The research report should be a detailed narrative explaining the function, biological processes, and localization of the gene product. Citations should be given for all claims.
You should prioritize authoritative reviews and primary scientific literature when conducting research. You can supplement
this with annotations you find in gene/protein databases, but these can be outdated or inaccurate.
We are specifically interested in the primary function of the gene - for enzymes, what reaction is catalyzed, and what is the substrate specificity? For transporters, what is the substrate? For structural proteins or adapters, what is the broader structural role? For signaling molecules, what is the role in the pathway.
We are interested in where in or outside the cell the gene product carries out its function.
We are also interested in the signaling or biochemical pathways in which the gene functions. We are less interested in broad pleiotropic effects, except where these elucidate the precise role.
Include evidence where possible. We are interested in both experimental evidence as well as inference from structure, evolution, or bioinformatic analysis. Precise studies should be prioritized over high-throughput, where available.
CGRRF1 (UniProt: Q99675), also known as CGR19 or RNF197, encodes a cell growth regulator with RING finger domain protein 1 in humans (kaneko2016genomewideidentificationand pages 1-2, glaeser2018erad‐dependentcontrolof pages 1-2). The gene symbol is unambiguous in the literature, with all sources referring to the same human ER-associated RING finger protein. The protein belongs to the family of ER-resident E3 ubiquitin ligases and contains characteristic RING finger and transmembrane domains (kaneko2016genomewideidentificationand pages 1-2, fenech2020interactionmappingof pages 1-2).
CGRRF1 functions primarily as an E3 ubiquitin ligase embedded in the endoplasmic reticulum (ER) membrane, where it participates in ER-associated degradation (ERAD) pathways (glaeser2018erad‐dependentcontrolof pages 1-2, wolf2021eviwlsfunctionis pages 1-2). The protein catalyzes the transfer of ubiquitin to specific substrate proteins, marking them for proteasomal degradation. CGRRF1's role extends beyond conventional protein quality control of misfolded proteins to include regulatory ERAD, which controls the abundance of properly folded, functional proteins in response to physiological conditions (glaeser2018erad‐dependentcontrolof pages 1-2, christianson2023mechanismsofsubstrate pages 50-53).
The E3 ligase activity of CGRRF1 appears to be substrate- and E2-specific. While one genome-wide screening study reported that CGRRF1 did not possess detectable in vitro autoubiquitination activity when paired with the promiscuous E2 enzyme UbcH5a (kaneko2016genomewideidentificationand pages 1-2), subsequent focused investigations demonstrated that CGRRF1 is functionally active when paired with its cognate E2 enzyme, UBE2J2, and specific substrates such as Evi/WLS (glaeser2018erad‐dependentcontrolof pages 10-12, glaeser2018erad‐dependentcontrolof pages 13-14). This substrate and E2 specificity is consistent with the specialized regulatory functions of CGRRF1 rather than a broad protein quality control role.
The best-characterized and experimentally validated substrate of CGRRF1 is Evi (also known as Wntless or WLS/GPR177), the dedicated cargo receptor for Wnt protein secretion (glaeser2018erad‐dependentcontrolof pages 1-2, wolf2021eviwlsfunctionis pages 1-2, glaeser2018erad‐dependentcontrolof pages 10-12). Multiple lines of experimental evidence support this substrate relationship:
Beyond Evi/WLS, proximity labeling studies have identified CGRRF1 in the neighborhood of nuclear envelope proteins such as lamin B receptor (LBR) and emerin, suggesting potential roles in regulating inner nuclear membrane protein homeostasis (cheng2022sharedanddistinctivea pages 6-7, cheng2022sharedanddistinctivea pages 3-4). However, this remains preliminary evidence requiring further validation.
CGRRF1 is a single-pass transmembrane protein with a predicted transmembrane domain spanning approximately amino acids 15-37 (kaneko2016genomewideidentificationand pages 1-2, glaeser2018erad‐dependentcontrolof pages 10-12). The protein's topology positions the N-terminal region within the ER lumen while the C-terminal portion, containing the catalytic machinery, faces the cytosol (glaeser2018erad‐dependentcontrolof pages 10-12).
The catalytic core consists of a C3HC4 RING-type zinc finger domain located at amino acids 274-315 (glaeser2018erad‐dependentcontrolof pages 10-12). This RING domain contains the canonical arrangement of cysteine and histidine residues (CVVCQNGTVNWVLLPCRHTCLCDGCVKYFQQCPMCR) that coordinate two zinc ions, which are essential for the structural integrity and catalytic function of the E3 ligase (glaeser2018erad‐dependentcontrolof pages 10-12). Site-directed mutagenesis of conserved cysteine residues (C2/C4A) within the RING domain abolished CGRRF1's ability to promote substrate degradation, confirming the functional importance of this domain (glaeser2018erad‐dependentcontrolof pages 10-12).
