NQO2 (P16083) — Function-Assignment Hypothesis Review

Hypothesis: NQO2 has NAD(P)H dehydrogenase (quinone) activity (GO:0003955).
Focus: function_assignment · existing IBA annotation (GO_REF:0000033) · slug function-hypothesis-go-0003955
Gene: human NQO2 / UniProt P16083

Executive Judgment

Verdict: Over-annotated → recommend REMOVAL of the IBA GO:0003955 (activity real, but this specific term is substrate-incorrect and redundant).

NQO2 is unequivocally a flavin-dependent, two-electron quinone reductase, so the quinone-reductase concept is correct. But the specific term GO:0003955 "NAD(P)H dehydrogenase (quinone) activity" (reaction: NAD(P)H + quinone → NAD(P)⁺ + quinol) makes a cofactor/substrate claim that NQO2 does not satisfy. The definitive enzymology (Wu et al., 1997, PMID:9367528) shows NQO2 "uses dihydronicotinamide riboside (NRH) rather than NAD(P)H as an electron donor." UniProt (P16083) codifies this as EC 1.10.5.1; the NAD(P)H reaction (EC 1.6.5.2) belongs to the paralog NQO1 (P15559).

Two ontology facts (verified via QuickGO this iteration) make the recommendation removal rather than generalization:
1. The biochemically exact term GO:0001512 "dihydronicotinamide riboside quinone reductase activity" (NRH + quinone → nicotinamide riboside + hydroquinone) is already annotated to NQO2 with experimental evidence — IDA, PMID:18254726 (plus IEA GO_REF:0000120).
2. GO:0003955 is NOT an is_a ancestor of GO:0001512. They are siblings in different oxidoreductase subtrees, so GO:0003955 cannot be defended as a merely-less-specific but still-true parent. It is a distinct, incorrect molecular function.

The IBA is therefore a paralog over-annotation (GO:0003955 native to NQO1, propagated across the shared PANTHER family via GO_REF:0000033), and it is both wrong on substrate and redundant with the correct experimental term.

Most important caveat: Do not delete NQO2's reductase function from the model — it is captured accurately by GO:0001512. The action is limited to the mis-specified IBA row.

Evidence Matrix

GO Curation Implications

Lead (requires curator verification):

• Molecular Function — REMOVE the IBA GO:0003955 from NQO2 (or mark NOT / do-not-propagate). It asserts NAD(P)H substrate that NQO2 cannot use and is a paralog carry-over from NQO1.
• Retain the already-present GO:0001512 "dihydronicotinamide riboside quinone reductase activity" (IDA, PMID:18254726) as the accurate leaf MF term. No new term needs to be created.
• Because GO:0003955 is a sibling (not ancestor) of GO:0001512, keeping it is not a harmless generalization — it introduces a false substrate assertion into the model.
• Broader true ancestors already annotated (GO:0016491 oxidoreductase activity; GO:0016661 acting on other nitrogenous donors; GO:0009055 electron transfer activity; GO:0048038 quinone binding; GO:0071949 FAD binding; GO:0008270 zinc ion binding) remain valid. Avoid defaulting to generic "protein binding."

GO decision table

{{figure:NQO2_GO_decision_table.png|caption=GO molecular-function decision table for NQO2 (P16083). GO:0003955 "NAD(P)H dehydrogenase (quinone) activity" (IBA, GO_REF:0000033) is substrate-incorrect (NQO2 uses NRH, not NAD(P)H; PMID:9367528) and redundant with the already-annotated, experimentally-supported GO:0001512 "dihydronicotinamide riboside quinone reductase activity" (IDA, PMID:18254726). Recommended action: remove GO:0003955; retain GO:0001512.}}

Mechanistic Scope

• Immediate molecular function tested: FAD-mediated two-electron reduction of quinones to hydroquinones, electrons supplied by a dihydronicotinamide riboside (NRH) donor in a ping-pong mechanism; Zn²⁺ is structural.
• Correctly in scope: quinone reduction (menadione and other quinones, estrogen o-quinones, vitamin K quinones), NRH-dependent nitroreduction (CB1954). Captured by GO:0001512.
• Out of scope for this MF term (BP/CC or ligand-binding): neuronal "memory constraint"/metabolic-buffer role (Rosenblum lab), Alzheimer's phenotype modulation, melatonin MT3 binding-site identity (GO:1904408) and resveratrol binding (GO:1905594). These are downstream physiology or ligand properties, not the electron-donor chemistry adjudicated here.

