WAGO-1 (Worm-specific Argonaute protein 1; UniProt Q21770; gene R06C7.1) is a non-catalytic Argonaute protein in Caenorhabditis elegans that functions as a central cytoplasmic effector of the endogenous 22G-RNA silencing pathway in the germline. WAGO-1 binds secondary small interfering RNAs (22G-RNAs) — 22-nucleotide, 5'-guanosine-bearing endogenous siRNAs synthesized by RNA-dependent RNA polymerases (RdRPs) — and uses them to silence transposable elements, pseudogenes, cryptic loci, and other aberrant transcripts. It localizes to perinuclear P granules (nuage) in germ cells, where it surveys transcripts exiting the nucleus through nuclear pore clusters. WAGO-1 lacks the conserved DEDH catalytic tetrad required for direct mRNA cleavage ("slicer" activity) and instead functions as a non-catalytic scaffold that recruits downstream silencing effectors and connects to nuclear chromatin-based transcriptional silencing via the HRDE-1/NRDE pathway.
WAGO-1 operates within a tripartite RNA immune system in which PRG-1/piRNAs scan for foreign sequences, the CSR-1 pathway licenses "self" transcripts, and the WAGO pathway maintains epigenetic memory of "non-self" RNAs — enabling the germline to distinguish its own transcripts from potentially harmful foreign genetic elements across generations. WAGO-1 participates in transgenerational epigenetic inheritance (TEI) of silencing signals, requires N-terminal proteolytic processing by the dipeptidase DPF-3 for proper 22G-RNA loading, and functions within an extensive protein interaction network of ~180 partners including RNA helicases (RDE-12, GLH-1, ZNFX-1), other Argonautes (PRG-1, CSR-1), and the Mutator complex (MUT-16). Recent studies have revealed that WAGO-1 is developmentally dynamic — predominantly active in gravid adult worms rather than embryos — and sexually dimorphic, with distinct localization patterns and functions in male versus female germlines.
| Feature | Value |
|---|---|
| Gene name | wago-1 |
| ORF name | R06C7.1 |
| UniProt accession | Q21770 |
| Organism | Caenorhabditis elegans |
| Protein family | Argonaute family, WAGO subfamily |
| Length | 945 amino acids |
| Key domains | PAZ domain (aa 322–432), Piwi domain (aa 636–899) |
| Notable features | Proline-rich disordered N-terminus (aa 1–41); lacks catalytic DDH/DEDH triad |
The gene symbol "wago-1" is unambiguous: it refers specifically to the C. elegans worm-specific Argonaute protein 1, a member of the WAGO (Worm-specific AGO) subfamily. This identity is confirmed by UniProt, WormBase (WBGene00011061), and primary literature.
WAGO-1 is an Argonaute protein that functions as the primary cytoplasmic effector of the endogenous 22G-RNA silencing pathway in the C. elegans germline. It binds secondary 22G-RNAs — endogenous small interfering RNAs that are 22 nucleotides long and bear a characteristic 5'-triphosphorylated guanosine — and uses them as guides to identify and silence target transcripts (PMID: 19800275; Gu et al., 2009).
The 22G-RNAs loaded onto WAGO-1 are synthesized by cellular RNA-dependent RNA polymerases (RdRPs, including RRF-1 and EGO-1) that use target mRNAs as templates. The RdRP complex also includes the Dicer-related helicase DRH-3. This places WAGO-1 downstream in a two-step amplification cascade: primary Argonautes (such as RDE-1 for exogenous dsRNA triggers, ERGO-1 for endogenous 26G-RNA triggers, or PRG-1 for piRNA triggers) initially recognize target transcripts, then recruit RdRP complexes to generate amplified secondary 22G-RNAs that are loaded onto WAGO-1 for sustained silencing (PMID: 19800275; PMID: 24684931).
WAGO-1's targets include:
- Transposable elements (transposons)
- Pseudogenes
- Cryptic loci (unannotated or aberrantly expressed genomic regions)
- Repetitive sequences
- Exogenous RNAi targets (when experimentally triggered)
As stated by Gu et al. (2009): "in the germline, one system is dependent on worm-specific AGOs, including WAGO-1, which localizes to germline nuage structures called P granules. WAGO-1 silences certain genes, transposons, pseudogenes, and cryptic loci" (PMID: 19800275).