The transmembrane architecture is critical for CGRRF1's function, as it allows the protein to access both ER lumenal and membrane-embedded substrates while presenting the ubiquitin conjugation machinery to the cytosolic proteasomal degradation system (christianson2023mechanismsofsubstrate pages 50-53, fenech2020interactionmappingof pages 1-2).
CGRRF1 is localized to the endoplasmic reticulum membrane, where it carries out its E3 ubiquitin ligase functions (kaneko2016genomewideidentificationand pages 1-2, fenech2020interactionmappingof pages 1-2). Genome-wide profiling of ER-localized E3 ligases confirmed that CGRRF1 is partially localized to the ER, consistent with its role in ERAD (kaneko2016genomewideidentificationand pages 1-2). The protein's membrane topology places the catalytic RING domain on the cytosolic side of the ER membrane, enabling access to cytosolic E2 enzymes and the ubiquitin-proteasome system (glaeser2018erad‐dependentcontrolof pages 10-12, christianson2023mechanismsofsubstrate pages 50-53).
Recent proximity labeling studies using TurboID fusions to nuclear envelope proteins identified CGRRF1 in the neighborhoods of emerin and lamin B receptor (LBR), suggesting that CGRRF1 may also function at the inner nuclear membrane (INM), which is continuous with the ER (cheng2022sharedanddistinctivea pages 6-7, cheng2022sharedanddistinctivea pages 3-4). This dual localization would be consistent with CGRRF1's potential roles in regulating both ER and nuclear envelope proteostasis.
CGRRF1 works in conjunction with the E2 ubiquitin-conjugating enzyme UBE2J2 to ubiquitinate substrates (glaeser2018erad‐dependentcontrolof pages 1-2, glaeser2018erad‐dependentcontrolof pages 10-12, glaeser2018erad‐dependentcontrolof pages 13-14). UBE2J2 is an ER-associated E2 enzyme that contains a catalytic ubiquitin-conjugating core domain (UBCc) spanning amino acids 14-127, with an active site cysteine residue critical for thioester bond formation with ubiquitin (glaeser2018erad‐dependentcontrolof pages 10-12). The E2 also possesses a C-terminal transmembrane domain that anchors it to the ER membrane (glaeser2018erad‐dependentcontrolof pages 10-12).
Experimental evidence for the CGRRF1-UBE2J2 partnership includes:
- Functional complementation: Knockdown of either CGRRF1 or UBE2J2 produces similar phenotypes, including stabilization of Evi protein and reduced Evi ubiquitination (glaeser2018erad‐dependentcontrolof pages 10-12, glaeser2018erad‐dependentcontrolof pages 1-2)
- Biochemical interaction: The RING domain of CGRRF1 interacts with the catalytic domain of UBE2J2 to facilitate ubiquitin transfer to substrates (glaeser2018erad‐dependentcontrolof pages 10-12)
The ubiquitin chains formed on Evi substrates include K11-, K48-, and K63-linkages, as detected by mass spectrometry and linkage-specific antibodies (wolf2021eviwlsfunctionis pages 1-2). K48-linked polyubiquitin chains are the canonical signal for proteasomal degradation, while K11 and K63 linkages may contribute to substrate recognition and processing through the ERAD pathway.
CGRRF1 plays a critical regulatory role in the Wnt signaling pathway by controlling the availability of the Wnt cargo receptor Evi/WLS, which is essential for secretion of lipidated Wnt proteins (glaeser2018erad‐dependentcontrolof pages 1-2, glaeser2018erad‐dependentcontrolof pages 6-7, glaeser2018erad‐dependentcontrolof pages 13-14). The mechanism operates as a feedback loop that adjusts cellular secretory capacity to match Wnt ligand availability:
In the absence of Wnt ligands: Evi is continuously ubiquitinated by the CGRRF1-UBE2J2 complex and targeted for ERAD. The AAA-ATPase VCP/p97 extracts ubiquitinated Evi from the ER membrane and delivers it to the proteasome for degradation (glaeser2018erad‐dependentcontrolof pages 1-2, glaeser2018erad‐dependentcontrolof pages 6-7). This prevents accumulation of unused cargo receptor and maintains appropriate ER homeostasis.
In the presence of palmitoylated Wnt proteins: Wnt ligands bind to Evi following palmitoleic acid modification by the acyltransferase Porcupine (Porcn). This Wnt-Evi interaction stabilizes Evi by preventing its CGRRF1-mediated ubiquitination and degradation (glaeser2018erad‐dependentcontrolof pages 1-2, glaeser2018erad‐dependentcontrolof pages 3-4). The stabilized Evi accumulates and increases the cell's capacity to transport Wnt proteins to the cell surface for secretion. Inhibition of Porcn with the small molecule LGK974 blocks Wnt palmitoylation and results in rapid CGRRF1-dependent degradation of Evi (glaeser2018erad‐dependentcontrolof pages 3-4).