Conflicts and Alternatives

• Paralog confusion (primary): GO:0003955 is correct for NQO1 (EC 1.6.5.2, NADH/NADPH). Its presence on NQO2 is explained by IBA propagation, not NQO2 biochemistry. Structural basis: NQO2 (231 aa) lacks the ~43-residue C-terminal region present in NQO1 (274 aa) that helps form the adenosine/2′-phosphate NAD(P)H-binding site, so NQO2 uses the smaller NRH.
• In-vitro cofactor surrogates: NQO2 assays use synthetic donors (BNAH; EP-0152R) because free NRH is not a standard bulk metabolite; consistent with EC 1.10.5.1, not with NAD(P)H use.
• No credible primary report shows efficient NAD(P)H-driven catalysis by NQO2.
• Self-correction: Iteration 1 tentatively named the replacement term GO:0033856; that ID is actually pyridoxine 5′-phosphate synthase activity. The correct term is GO:0001512, confirmed via QuickGO.

Knowledge Gaps

1. Physiological NRH source in vivo. Checked: literature uses in-vitro NRH/BNAH surrogates. Matters for BP context, not the MF term. Resolve via tissue metabolomics for NRH and NRH-generating enzymes.
2. Whether the review pipeline treats a non-ancestral IBA as "generalize" vs "remove." Checked ancestry (GO:0003955 not ancestor of GO:0001512), which argues for removal. Curator should confirm project policy.
3. Quantitative NAD(P)H vs NRH kinetics. Existing data are qualitative (NRH-preference). A kcat/Km ratio would formally bound the error; confirmatory only.

Discriminating Tests

• Side-by-side kinetics: NQO2 quinone reduction with NRH/BNAH vs NADH vs NADPH → expect robust NRH activity, negligible NAD(P)H (discriminates GO:0001512 from GO:0003955).
• Structure/domain check: confirm absence of the NQO1 C-terminal NAD(P)H subdomain in NQO2 (PDB 1QR2 vs NQO1 structures; sequence alignment).
• Chimera/mutagenesis: graft the NQO1 C-terminal extension onto NQO2 to test gain of NAD(P)H use — causal test of the domain–cofactor link.

Curation Leads (require curator verification)

• Candidate action: Remove/NOT the IBA GO:0003955 on NQO2; retain existing IDA GO:0001512.
• Candidate reference to verify (donor specificity): PMID:9367528 — "NQO2 uses dihydronicotinamide riboside (NRH) rather than NAD(P)H as an electron donor. It catalyzes a two-electron reduction of quinones and oxidation-reduction dyes."
• Candidate reference supporting the correct term (already the IDA source): PMID:18254726 (Calamini et al., 2008, QR2 kinetics + X-ray) — verify it is the IDA basis for GO:0001512.
• Context reference: PMID:10945627 (CB1954 co-substrate-mediated bioactivation) confirms NRH-type co-substrate, not NAD(P)H.
• Database support: UniProt P16083 (EC 1.10.5.1, NRH→quinol reaction, FAD+Zn²⁺); QuickGO ancestry showing GO:0003955 is not an ancestor of GO:0001512.
• Suggested curator question: Does project policy remove a substrate-incorrect, non-ancestral IBA term when the correct experimental term is already present, or retain it flagged?
• Suggested experiment: NRH-vs-NAD(P)H kinetic comparison to document cofactor discrimination quantitatively.

Provenance (executed this review)

• UniProt REST: NQO2 P16083 = 231 aa, EC 1.10.5.1, NRH→quinol, FAD+Zn²⁺; NQO1 P15559 = 274 aa, EC 1.6.5.2, NAD(H)/NADP(H). Confirms paralog cofactor divergence + 43-aa length difference.
• QuickGO ontology: GO:0001512 is_a ancestors = {GO:0016679, GO:0016491, GO:0003824, GO:0003674}; GO:0003955 NOT among them (sibling relationship).
• QuickGO annotation (UniProtKB:P16083, MF): GO:0001512 = IDA (PMID:18254726) + IEA; GO:0003955 = IBA only (GO_REF:0000033).
• NCBI eSummary: PMID:18254726 = QR2 melatonin kinetics/X-ray; PMID:10945627 = CB1954 co-substrate bioactivation.
• Sequence comparison (UniProt FASTA, computed): NQO2 231 aa vs NQO1 274 aa; NQO1 carries exactly 43 extra C-terminal residues (…NFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK) absent in NQO2 — the C-terminal segment forming part of the NAD(P)H adenosine-binding site, i.e. the structural reason NQO2 cannot use NAD(P)H.
• Literature: PMID:9367528 (definitive), 18996184, 21506232, plus review 18374191.

Artifacts generated

• NQO2_GO_decision_table.png — rendered GO MF decision table (remove IBA GO:0003955; retain GO:0001512), auto-saved during execution.
• Evidence matrix and GO decision table are embedded above as artifact-friendly Markdown tables (the code executor sandbox could not write CSVs to the job directory; the executed code and its printed outputs above are the provenance).

Artifacts

• OpenScientist final report
• OpenScientist final report
• OpenScientist NQO2 GO decision table