P3R3URF microprotein: evidence for stable, independently functional expression
Iteration 1 — autonomous discovery report
Date: 2026-07-06
1. Summary (answer to the research question)
Human P3R3URF is a genuinely annotated and detectable upstream-ORF (uORF) microprotein:
UniProt A0A087WWA1 (P3R3URF_HUMAN), a reviewed (Swiss‑Prot), 95‑amino‑acid protein with
protein‑existence level PE1 ("Evidence at protein level"), a MANE‑Select transcript
(ENST00000506599.2) and a CCDS entry, plus cross‑references in mass‑spectrometry repositories
(PeptideAtlas, MassIVE, jPOST, PaxDb). So it passes the "translated + molecularly detected" bar.
However, there is essentially no direct evidence that it is an independently functional microprotein.
There is no dedicated primary‑literature characterization of P3R3URF (no PubMed paper reports its
Ribo‑seq initiation, ORF‑specific perturbation, endogenous tagging, localization, or interactors). Its
only functional annotation — "cytokine‑mediated signaling pathway" (GO:0019221) — is IBA (phylogenetic)
only, with zero P3R3URF‑specific experimental support, and is best explained as over‑transfer from the
adjacent/canonical PIK3R3 (p55‑gamma) family. Its expression is testis‑exclusive (Human Protein
Atlas: "tissue enriched", "detected in single", testis nTPM 133.6), the classic signature of
spermatogenesis transcriptional permissiveness, which lowers the prior for a conserved somatic function.
Net assessment: P3R3URF is a bona‑fide "peptidein" — evidence of synthesis but unresolved biological
status — and no molecular function or pathway role is currently supported by direct evidence.
2. Key findings (with evidence)
Finding 1 — Direct protein-level evidence: real, but only "detection", not function
- UniProt A0A087WWA1, reviewed/Swiss‑Prot, PE1 = evidence at protein level, 95 aa,
"PIK3R3 upstream open reading frame protein". HGNC:53451, NCBI GeneID 110117498, chr 1p34.1.
- Tracked as a real coding transcript: MANE‑Select ENST00000506599.2 + CCDS.
- MS support underpinning PE1: PeptideAtlas, MassIVE, jPOST, PaxDb cross‑references.
- ⚠️ Caveat: the two literature references on the entry are nucleotide‑level only —
PMID 16710414 (chr1 genomic sequence) and PMID 15489334 (MGC full‑length cDNA). The protein‑level
claim rests on high‑throughput MS repositories, not a targeted P3R3URF study. This is exactly the
regime the TransCODE consortium calls a "peptidein": evidence of synthesis but unresolved biological
status (review PMID 42392898; primary Deutsch et al. TransCODE study [uncached — not retrieved
here; verify PMID/DOI]). Community MS benchmarking cautions that unannotated‑microprotein MS calls need
careful validation (PMID 42230598).
Finding 2 — The cytokine-signaling annotation is phylogenetic over-transfer
- The sole GO term on P3R3URF is GO:0019221 "cytokine‑mediated signaling pathway", evidence
IBA (ECO:0000318), reference GO_REF:0000033, propagated from PANTHER ancestral node
PTN008494619 (with/from MGI:2385459). No EXP/IDA/IMP/IPI/IGI annotation exists.
- NCBI independently records it as "Predicted to be involved in cytokine‑mediated signaling pathway
[Alliance of Genome Resources]" — a prediction, not an observation.
- Interpretation: IBA = Inferred from Biological aspect of Ancestor. Because P3R3URF sits in/near the
PIK3R3 / p55‑gamma (PI3K regulatory subunit) family and shares its genomic locus, this is
phylogenetic over‑transfer from canonical PI3K‑regulatory‑subunit biology, not P3R3URF evidence.
Finding 3 — Testis-exclusive expression + strong PIK3R3 conflation risk
- Human Protein Atlas (ENSG00000250719): RNA specificity "Tissue enriched", distribution
"Detected in single", only tissue = testis (nTPM 133.6). This single‑tissue, testis‑restricted
pattern is the hallmark of the permissive transcriptional/translational environment of late
spermatogenesis, where many ORFs are expressed without demonstrable selected function.
- Conflation risk: P3R3URF is the uORF immediately 5′ of PIK3R3, and there is an annotated
read‑through locus P3R3URF‑PIK3R3. A separate TrEMBL entry F6TDL0 (507 aa, "Inferred from
homology") maps to the P3R3URF symbol but is auto‑annotated (ARBA) as "Phosphatidylinositol
3‑kinase regulatory subunit gamma / p55PIK" with an SH2 domain — i.e., the read‑through / p55‑gamma
protein mislabeled under the P3R3URF gene symbol. Any RNA‑seq, antibody, or "P3R3URF knockdown"
experiment therefore risks measuring canonical PIK3R3/p55‑gamma biology (well‑documented in cancer and
PI3K/AKT signaling: e.g., PMIDs 37212524, 35761259, 39862908) rather than the 95‑aa microprotein.
Finding 4 — Biophysics: extreme arginine-rich, low-complexity, likely disordered
- Sequence (95 aa):
MGPSRLVRGPRPQGMRSPYRRPGMGWPRPRFPRMFKCSRRRYQQGLRGRTASSAAINPATRAMGINNTHTDTTIVWIFPPQVLRHLRQPGIFLIL
- 17 Arg (18%), 1 Lys, 12 Pro (13%), 9 Gly; 18 basic vs 1 acidic → net charge ≈ +17.
