AADACL2: is the esterase call founded, and which of its two localisations is?

Reproduce with uv run --no-project --with requests --with biopython python audit_aadacl2_record.py.
Every number below is fetched at run time from the UniProt, InterPro, QuickGO, EBI Proteins
and Human Protein Atlas REST APIs, plus this gene's own AADACL2-goa.tsv; if that TSV is
missing the script aborts with the regeneration command rather than dropping a section.
Machine-readable output is in results.json. This file is prose written from that file.

Run date: 2026-07-25.

The record being audited

Seven GOA rows, no experimental evidence of any kind: 2 IBA and 5 IEA. Three rows assert an
activity at three different levels of generality (GO:0003824 catalytic activity,
GO:0016787 hydrolase activity twice, GO:0052689 carboxylic ester hydrolase activity),
and three rows assert a location — two of which cannot both be true (GO:0016020 membrane
twice, GO:0005576 extracellular region).

1. The catalytic machinery is intact, and it is not just the fold

(script section Q1)

AADACL2's own UniProt record annotates active sites at 189, 341 and 371, which are
Ser, Asp, His — a serine-hydrolase catalytic triad — plus an oxyanion-hole motif at
111-113 (HGG). A motif scan of the sequence finds one GDXG nucleophile elbow,
GDSSG at 187-191, placing Ser189 at the elbow apex, and the record carries the PROSITE
PS01174 GDXG-lipase serine signature.

Those are UniProt's own assertions, several of them ECO:0000250 (by similarity), so they
are not independent of the family. The reciprocal test is stronger: align AADACL2 to each
experimentally characterised protein cited in its own GOA WITH/FROM column, and ask what
AADACL2 carries at that protein's annotated active-site positions. A hit only counts if the
residue is identical and the mapped position is one of AADACL2's own annotated sites —
at 20% identity a global alignment will happily park a source Asp on some unrelated Asp.

Source (GOA WITH/FROM) % identity to AADACL2 triad maps onto S189/D341/H371
AADAC, Homo sapiens (P22760) 51.6 yes
Aadac, Mus musculus 51.5 yes
Aadac, Rattus norvegicus 50.0 yes
Nceh1, Mus musculus 38.4 yes
NlhH carboxylesterase, M. tuberculosis (P9WK87) 35.7 yes
LipI esterase, M. tuberculosis (P71668) 32.2 yes
CXE18 carboxylesterase, A. thaliana 28.7 yes
LipN carboxylesterase, M. tuberculosis (P95125) 26.1 yes
CXE12, ICME, Afmid, BNA7, Aes, HIDH 19.7-26.5 no

Eight of the fifteen sources with annotated active sites map all three residues onto
AADACL2's own annotated triad
, and they are essentially the closest ones: the seven
highest-identity sources all corroborate, and so does LipN at 26.1%. Every source that fails
lies at 26.5% identity or below, which is where this global alignment loses register in the
C-terminal half (for Afmid and Aes the source His has no aligned partner at all). The failures
are therefore alignment artefacts, not evidence of residue loss.

Broken down by position, the aggregate understates the nucleophile badly:

AADACL2 position residue sources aligning here with the identical residue
189 Ser 15 / 15 14 / 15
341 Asp 8 / 15 8 / 15
371 His 8 / 15 8 / 15

Every one of the fifteen sources places its own catalytic nucleophile on AADACL2 position
189
, and fourteen of them carry a serine there. The single exception is soybean HIDH, whose own
annotated nucleophile is a threonine — and HIDH is the one source in the set whose
physiologically important reaction is a dehydration rather than a hydrolysis, so the
substitution is informative rather than noise. (HIDH is bifunctional, not a pure lyase: it
carries EC 3.1.1.1 alongside EC 4.2.1.105 and a GO:0106435 carboxylesterase activity IDA, so
it does not threaten GO:0016787 — it refutes only the serine mechanism term. See
NODE_PTN009058710.md, the shared node-level audit for AADACL2, AADACL3 and AADACL4.) The
8/15 triad-complete figure is driven entirely by the acid and the base, which sit in the
C-terminal half where register is lost below 26.5% identity. The nucleophile elbow, the most
conserved element of the fold, never loses register.

