Focus type: function_assignment
Hypothesis slug: conditional-proapoptotic-and-channel-capacities
Source file: genes/human/BCL2/BCL2-ai-review.yaml
Executive verdict: PARTIALLY SUPPORTED. The seed hypothesis makes two distinct
claims about human BCL2 — (1) that it can positively regulate apoptosis after
caspase cleavage or conformational conversion, and (2) that it can form functional
channels/pores contributing to transmembrane transport. Both claims are backed by
direct primary experimental data, but in each case the activity is conditional,
in-vitro or context-restricted, and mechanistically distinct from BCL2's predominant
native antiapoptotic function. The correct curation posture is therefore retain
with qualifiers, not reject, and not promote to core function.
The proapoptotic capacity is real but proteoform- and context-dependent. BCL2 becomes
a death effector in two mechanistically separate ways. First, caspase-3 cleaves BCL2 at
Asp34, and the resulting C-terminal cleavage fragment — not the intact native
protein — behaves like a Bax-like killer that triggers cell death via its BH3 and
transmembrane domains (PMID:9395403(https://pubmed.ncbi.nlm.nih.gov/9395403/)).
Second, the intact full-length protein can be converted from protector to killer by
binding the orphan nuclear receptor Nur77/TR3, which induces a conformational change
exposing the BH3 domain (PMID:14980220(https://pubmed.ncbi.nlm.nih.gov/14980220/)).
The gene product that performs the proapoptotic step is thus either a processed fragment
or a conformationally altered complex, not the resting antiapoptotic conformer.
The channel/transport capacity is likewise genuine but restricted. Purified recombinant
BCL2 forms discrete, cation-selective ion-conducting channels in planar lipid bilayers,
and this requires the core hydrophobic h5–h6 helices
(PMID:9144199(https://pubmed.ncbi.nlm.nih.gov/9144199/)). However, its
membrane-permeabilizing pore activity is only observed at acidic pH on acidic lipids
(PMID:9219694(https://pubmed.ncbi.nlm.nih.gov/9219694/)), and at physiological pH its
dominant transport-related role is the opposite — inhibiting other channels, blocking
Bax channel activity (PMID:9219694(https://pubmed.ncbi.nlm.nih.gov/9219694/)) and
reducing IP3 receptor open probability
(PMID:15263017(https://pubmed.ncbi.nlm.nih.gov/15263017/)). Both the channel-activity
(MF) and positive-regulation-of-apoptosis (BP) GO terms already exist on BCL2, and
the channel-activity IBA is supported by direct experimental (IDA) annotations across the
Bcl-2 family (BCL2, BAX, BAK1), so the ancestral GO_Central inference should not be
rejected on family-role-exclusivity grounds.
Cheng et al. 1997 (PMID:9395403(https://pubmed.ncbi.nlm.nih.gov/9395403/), Conversion
of Bcl-2 to a Bax-like death effector by caspases, Science) demonstrated that the
flexible loop of BCL2 is cleaved at Asp34 by caspase-3. This cleavage was observed in
vitro with recombinant caspase-3, in caspase-3-overexpressing cells, and during
physiological apoptosis (Fas ligation and IL-3 withdrawal). The critical mechanistic
point is that proapoptotic activity is a property of the cleavage product, not the
intact native protein:
"The carboxyl-terminal Bcl-2 cleavage product triggered cell death and accelerated
Sindbis virus-induced apoptosis, which was dependent on the BH3 homology and
transmembrane domains of Bcl-2." — PMID:9395403(https://pubmed.ncbi.nlm.nih.gov/9395403/)
Importantly, cleavage-resistant Asp34 mutants showed increased protection against
apoptosis, confirming that removing the cleavage site removes a proapoptotic liability.
This establishes a clean answer to one of the seed's discriminating questions: the gene
product that performs the proapoptotic step is the C-terminal caspase fragment, which
acts through the conserved BH3 and transmembrane domains, functionally converting BCL2
into a Bax-like effector. This is a feed-forward amplification mechanism, not the
resting function.