A critical feature of WAGO-1 is that it lacks endonuclease (slicer) activity. UniProt annotation states: "Members of the WAGO (worm-specific argonaute) subfamily lack conserved metal-binding residues found in other argonaute proteins and probably do not cleave target mRNAs directly."
Classical Argonaute proteins (e.g., human AGO2) contain a DDH or DEDH catalytic triad in the Piwi domain that coordinates a divalent metal ion for RNase H-like cleavage of target RNA. WAGO-1's Piwi domain (aa 636–899), while structurally present, lacks these conserved catalytic residues. Therefore, WAGO-1 does not directly cleave target mRNAs. Instead, it likely functions as a non-catalytic scaffolding platform that:
This is an important distinction from catalytically active Argonautes: WAGO-1's silencing is mediated through protein-protein interactions and recruitment rather than direct endonucleolytic cleavage.
A major conceptual advance in understanding WAGO-1's function came from the discovery that it operates within a self/non-self RNA discrimination system in the germline (PMID: 22738726; Shirayama et al., 2012). In this model:
As Shirayama et al. (2012) stated: "PRG-1 scans for foreign sequences and two other Argonaute pathways serve as epigenetic memories of 'self' and 'nonself' RNAs" (PMID: 22738726). This places WAGO-1 in a tripartite immune-like system:
| Pathway Component | Argonaute | Small RNA | Function |
|---|---|---|---|
| Scanner | PRG-1 (Piwi) | piRNAs (21U-RNAs) | Scans for foreign/non-self sequences |
| Self memory | CSR-1 | 22G-RNAs | Licenses endogenous germline transcripts as "self" |
| Non-self memory | WAGO-1 and other WAGOs | 22G-RNAs | Maintains epigenetic silencing of non-self targets |
WAGO-1 physically interacts with both PRG-1 and CSR-1 (WormBase interaction data; Barucci et al., 2020; Singh et al., 2021), consistent with functional crosstalk between these pathways.
In addition to its endogenous surveillance role, WAGO-1 participates in experimentally induced RNA interference (RNAi). When exogenous double-stranded RNA is introduced, the primary Argonaute RDE-1 initiates target recognition, after which RdRP complexes generate amplified 22G-RNAs that are loaded onto WAGO-1 and other WAGO proteins to execute robust and sustained silencing (PMID: 24684931). WAGO-1 also participates in antiviral defense, as evidenced by the fact that its cofactor RDE-12 is required for viral suppression (PMID: 24684931).
WAGO-1's cytoplasmic post-transcriptional surveillance is connected to a nuclear silencing arm through the NRDE (Nuclear RNAi Defective) pathway. WAGO-1 physically interacts with NRDE-2, a nuclear RNAi factor (Wan et al., 2020, WormBase). The nuclear Argonaute HRDE-1 (also known as WAGO-9) receives small RNA signals from the cytoplasmic WAGO pathway and mediates transcriptional gene silencing through deposition of histone H3 lysine 9 methylation (H3K9me) at target loci. Ni et al. (2014) showed that HRDE-1 targets include LTR retrotransposons: "we coordinately examined the genome-wide profiles of transcription, histone H3 lysine 9 methylation (H3K9me) and endogenous siRNAs of a germline nuclear Argonaute (hrde-1/wago-9) mutant and identified regions on which transcription activity is markedly increased and/or H3K9me level is markedly decreased relative to wild type animals" (PMID: 25534009).
Schreier et al. (2025) established the hierarchy between cytoplasmic and nuclear WAGOs: "the nuclear Argonaute protein HRDE-1 is required for RNAi establishment in parents and offspring, but not for the inheritance process. In contrast, the cytoplasmic Argonaute protein WAGO-3 is the only factor essential for inheritance, via sperm and oocyte" (PMID: 40624357). This places cytoplasmic WAGOs (including WAGO-1) as carriers of the silencing signal, while HRDE-1 re-establishes transcriptional silencing in each generation.
This creates a two-tier silencing system: WAGO-1 mediates acute post-transcriptional silencing in P granules (cytoplasmic), while the downstream nuclear arm (HRDE-1) establishes durable chromatin-based transcriptional repression for long-term and transgenerational silencing.