So this is not a case of a family name propagating onto a fold-only relic: the nucleophile,
the acid, the base and the oxyanion loop are all present and all in register with three
independently characterised bacterial carboxylesterases and with the 51.6%-identical human
paralog AADAC. GO:0017171 serine hydrolase activity — whose definition requires exactly a
serine nucleophile activated by an acid/base proton relay — is the term this evidence
licenses for AADACL2 itself. Nothing here identifies a substrate, and nothing here licenses
the term on the PTN009058710 IBA row: that row's donors include a threonine-nucleophile
member, so the term has to be reached from the family node instead (section 5, and
NODE_PTN009058710.md).

2. GO:0016020 membrane is a family-majority feature that AADACL2 alone lacks

(script section Q2, with the WITH/FROM resolution from Q3)

GO:0016020 is asserted twice: once by PANTHER (IBA, PTN009058713) and once by
InterPro/ARBA (IEA, IPR017157 = Arylacetamide deacetylase, plus ARBA00028763).
Tabulating every reviewed UniProtKB entry carrying IPR017157:

N-terminal feature count
TRANSMEM 12
cleaved SIGNAL and no TRANSMEM 1 — AADACL2 (human)
neither 1 — AADACL3 (human)

Eleven of the twelve transmembrane segments are annotated explicitly as
"Helical; Signal-anchor for type II membrane protein"; the exception is mouse Aadacl3, which
carries three plain helices. Of the 14 reviewed members, AADACL2 is the only one whose
N-terminal hydrophobic segment UniProt calls a cleaved signal peptide. Its three WITH/FROM protein sources for the
membrane IBA are all type-II signal-anchored: human AADAC (TRANSMEM 6-23), mouse Aadac
(6-26) and mouse Nceh1 (5-25). So the membrane claim is a transfer of a feature that
AADACL2's own record says it does not have.

3. But the sequence does not actually settle it, and this is the interesting part

(script sections Q5 and Q4)

The tempting conclusion — "membrane is a paralog artefact, secreted is right" — does not
survive measurement. UniProt puts the cleavage site after residue 18, giving
(-3,-1) = V-S-H: histidine at -1, which is not a residue signal peptidase I accepts
(the -1 position is small and neutral, A/S/C/G/T, in the overwhelming majority of sites).
And the hydrophobic core itself is indistinguishable from the validated anchors. Peak mean
Kyte-Doolittle hydropathy over a 19-residue window in the N-terminal 45 residues, measured
identically for all five human family members:

protein UniProt N-terminal call peak KD-19 window peak mean KD
AADAC TRANSMEM 6-23, type II signal anchor (experimentally validated) 5-23 1.81
AADACL2 SIGNAL 1-18, cleaved 1-19 1.94
NCEH1 TRANSMEM 5-25, type II signal anchor 5-23 2.08
AADACL3 none 6-24 2.50
AADACL4 TRANSMEM 5-25, type II signal anchor 6-24 2.80

AADACL2's segment (1.94) is more hydrophobic than AADAC's experimentally confirmed
signal anchor (1.81). Hydropathy cannot distinguish them, and the N-termini are homologous
across the whole segment (MGLKALCLGLLCVLFVSHFYTPMPDNIEESWKIM in AADACL2 against
MGRKSLYLLIVGILIAYYIYTPLPDNVEEPWRMM in AADAC, same position, same downstream
TP.PDN.EE.W motif). This is the classic signal-peptide / type-II-signal-anchor ambiguity,
and UniProt has resolved it one way for AADACL2 and the other way for its four paralogs.