Lin et al. 2004 (PMID:14980220(https://pubmed.ncbi.nlm.nih.gov/14980220/), Conversion
of Bcl-2 from protector to killer by interaction with nuclear orphan receptor
Nur77/TR3, Cell) showed a second, cleavage-independent route to proapoptotic activity.
The orphan nuclear receptor Nur77/TR3 binds the N-terminal loop of BCL2, and:
"Nur77 binding induces a Bcl-2 conformational change that exposes its BH3 domain,
resulting in conversion of Bcl-2 from a protector to a killer." — PMID:14980220(https://pubmed.ncbi.nlm.nih.gov/14980220/)
Here the same full-length gene product (no proteolysis) acquires proapoptotic
activity through an induced conformational change that unmasks its BH3 domain and targets
Nur77 to mitochondria. This is significant for curation because it shows the proapoptotic
capacity is intrinsic to the folded protein under the right partner/conformational
context — it does not strictly require caspase processing. Together, Findings 1 and 2
establish two independent, experimentally validated conditional proapoptotic mechanisms.
Schendel et al. 1997 (PMID:9144199(https://pubmed.ncbi.nlm.nih.gov/9144199/), Channel
formation by antiapoptotic protein Bcl-2, PNAS) provided direct biophysical evidence
that purified recombinant BCL2 has intrinsic channel-forming activity:
"In planar lipid bilayers, where detection of single channels is possible, Bcl-2
formed discrete ion-conducting, cation-selective channels, whereas the Bcl-2
(Deltah5, 6) mutant did not." — PMID:9144199(https://pubmed.ncbi.nlm.nih.gov/9144199/)
Single-channel conductance was 18 ± 2 pS in 0.5 M KCl at pH 7.4, with larger 41 and 90 pS
substates, and the activity required the core hydrophobic h5–h6 helices (the Δh5,6 mutant
was inactive). This structurally maps the channel to the same pore-forming module shared
across the Bcl-2 fold and the bacterial pore-forming toxins (diphtheria toxin, colicins).
However, the membrane-permeabilizing (pore/efflux) activity is strongly restricted.
Antonsson et al. 1997 (PMID:9219694(https://pubmed.ncbi.nlm.nih.gov/9219694/),
Inhibition of Bax channel-forming activity by Bcl-2) found that:
"Bcl-2, in contrast, triggered carboxyfluorescein release at acidic pH only." —
PMID:9219694(https://pubmed.ncbi.nlm.nih.gov/9219694/)
and, critically, that at physiological pH BCL2 blocks Bax channel activity rather than
forming its own permeabilizing pore. This directly answers the seed's discriminating
question about whether transport evidence reflects intrinsic pore formation or regulation
of another channel: both are documented, but the physiologically dominant activity is
channel regulation/inhibition, not intrinsic permeabilization. This is reinforced by
Chen et al. 2004 (PMID:15263017(https://pubmed.ncbi.nlm.nih.gov/15263017/)), which
showed BCL2 reduces the open probability of IP3 receptor Ca²⁺ channels reconstituted in
bilayers, again an inhibitory/regulatory role.
Paralog evidence supports an ancestral channel-forming capacity of the fold: Minn et al.
1997 (PMID:9002522(https://pubmed.ncbi.nlm.nih.gov/9002522/)) showed Bcl-xL forms
ion-conducting channels in synthetic membranes:
"Like the bacterial toxins, Bcl-xL can insert into either synthetic lipid vesicles or
planar lipid bilayers and form an ion-conducting channel." —
PMID:9002522(https://pubmed.ncbi.nlm.nih.gov/9002522/)
Comparison of UniProt sequences P10415 (human, 239 aa) and P10417 (mouse, 236 aa) shows
that the structural determinants of both conditional activities are conserved. The
caspase-3 cleavage motif DAGD (D31-A32-G33-D34) is fully conserved (residue 34 = Asp in
both species), and the core hydrophobic h5–h6 channel-forming region (~res 140–200) is
essentially identical:
| Feature | Human (P10415) | Mouse (P10417) | Conserved? |
|---|---|---|---|
| Length | 239 aa | 236 aa | — |
| Caspase site (res 25–45) | QRGYEWDAGDVGAAPPGAAPA | QRGYEWDAGDADAAPLGAAPT | Asp34 conserved |
| h5–h6 core (~140–200) | DGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVE | NWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYG | Essentially identical |
This means the capacity to be cleaved into a Bax-like fragment and to form a channel is
sequence-encoded in mouse Bcl2, but this is inference from conservation only —
species-specific primary functional support in mouse was not established in this
investigation.