An intriguing mechanistic connection links WAGO-1-mediated surveillance with the nonsense-mediated mRNA decay (NMD) pathway. Gu et al. (2009) demonstrated that "components of the nonsense-mediated decay pathway function in at least one WAGO-mediated surveillance pathway" (PMID: 19800275). This suggests convergence between two RNA quality control systems — one guided by small RNAs (WAGO pathway) and one recognizing aberrant translation termination events (NMD) — potentially to ensure robust silencing of defective transcripts in the germline.
WAGO-1 localizes to P granules — perinuclear, membraneless ribonucleoprotein condensates (nuage) that are characteristic of C. elegans germ cells (PMID: 19800275). This localization has been confirmed by direct experimental observation (GO:0043186, IDA evidence from WormBase).
P granules are phase-separated condensates that assemble on the cytoplasmic face of nuclear pore clusters in germ cells. Thomas et al. (2025) demonstrated that "P granules overlay nuclear pore clusters, facilitating surveillance of nascent transcripts by Argonaute proteins enriched in P granules" (PMID: 40067309). This positioning is functionally significant: it places WAGO-1 at the first point of contact for mRNAs as they exit the nucleus, enabling immediate surveillance of nascent transcripts for complementarity to loaded 22G-RNAs.
Recent high-resolution imaging has revealed that P granules exist within a larger organized architecture of perinuclear germ granule compartments. Uebel et al. (2023) demonstrated that P granules adopt a "toroidal P granule morphology, which encircles the other germ granule compartments in a consistent exterior-to-interior spatial organization, providing broad implications for the trajectory of an RNA as it exits the nucleus" (PMID: 38009921). Adjacent to P granules are Z granules (containing ZNFX-1 and WAGO-4) and Mutator foci (containing MUT-16 and RdRP machinery). Together, these form ordered PZM (P granule–Z granule–Mutator) assemblages (PMID: 29769721; Wan et al., 2018).
This spatial organization implies a directional RNA processing pathway:
1. Nuclear pores → mRNA export
2. P granules (outer shell, containing WAGO-1) → transcript surveillance and initial target recognition
3. Z granules (intermediate, containing ZNFX-1) → memorization and pUGylation of silenced transcripts for inheritance
4. Mutator foci (inner, containing MUT-16 and RdRPs) → secondary siRNA amplification
WAGO-1 is primarily expressed in the germline, with enrichment in sperm and oocytes (UniProt tissue specificity). WormBase concise description: "Expressed in germ line and in male." This is consistent with its primary role in germ cell genome surveillance and its connection to the paternal 26G-RNA pathway (ALG-3/4). WAGO-1 also colocalizes with its cofactor RDE-12 in cytoplasmic and perinuclear foci in somatic cells (PMID: 24684931), indicating that it may also function outside the germline in certain contexts.
Gene Ontology annotations include localization to cytoplasmic ribonucleoprotein granules (GO:0036464) and the RISC complex (GO:0016442), and molecular functions including single-stranded RNA binding (GO:0003727) and DEAD/H-box RNA helicase binding (GO:0017151, IPI evidence from PMID: 24684931).
Immunoprecipitation of WAGO-1 identified a robust physical association with RDE-12, a conserved Vasa ATPase-related helicase protein (PMID: 24684931). As Shirayama et al. (2014) reported: "we immunoprecipitated the C. elegans AGO WAGO-1, which engages amplified small RNAs during RNAi. These studies identified a robust association between WAGO-1 and a conserved Vasa ATPase-related protein RDE-12. rde-12 mutants are deficient in RNAi, including viral suppression, and fail to produce amplified secondary siRNAs and certain endogenous siRNAs (endo-siRNAs). RDE-12 colocalizes with WAGO-1 in germline P granules and in cytoplasmic and perinuclear foci in somatic cells."
RDE-12 is first recruited to target mRNAs by upstream/primary Argonautes (RDE-1 and ERGO-1), where it promotes secondary siRNA amplification and/or WAGO-1 loading. Downstream of these events, RDE-12 forms an RNase-resistant (target mRNA-independent) complex with WAGO-1, suggesting additional roles in ongoing target surveillance.