The Human Protein Atlas, whose protein-class assignment is a majority vote over several
secretome and membrane predictors, does place AADACL2 — and only AADACL2 — in the secreted
class:

protein HPA protein class RNA tissue distribution
AADAC Enzymes; Metabolic; Predicted intracellular detected in many (liver 884 nTPM)
NCEH1 Enzymes; Predicted intracellular; Predicted membrane detected in all
AADACL2 Predicted secreted detected in single (skin, 10.1 nTPM)
AADACL3 Predicted membrane detected in some (skin 3.0, placenta 1.5)
AADACL4 Predicted membrane detected in single (choroid plexus 1.7)

That discrimination is suggestive but it is not independent corroboration, for two reasons:
these predictors are SignalP-family tools of the same kind that produced UniProt's call, and
HPA's membrane classifier fails to recognise AADAC, an experimentally validated
single-pass type-II ER membrane protein, as a membrane protein at all. A classifier that
misses one of the family's two experimentally validated membrane proteins cannot be used to
argue that AADACL2 is a negative.

4. Mass spectrometry does not adjudicate it either

(script section Q7)

AADACL2 is PE 1: Evidence at protein level, so it is worth asking what the peptides
covered. Four observed peptides are recorded (PeptideAtlas, ProteomicsDB):

residues peptide source
124-130 AFDFLNR ProteomicsDB
214-233 MQVLLYPGLQITDSYLPSHR PeptideAtlas
294-316 DYVYTEPILGGLSYSLPGLTDSR PeptideAtlas
345-353 DDGLMYVTR PeptideAtlas, ProteomicsDB

The earliest observed residue is 124. No peptide spans the annotated cleavage site and
none starts at the putative mature N-terminus (residue 19). Detection establishes that the
protein is made; it says nothing about whether the N-terminal helix is removed. The
localisation question is genuinely open, not merely under-curated.

5. The PANTHER node placement is inverted

(script section Q6)

Comparing the IBA annotations of all five human family members and the node each was
transferred from:

term AADAC NCEH1 AADACL2 AADACL3 AADACL4
GO:0017171 serine hydrolase activity PTN002745055 PTN002745068 — — —
GO:0005789 endoplasmic reticulum membrane PTN002745055 — — — —
GO:0016787 hydrolase activity — — PTN009058710 PTN009058710 PTN009058710
GO:0016020 membrane — PTN009058713 PTN009058713 PTN009058713 PTN009058713

The mechanistic molecular function sits only at the two ortholog-specific nodes
(PTN002745055 for AADAC, PTN002745068 for NCEH1), so AADACL2/3/4 inherit nothing from
it. What they do inherit at the shared family node PTN009058713 is GO:0016020 membrane.
Meanwhile their only molecular function comes from the much deeper node PTN009058710,
whose 16 protein sources span three Arabidopsis CXE carboxylesterases and the Arabidopsis
isoprenylcysteine methylesterase ICME, mouse Afmid, yeast BNA7, E. coli Aes, three
M. tuberculosis esterases and soybean HIDH — a node so broad that bare hydrolase activity is all it can safely carry (only 5 of those 16 sources have any transmembrane
segment, which is why the membrane call could not have come from here).

The placement is the wrong way round with respect to what actually transfers. The catalytic
triad is demonstrably conserved across the whole family including AADACL2 (Q1), so
GO:0017171 is safe at PTN009058713; the type-II signal anchor is not conserved in
AADACL2, so GO:0016020 is not. Moving the activity down to the family node and dropping
the localisation from it would fix three human genes at once.

Both halves of that claim were then tested donor by donor in NODE_PTN009058710.md, the
shared node-level audit for AADACL2, AADACL3 and AADACL4. It confirms that GO:0017171 is
true of every donor PAINT cites at PTN009058713 and IDA-supported by all three of them,
and that at
PTN009058710 no candidate term below GO:0016787 survives every donor — so the deep-node
row cannot be upgraded, only recognised as redundant with the IPR017157-derived
GO:0052689 that all three genes already carry.