QuickGO for UniProtKB:P10415 (248 annotations) shows the relevant terms are already
present:
| GO term | Aspect | Evidence on BCL2 | Notes |
|---|---|---|---|
| GO:0015267 channel activity | MF | IBA (GO_REF:0000033) + IDA (PMID:9219694) | Ancestral + direct |
| GO:0016248 channel inhibitor activity | MF | IDA (PMID:9219694) | Regulatory role |
| GO:0055085 transmembrane transport | BP | IEA (GO_REF:0000108) | Electronic only |
| GO:0043065 positive regulation of apoptotic process | BP | IBA + NAS (PMID:14634621) | No IDA; neither PMID:9395403 nor 14980220 cited |
| GO:0043066 negative regulation of apoptotic process | BP | ~14 annotations incl. IDA/IMP | Predominant native role |
| GO:0046902 reg. mitochondrial membrane permeability | BP | ISS (PMID:9843949) | — |
| GO:0051924 regulation of calcium ion transport | BP | IDA (PMID:8022822) | — |
The predominant native antiapoptotic role (GO:0043066) is much more heavily and directly
supported (~14 annotations, many IDA/IMP) than the proapoptotic role, confirming that
positive regulation of apoptosis is a minority, conditional annotation. Notably, the
two strongest primary proapoptotic papers (PMID:9395403, PMID:14980220) are not cited
on the positive-regulation term — they are candidate IDA additions.
QuickGO across the Bcl-2 family for GO:0015267 channel activity:
| Gene | UniProt | Channel activity evidence |
|---|---|---|
| BCL2 | P10415 | IBA + IDA (PMID:9219694) |
| BAX | Q07812 | IBA + IDA (PMID:9219694) |
| BAK1 | Q16611 | IBA + IDA (PMID:22006182) |
| BCL2L1 (Bcl-xL) | Q07817 | IBA (+ bilayer data PMID:9002522) |
Multiple family members carry direct experimental (IDA) channel-activity annotations.
The GO_Central ancestral (IBA) inference on BCL2 therefore rests on real descendant
experimental evidence, not paralog guesswork. This directly addresses the seed's
instruction not to reject ancestral assertions on family-role-exclusivity or absent-assay
grounds alone: the ancestral node placement is legitimate.
BCL2 is fundamentally an antiapoptotic guardian whose resting conformation sequesters
proapoptotic BH3-containing effectors and inhibits other channels. The seed hypothesis's
two "conditional capacities" are best understood as state-switches away from this
default:
┌─────────────────────────────────────────────┐
│ NATIVE / RESTING BCL2 (core) │
│ • Antiapoptotic (GO:0043066, IDA-rich) │
│ • Blocks Bax channel @ physiological pH │
│ • Inhibits IP3R Ca2+ channel (GO:0016248) │
└───────────────┬─────────────────────────────┘
│
┌──────────────────────────┼──────────────────────────┐
│ CASPASE-3 @ Asp34 │ Nur77/TR3 binding │ Acidic pH +
│ (proteolysis) │ (conformational) │ acidic lipid
▼ ▼ ▼
┌────────────────────┐ ┌──────────────────────────┐ ┌────────────────────┐
│ C-TERMINAL FRAGMENT│ │ BH3-EXPOSED FULL-LENGTH │ │ INTRINSIC PORE │
│ Bax-like killer │ │ protector→killer │ │ (CF release) │
│ needs BH3 + TM │ │ mito-targets Nur77 │ │ in-vitro only │
│ PMID:9395403 │ │ PMID:14980220 │ │ PMID:9219694/9144199│
│ → GO:0043065 (+apop)│ │ → GO:0043065 (+apop) │ │ → GO:0015267 │
└────────────────────┘ └──────────────────────────┘ └────────────────────┘
Which gene product performs the proapoptotic step? Two answers, both correct in their
context: (i) the C-terminal caspase-3 fragment (a distinct proteoform), and (ii) the
Nur77-complexed, BH3-exposed full-length conformer. Neither is the resting
antiapoptotic species. This is the key qualifier for any positive-regulation-of-apoptosis
annotation.