This interaction places WAGO-1 in a defined biochemical pathway:
Trigger (dsRNA / piRNA / 26G-RNA)
↓
Primary Argonaute (RDE-1 / ERGO-1 / PRG-1) recognizes target
↓
RDE-12 recruited to target mRNA
↓
RdRP complex (RRF-1/EGO-1, DRH-3) amplifies 22G-RNAs
↓
WAGO-1 loaded with 22G-RNAs → target silencing
The Vasa-family helicase GLH-1 directly binds WAGO-1, and its ATPase cycle regulates this interaction. Dai et al. (2022) showed that "the ATPase cycle of GLH-1 regulates direct binding to the Argonaute WAGO-1, which engages amplified small RNAs" and that GLH proteins "promote the amplification of small RNAs required for transgenerational inheritance" (PMID: 36070689). GLH proteins are structural components of P granules and compete with each other to control Argonaute pathway specificity — i.e., whether small RNAs are channeled toward silencing WAGOs (like WAGO-1) versus the gene-activating Argonaute CSR-1.
WAGO-1 interacts with ZNFX-1, a conserved RNA helicase that defines Z granules (UniProt, citing PMID: 29775580). ZNFX-1 functions to "memorialize" silenced transcripts: it interacts with sRNA-targeted transcripts that have acquired poly(UG) tails and concentrates them in perinuclear condensates, sustaining pUGylation and robust sRNA amplification in inheriting generations (PMID: 35739318). The WAGO-1–ZNFX-1 interaction thus connects P granule surveillance to the transgenerational inheritance machinery.
WAGO-1 physically interacts with MUT-16 (Phillips et al., 2014; Manage et al., 2020, WormBase), the scaffold protein of Mutator foci — the perinuclear condensates where RdRP-mediated 22G-RNA synthesis occurs. This interaction connects WAGO-1 directly to the site of secondary siRNA biogenesis. In the PZM germ granule architecture, Mutator foci are positioned interior to P granules, and the WAGO-1–MUT-16 interaction likely facilitates the loading of newly synthesized 22G-RNAs onto WAGO-1.
WormBase catalogs 180 unique physical interactors for WAGO-1 across 26+ studies, revealing it as a central hub in the germ granule RNA surveillance network. Key interaction categories include:
| Category | Key Partners | References |
|---|---|---|
| P granule scaffolds | DEPS-1, PGL-1, PGL-3 | Barucci et al. 2020; Dai et al. 2022; Chen et al. 2016 |
| Vasa helicases | GLH-1, GLH-4, RDE-12, VBH-1 | Dai et al. 2022; Shirayama et al. 2014; multiple |
| Other Argonautes | PRG-1, CSR-1, PPW-2, WAGO-4, WAGO-5 | Barucci et al. 2020; Singh et al. 2021; Dai et al. 2022 |
| Mutator complex | MUT-16 | Phillips et al. 2014; Manage et al. 2020 |
| Z granule | ZNFX-1 | Ishidate et al. 2018; Barucci et al. 2020 |
| Nuclear RNAi | NRDE-2 | Wan et al. 2020 |
| RNA-binding proteins | CAR-1, GLD-1, TIAR-1, SQD-1, PAB-1/2 | Dai et al. 2022 |
| Ribosomal proteins | Numerous RPL and RPS subunits | Barucci et al. 2020; Dai et al. 2022 |
The extensive interactions with ribosomal proteins are consistent with WAGO-1's association with translating mRNAs and potential roles in translational regulation of targets.
WAGO-1's activity is regulated through N-terminal proteolytic processing by DPF-3, a P-granule-localized dipeptidase orthologous to mammalian DPP8/9 (PMID: 33852894). Gudipati et al. (2021) demonstrated that "DPF-3, a P-granule-localized N-terminal dipeptidase orthologous to mammalian dipeptidyl peptidase (DPP) 8/9, processes the unusually proline-rich N termini of WAGO-1 and WAGO-3 Argonaute (Ago) proteins. Without DPF-3 activity, these WAGO proteins lose their proper complement of 22G RNAs. Desilencing of repeat-containing and transposon-derived transcripts, DNA damage, and acute sterility ensue."