N‑terminal ~40 aa are 50% R/K/P (low‑complexity, arginine/proline‑rich); C‑terminal 20 aa
(WIFPPQVLRHLRQPGIFLIL) are hydrophobic (mean Kyte–Doolittle +0.66). UniProt cross‑refs include
RNAct and AlphaFoldDB.
- Interpretation (hypothesis‑generating): this composition is typical of intrinsically disordered
microproteins (cf. review PMID 42247584) and is compatible with nucleic‑acid/RNA binding or a
nucleolar/RNA‑granule localization; the short C‑terminal hydrophobic patch could mediate
membrane/hydrophobic‑partner contacts. Not established — arginine‑rich low complexity is also common in
young/testis ORFs and is not itself evidence of function.
3. Supported vs refuted hypotheses
| Hypothesis |
Verdict |
Basis |
| P3R3URF is translated and detectable at the protein level |
Supported (direct) |
Swiss‑Prot PE1; MS repositories; MANE/CCDS |
| P3R3URF has a dedicated experimental characterization in the literature |
Refuted |
No PubMed paper reports P3R3URF‑specific function/Ribo‑seq/perturbation/tagging |
| The "cytokine‑mediated signaling" role is P3R3URF‑specific |
Refuted |
Only GO annotation is IBA phylogenetic (GO_REF:0000033, PANTHER PTN008494619); NCBI = "Predicted" |
| P3R3URF is testis‑enriched |
Supported (direct) |
HPA "tissue enriched / detected in single", testis nTPM 133.6 |
| Testis expression + locus proximity risk conflation with PIK3R3/p55‑gamma |
Supported |
Read‑through P3R3URF‑PIK3R3; TrEMBL F6TDL0 (507 aa) mislabeled as p55PIK under the P3R3URF symbol |
| P3R3URF is an established independently functional microprotein |
Not supported (no direct evidence) |
No interactors, localization, loss‑of‑function, or conservation‑of‑function data |
Direct P3R3URF evidence = PE1/MS detection + testis‑enriched expression + genomic uORF status.
Field-general inference only (NOT P3R3URF‑specific) = any claim of cytokine/PI3K signaling function,
disorder‑based RNA binding, or "microproteins are often functional regulators."
4. Experiments that would resolve whether P3R3URF is a real functional microprotein
- ORF‑specific Ribo‑seq / P‑site analysis in human testis/spermatid samples to confirm bona‑fide
initiation at the P3R3URF AUG independent of PIK3R3 CDS translation (and quantify translation
efficiency vs read‑through).
- Endogenous epitope tagging (CRISPR knock‑in of a small tag at the P3R3URF locus, respecting the
uORF/read‑through architecture) → immunofluorescence localization (nucleolus vs cytoplasm vs membrane)
and AP‑MS interactomics; test the arginine‑rich RNA/nucleic‑acid‑binding hypothesis via CLIP/RNA
pulldown.
- ORF‑specific perturbation that spares canonical PIK3R3: start‑codon mutation or frameshift confined
to the uORF, or targeting the P3R3URF‑unique 3′ region, with phenotyping in spermatogenesis models —
critical to avoid the PIK3R3/p55‑gamma conflation documented above.
- Evolutionary test of selected function: dN/dS and ORF‑conservation across mammals/primates; a young,
lineage‑restricted ORF under neutral evolution would argue for spermatogenesis "translational noise."
- Targeted MS with P3R3URF‑unique peptides (its sequence shares no tryptic peptides with p55‑gamma) to
independently confirm the endogenous microprotein and distinguish it from the read‑through product.
5. Limitations
- No wet‑lab data or omics files were provided; findings derive from curated resources
(UniProt/Swiss‑Prot, QuickGO, NCBI Gene/Alliance of Genome Resources, Human Protein Atlas) accessed
programmatically on 2026‑07‑06.
- PE1 status reflects MS detection, which does not establish function; MS calls for
small/basic peptides warrant orthogonal validation (PMID 42230598).
- The primary TransCODE "peptideins" study (Deutsch et al.) was not retrieved/cached here — cited
only via the review PMID 42392898; verify the primary PMID/DOI before quoting.
- HPA nTPM values summarize bulk‑testis RNA; single‑cell/spermatid‑stage resolution was not directly
confirmed in this iteration.
Key identifiers
- UniProt (microprotein): A0A087WWA1 — reviewed, PE1, 95 aa
- UniProt (read‑through/p55γ mislabel): F6TDL0 — TrEMBL, 507 aa, "inferred from homology"
- HGNC: HGNC:53451 · NCBI Gene: 110117498 · Ensembl gene ENSG00000250719 · transcript
ENST00000506599.2 (MANE‑Select)
- GO: GO:0019221 cytokine‑mediated signaling — IBA only (GO_REF:0000033; PANTHER PTN008494619)
- Nucleotide references: PMID 16710414, PMID 15489334
- Field context (cited, cached): PMID 42392898 (peptideins/TransCODE review), PMID 42230598
(MS microprotein benchmarking), PMID 42247584 (disordered microproteins)
- PIK3R3 canonical biology (conflation context): PMID 37212524, 35761259, 39862908