Is transport evidence intrinsic pore formation or channel regulation? Both are
experimentally documented, but they operate under different conditions. Intrinsic
cation-selective channel formation is demonstrable for purified BCL2 in bilayers
(pH 7.4), and pore/permeabilization activity appears only at acidic pH on acidic lipids.
Under physiological conditions the dominant, biologically relevant transport role is
negative regulation of other channels (Bax, IP3R). The MF term GO:0015267 (channel
activity) is thus valid as an intrinsic capacity, but the physiological narrative is
better captured by the co-existing GO:0016248 (channel inhibitor activity).
| Citation | Evidence type | Stance | Claim tested | Key finding | Context | Confidence / limitations |
|---|---|---|---|---|---|---|
| PMID:9395403(https://pubmed.ncbi.nlm.nih.gov/9395403/) | Direct assay + mutant phenotype | Supports (qualifies) | Proapoptotic after caspase cleavage | Caspase-3 cleaves BCL2 at Asp34; C-terminal fragment triggers death via BH3+TM; cleavage-resistant mutant is more protective | Human, in vitro + cell lines (Fas, IL-3 withdrawal, Sindbis) | High; activity is of the fragment, not intact protein |
| PMID:14980220(https://pubmed.ncbi.nlm.nih.gov/14980220/) | Direct assay + interaction | Supports (qualifies) | Proapoptotic via conformational conversion | Nur77/TR3 binds N-loop, exposes BH3, converts protector→killer | Human cancer cells, mitochondria | High; requires Nur77 partner/context |
| PMID:9144199(https://pubmed.ncbi.nlm.nih.gov/9144199/) | Direct assay (biophysical) | Supports (qualifies) | Intrinsic channel formation | Purified BCL2 forms cation-selective channels (18 pS); Δh5,6 mutant inactive | In vitro planar bilayer, pH 7.4 | High for capacity; physiological relevance uncertain |
| PMID:9219694(https://pubmed.ncbi.nlm.nih.gov/9219694/) | Direct assay | Qualifies / competing | Pore vs channel regulation | BCL2 permeabilizes only at acidic pH; at physiological pH it BLOCKS Bax channel | In vitro vesicles/bilayers | High; establishes regulatory dominance |
| PMID:9002522(https://pubmed.ncbi.nlm.nih.gov/9002522/) | Structural/evolutionary (paralog) | Supports | Ancestral channel capacity of fold | Bcl-xL forms ion-conducting channel like bacterial toxins | In vitro | High; paralog, not BCL2 directly |
| PMID:15263017(https://pubmed.ncbi.nlm.nih.gov/15263017/) | Direct assay + interaction | Competing (regulatory) | Transport = channel regulation | BCL2 reduces IP3R open probability; forms complex with IP3R | WEHI7.2 T cells, bilayers | High; supports inhibitory role |
| UniProt P10415/P10417 | Computational (sequence) | Supports (inference) | Mouse conservation | Asp34 motif + h5–h6 core conserved human↔mouse | Sequence | Moderate; conservation ≠ function |
| QuickGO P10415 | Review/database | Orientation | GO term existence | Both MF channel + BP positive-apoptosis terms already annotated | Database | High for annotation status |
| QuickGO family (BAX/BAK1/BCL2L1) | Review/database | Supports | Descendant support for IBA | Family members carry direct IDA channel annotations | Database | High; validates ancestral node |
Lead action (requires curator verification): RETAIN both terms with conditional/
non-core qualifiers; do NOT remove on family-role-exclusivity grounds.
GO:0015267 channel activity (MF) — Retain. It carries both an IBA (ancestral,
descendant-supported by BAX/BAK1 IDA) and a direct IDA (PMID:9219694). The intrinsic
channel-forming capacity is directly demonstrated for purified BCL2 (PMID:9144199).
Curators may consider adding a note that permeabilization is pH/lipid-restricted and
that the physiologically dominant transport role is inhibitory.