WAGO-1 has an unusually proline-rich N-terminus (compositional bias at residues 1–20), and DPF-3 cleaves this region. The DPF-3 enzyme has been further characterized as having tripeptidyl peptidase activity (PMID: 41239757), suggesting it sequentially removes N-terminal tripeptides from the proline-rich stretch. Without DPF-3 processing:
- WAGO-1 loses its proper complement of 22G-RNAs
- Transposon and repeat-derived transcripts become desilenced
- DNA damage accumulates
- Acute sterility results
This establishes N-terminal processing as a regulatory checkpoint ensuring WAGO-1 associates with appropriate small RNAs before engaging in silencing.
WAGO-1 and the related WAGO-3 show distinct developmental dynamics. Seistrup et al. (2026) demonstrated that "WAGO-1 mostly affects 22G-RNA expression in gravid adult worms, while WAGO-3 predominantly affects 22G-RNA expression in embryos" (PMID: 41870199). This temporal partitioning suggests that different WAGO proteins take over surveillance roles at different developmental stages.
WAGO-1 is specifically linked to the paternal 26G-RNA pathway governed by the Argonautes ALG-3/4, while WAGO-3 is linked to the maternal 26G-RNA pathway governed by ERGO-1 (PMID: 41870199). The ALG-3/4 pathway is active during spermatogenesis and targets sperm-enriched transcripts, consistent with WAGO-1's enrichment in sperm.
DiNardo et al. (2025) identified "sexual dimorphisms in localization and function of protein structural features of the Argonaute WAGO-1 that affects sex-specific gene regulation during gametogenesis" (PMID: 40501979). Specific structural features of the WAGO-1 protein show different localization patterns and functional roles in male versus hermaphrodite germlines. WAGO-1 is required for proper germ granule structure and gametogenesis in both sexes, but through sex-specific mechanisms.
Notably, loss of WAGO-1 alone does not globally upregulate its target mRNAs (PMID: 41870199), suggesting significant functional redundancy among WAGO proteins. C. elegans possesses ~12 WAGO-subfamily Argonautes, and loss of one WAGO leads to compensatory redistribution of 22G-RNAs to other WAGOs, buffering the system against single-gene perturbations.
WAGO-1 participates in transgenerational epigenetic inheritance (TEI) of RNAi-induced silencing. Woodhouse et al. (2025) classified wago-1 among genes involved in TEI, showing it functions in either establishment or maintenance of transgenerational silencing signals (PMID: 40460278). The mechanistic basis involves the GLH family of Vasa helicases: Dai et al. (2022) showed that GLH proteins "promote the amplification of small RNAs required for transgenerational inheritance" and that "the ATPase cycle of GLH-1 regulates direct binding to the Argonaute WAGO-1" (PMID: 36070689).
The TEI pathway also involves Z granules, where the helicase ZNFX-1 and the Argonaute WAGO-4 concentrate pUGylated (poly-UG-tailed) target transcripts to maintain a pool of templates for ongoing 22G-RNA amplification (PMID: 35739318; PMID: 29769721). In the TEI framework:
WAGO-1's specific role in this cascade is connected to the establishment phase and its interaction with ZNFX-1 and GLH-1, which together ensure that the correct transcripts are targeted for silencing and that small RNA amplification is sustained across generations.
WAGO-1 contains the hallmark domains of the Argonaute protein family:
An AlphaFold v6 structural model is available for WAGO-1 (AF-Q21770-F1). The prediction is high-confidence overall (mean pLDDT = 90.6), with 80.7% of residues scoring ≥90.
| Region | Residues | Mean pLDDT | Interpretation |
|---|---|---|---|
| N-terminal disordered | 1–41 | 30.8 | Intrinsically disordered (confirmed) |
| N-lobe | 42–321 | 93.2 | Well-structured |
| PAZ domain | 322–432 | 94.0 | Well-structured |
| MID region | 433–635 | 94.6 | Well-structured |
| Piwi domain | 636–899 | 92.9 | Well-structured |
| C-terminal | 900–945 | 88.5 | Moderately confident |
The model confirms that WAGO-1 adopts the canonical Argonaute bilobed architecture: an N-lobe (N-domain + PAZ) and a C-lobe (MID + Piwi), forming a channel for guide RNA binding and target recognition. The N-terminal 41 residues are predicted as intrinsically disordered (pLDDT 30.8), consistent with their role as a regulatory peptide processed by DPF-3. The sequence of this region — MSPHPPQPHPPMPPMPPVTAPPGAMTPMPPVPADAQKLHQS — contains 39% proline, explaining its recognition by DPF-3, a proline-directed peptidase.