GO:0016248 channel inhibitor activity (MF) — Retain and emphasize. This
IDA-supported term (PMID:9219694, plus IP3R inhibition PMID:15263017) better captures
the physiological transport-related function than intrinsic pore formation.
GO:0043065 positive regulation of apoptotic process (BP) — Retain, but currently
under-supported at the primary level. It has an IBA and an NAS (PMID:14634621) but no
IDA. Candidate IDA additions: PMID:9395403 (caspase fragment) and PMID:14980220
(Nur77 conversion), each with a proteoform/context qualifier. Because the proapoptotic
activity belongs to a distinct proteoform (caspase fragment) or an induced conformer,
the annotation should carry qualifiers noting it is not the resting-state activity.
GO:0055085 transmembrane transport (BP) — currently IEA only; the direct evidence
points more to channel activity (MF) and regulation of transport than to BCL2
itself being a bulk transporter. Treat as non-core / low priority.
Do not reject the ancestral (IBA) assertions using the argument that BCL2 is
"an antiapoptotic protein so it cannot be proapoptotic or a channel." The seed's
caution is correct: the PAINT node is descendant-supported, and both capacities have
direct BCL2 primary evidence.
The predominant native role — GO:0043066 negative regulation of apoptotic process —
remains the core function and is far more strongly (IDA/IMP) supported; nothing here
challenges that.
The immediate molecular functions being tested are: (i) BH3-mediated proapoptotic
effector activity exposed by cleavage or conformational change, and (ii) intrinsic ion
channel/pore formation in lipid membranes. Both are direct gene-product activities, but
each is gated by a specific molecular state (proteolytic fragment, partner-induced
conformer, or acidic membrane environment). These must be separated from downstream
phenotypes such as mitochondrial outer membrane permeabilization, cytochrome c release,
and cell death, which are pathway consequences rather than the immediate BCL2 activity.
The proapoptotic annotation is a state-specific molecular capacity, not a constitutive
function or a mere loss-of-function phenotype.
Physiological relevance of intrinsic pore. Checked: PMID:9144199, 9219694.
Gap: whether BCL2's intrinsic channel/pore ever forms under physiological pH in
vivo, versus being an in-vitro property. Resolve: single-molecule/electrophysiology
in native mitochondrial membranes at physiological pH; conditional pore-dead h5–h6
mutants.
In vivo contribution of the caspase fragment. Checked: PMID:9395403 (cells +
in vitro). Gap: quantitative contribution of the Asp34 fragment to apoptosis
amplification in normal physiology. Resolve: Asp34→Ala knock-in mouse phenotyping.
Generality of Nur77 conversion. Checked: PMID:14980220. Gap: whether BH3
exposure by Nur77 occurs broadly or only in specific cell types/stimuli. Resolve:
conformation-specific (BH3-exposed) antibodies across tissues.
Mouse functional support. Checked: sequence conservation only. Gap: no mouse
primary functional assays reviewed. Resolve: mouse Bcl2 caspase-cleavage and
Nur77-conversion assays.
PAINT node placement details. Checked: QuickGO IBA/IDA distribution across
family. Gap: the exact ancestral node and loss/divergence pattern were inferred from
annotation presence, not from direct inspection of the PANTHER tree. Resolve:
consult the PANTHER family tree / PAINT annotations directly.
The hypothesis is partially supported. Both the conditional proapoptotic capacity and
the channel/pore capacity of human BCL2 are backed by direct primary experimental data,
but each is a conditional, non-core capacity distinct from BCL2's predominant native
antiapoptotic function. The proapoptotic step is performed by either the caspase-3
C-terminal fragment (PMID:9395403) or the Nur77-converted, BH3-exposed conformer
(PMID:14980220) — not the resting protein. Intrinsic channel formation is real
(PMID:9144199) but permeabilization is acidic-pH/lipid-restricted; at physiological pH the
dominant transport role is channel inhibition (PMID:9219694, PMID:15263017). The
corresponding GO terms already exist, are descendant-supported for the ancestral IBA, and
should be retained with conditional/non-core qualifiers rather than removed. The two
direct proapoptotic papers are strong candidate IDA additions, and mouse extension is
supported only at the sequence level.