{{figure:wago1_alphafold_profile.png|caption=AlphaFold confidence profile of WAGO-1 showing high-confidence PAZ and Piwi domains flanking a disordered proline-rich N-terminus (pLDDT ~31), which is the substrate for DPF-3 proteolytic processing. Mean pLDDT = 90.6; 80.7% of residues at very high confidence (>=90).}}
The WAGO subfamily is nematode-specific (worm-specific Argonautes), having evolved and expanded within the Caenorhabditis lineage. C. elegans encodes approximately 12 WAGO proteins, which have diversified to handle different aspects of RNA surveillance, transposon defense, and gene regulation (PMID: 30650636). This expansion is thought to reflect the extensive reliance of nematodes on RNA-based genome defense mechanisms.
The following model integrates all findings into a coherent picture of WAGO-1's role in the C. elegans germline:
┌─────────────────────────────────────────────┐
│ NUCLEUS │
│ │
│ Target gene ──→ nascent mRNA │
│ ▲ │
│ │ H3K9me3 (transcriptional │
│ │ silencing) │
│ │ │
│ HRDE-1/NRDE-2 ◄── 22G-RNAs │
│ ▲ │
└────────────────────────┼────────────────────┘
Nuclear pores │
═══════════╤═════════════╧════════════════════
│
┌─────────▼──────────────────────────────────┐
│ P GRANULE (perinuclear) │
│ │
│ mRNA exits ──→ WAGO-1:22G-RNA scans it │
│ nucleus │ │
│ ▼ │
│ Match found? │
│ ╱ ╲ │
│ Yes No │
│ │ │ │
│ Recruit Release │
│ silencing (translation) │
│ effectors │
│ │ │
│ GLH-1, RDE-12 (helicase cofactors) │
│ DEPS-1 (scaffold) │
│ NMD factors │
└──────────┬─────────────────────────────────┘
│
┌─────────▼──────────────────────────────────┐
│ MUTATOR FOCI │
│ │
│ MUT-16 scaffold │
│ RdRP: target mRNA → new 22G-RNAs │
│ (amplification loop) │
└──────────┬─────────────────────────────────┘
│
┌─────────▼──────────────────────────────────┐
│ Z GRANULE │
│ │
│ ZNFX-1 + WAGO-4 │
│ pUGylated transcripts stored │
│ → transgenerational inheritance │
└────────────────────────────────────────────┘
UPSTREAM INITIATION:
PRG-1/piRNAs ──→ scan for non-self ──→ trigger WAGO pathway
CSR-1/22G-RNAs ──→ license self ──→ protect from silencing
POST-TRANSLATIONAL ACTIVATION:
DPF-3 protease ──→ cleaves WAGO-1 proline-rich N-terminus
──→ enables 22G-RNA loading
{{figure:wago1_pathway_map.png|caption=Comprehensive functional pathway map of WAGO-1 showing its position within the tripartite self/non-self RNA immune system, P granule localization, protein interactions, and connections to nuclear silencing and transgenerational inheritance.}}
The following primary research papers provide the core evidence for this functional annotation:
| PMID | Authors/Year | Key Contribution |
|---|---|---|
| PMID: 19800275 | Gu et al. 2009 | Defined WAGO-1 as P granule-localized Argonaute that silences transposons, pseudogenes via 22G-RNAs; identified NMD connection |
| PMID: 22738726 | Shirayama et al. 2012 | Established self/non-self RNA immune system model with WAGO as non-self memory |
| PMID: 24684931 | Shirayama et al. 2014 | Identified RDE-12 Vasa helicase as WAGO-1 cofactor via immunoprecipitation |
| PMID: 25534009 | Ni et al. 2014 | Characterized HRDE-1-mediated nuclear silencing and H3K9me at WAGO targets |
| PMID: 29769721 | Wan et al. 2018 | Discovered Z granules and PZM assemblage architecture |
| PMID: 33852894 | Gudipati et al. 2021 | Demonstrated DPF-3 N-terminal processing of WAGO-1 is required for 22G-RNA loading |
| PMID: 35739318 | Ouyang et al. 2022 | ZNFX-1 memorializes silenced RNAs in perinuclear condensates via pUGylation |
| PMID: 36070689 | Dai et al. 2022 | Showed GLH-1 ATPase cycle regulates WAGO-1 binding and transgenerational silencing |
| PMID: 38009921 | Uebel et al. 2023 | Revealed toroidal P granule morphology and germ granule spatial organization |
| PMID: 40067309 | Thomas et al. 2025 | Demonstrated P granule overlay of nuclear pore clusters for transcript surveillance |
| PMID: 40460278 | Woodhouse et al. 2025 | Classified wago-1 role in TEI establishment/maintenance |
| PMID: 40501979 | DiNardo et al. 2025 | Identified sexual dimorphism in WAGO-1 localization and function |
| PMID: 40624357 | Schreier et al. 2025 | Established hierarchy between cytoplasmic WAGOs and nuclear HRDE-1 in inheritance |
| PMID: 41239757 | Trivedi & Gudipati 2026 | Characterized DPF-3 as having tripeptidyl peptidase activity |
| PMID: 41870199 | Seistrup et al. 2026 | Revealed developmental dynamics and link to paternal ALG-3/4 pathway |
Key review articles providing broader context include Fischer (2015; PMID: 25505902), Billi et al. (2014; PMID: 23890211), and Almeida et al. (2019; PMID: 30650636).
Mechanism of non-catalytic silencing is unclear. While it is established that WAGO-1 lacks slicer activity, the precise mechanism by which it effects target silencing — whether through recruitment of exonucleases, translational repression, or mRNA sequestration — remains undefined. The large number of interaction partners suggests multiple possible effector routes, but the dominant mechanism has not been established.
Redundancy among WAGO proteins. C. elegans possesses ~12 WAGO-subfamily Argonautes. Single wago-1 mutants often show modest phenotypes because of functional redundancy. Comprehensive genetic analysis of WAGO combinatorial mutants is limited, making it difficult to precisely delineate WAGO-1's unique versus shared contributions.
Target specificity rules are incomplete. How WAGO-1 selects which 22G-RNAs to bind (versus WAGO-3, WAGO-4, etc.) is not fully understood. The DPF-3 processing requirement and GLH-1 interaction provide partial answers, but the complete biochemical basis for pathway specificity remains elusive.
Stoichiometry and dynamics of P granule interactions. While the interactome is extensive (180 partners), many interactions were identified by high-throughput methods (co-IP/MS). The stoichiometry, temporal dynamics, and direct versus indirect nature of many interactions require further validation.
Somatic functions are poorly characterized. WAGO-1 has been studied primarily in the germline. Whether and how it functions in somatic cells (where P granules are absent) is largely unexplored, though RDE-12 colocalizes with WAGO-1 in somatic foci.
No experimental 3D structure. No experimental structure of WAGO-1 — either alone or in complex with 22G-RNA — exists. The AlphaFold model provides a monomeric prediction but cannot reveal how N-terminal processing by DPF-3 alters the structure or how 22G-RNA binding occurs in the non-catalytic Piwi pocket.
Cryo-EM of WAGO-1:22G-RNA complex. Determine the experimental structure of WAGO-1 bound to a 22G-RNA guide, ideally in both DPF-3-processed and unprocessed forms, to understand how N-terminal cleavage enables small RNA loading.
Proximity-dependent labeling (TurboID) in vivo. Use a WAGO-1::TurboID fusion expressed from the endogenous locus to map the immediate spatial interactome in P granules with temporal resolution, distinguishing direct from indirect interactors.
Combinatorial WAGO mutant analysis. Generate and characterize wago-1; wago-3 double mutants and higher-order combinations to define the unique versus redundant contributions of individual WAGOs to 22G-RNA populations, target silencing, and fertility.
Single-molecule FISH of WAGO-1 targets. Track individual target transcripts through P granules, Z granules, and Mutator foci to determine the kinetics and order of RNA processing events in the PZM assemblage.
Investigate somatic functions. Use tissue-specific promoters to express tagged WAGO-1 in somatic tissues and characterize any non-germline surveillance functions, particularly in the context of antiviral defense.
WAGO-1 CLIP-seq across development. Define the direct RNA targets of WAGO-1 at nucleotide resolution in different developmental stages and sexes, building on the developmental dynamics reported by Seistrup et al. (2026) and DiNardo et al. (2025).