This regulatory mechanism ensures that Wnt-producing cells maintain an optimal level of cargo receptor that matches the demand for Wnt secretion. The pathway represents an elegant example of regulatory ERAD, where degradation of a functional protein is controlled by the availability of its cargo (glaeser2018erad‐dependentcontrolof pages 1-2, christianson2023mechanismsofsubstrate pages 50-53).
A triaging complex involving Porcupine (Porcn) and VCP appears to determine whether Evi enters the secretory pathway or the ERAD pathway (glaeser2018erad‐dependentcontrolof pages 1-2, glaeser2018erad‐dependentcontrolof pages 13-14). Porcn acts as both a Wnt-modifying enzyme and a sensor of Wnt availability, helping coordinate the decision between Evi stabilization (for secretion) and Evi degradation (via ERAD).
As an ER-resident E3 ubiquitin ligase, CGRRF1 is a component of the broader ERAD machinery that maintains ER protein homeostasis (kaneko2016genomewideidentificationand pages 1-2, christianson2023mechanismsofsubstrate pages 50-53, fenech2020interactionmappingof pages 1-2). ERAD is a specialized ubiquitin-proteasome system pathway that prevents the secretion and aggregation of proteins that have failed to fold properly or are no longer needed (christianson2023mechanismsofsubstrate pages 50-53).
The ERAD pathway involving CGRRF1 includes several key components:
- Recognition: ERLIN2 links Evi/WLS to the ubiquitination machinery, potentially serving as an adapter or recognition factor (wolf2021eviwlsfunctionis pages 1-2, christianson2023mechanismsofsubstrate pages 50-53)
- Ubiquitination: CGRRF1 (E3 ligase) and UBE2J2 (E2 enzyme) catalyze polyubiquitin chain formation on substrates (glaeser2018erad‐dependentcontrolof pages 10-12, glaeser2018erad‐dependentcontrolof pages 1-2)
- Extraction/Dislocation: VCP/p97 (also known as Cdc48 in yeast) uses ATP hydrolysis to extract ubiquitinated substrates from the ER membrane (glaeser2018erad‐dependentcontrolof pages 1-2, glaeser2018erad‐dependentcontrolof pages 6-7)
- Degradation: Extracted substrates are delivered to the 26S proteasome for proteolysis (glaeser2018erad‐dependentcontrolof pages 1-2)
Recent comprehensive reviews of ERAD mechanisms in mammals cite CGRRF1 as a specialized ER-E3 ligase that extends beyond traditional protein quality control to regulate signaling pathway components (christianson2023mechanismsofsubstrate pages 50-53, wang2025sel1lhrd1mediatederadin pages 6-8, christianson2023mechanismsofsubstrate pages 26-30).
CGRRF1 expression is transcriptionally upregulated in response to ER stress (kaneko2016genomewideidentificationand pages 1-2). In a genome-wide screen of 37 candidate RING finger-containing, transmembrane protein-encoding genes, CGRRF1 was identified as one of four genes (along with RNFT1, RNF185, and RNF19B) whose expression was significantly increased following ER stress induction (kaneko2016genomewideidentificationand pages 1-2). This stress-responsive expression pattern suggests that CGRRF1 contributes to the cellular adaptive response to ER proteotoxic stress, potentially by enhancing the capacity for ERAD of accumulated or misfolded proteins.
However, unlike RNFT1 and RNF185, CGRRF1 overexpression did not confer significant resistance to ER stressor treatment in the initial screening study (kaneko2016genomewideidentificationand pages 1-2), suggesting that its primary role may be in regulatory ERAD rather than broad cytoprotection against ER stress.
The functional characterization of CGRRF1 is based on multiple complementary experimental approaches:
CGRRF1 has potential relevance to cancer biology through its regulation of Wnt signaling. Analysis of The Cancer Genome Atlas (TCGA) data revealed that CGRRF1 mRNA levels are reduced in several cancers, including endometrial and colon adenocarcinomas (glaeser2018erad‐dependentcontrolof pages 13-14). This downregulation could contribute to the aberrantly elevated Evi protein levels observed in cancer tissues, even in the absence of increased Evi transcription (glaeser2018erad‐dependentcontrolof pages 13-14).
Since Wnt signaling is frequently dysregulated in cancer and drives tumor progression, the loss of CGRRF1-mediated control over Evi/WLS abundance could enhance Wnt secretory capacity and promote autocrine/paracrine Wnt signaling in tumors (glaeser2018erad‐dependentcontrolof pages 1-2, glaeser2018erad‐dependentcontrolof pages 13-14). This mechanism represents a potential indirect route to Wnt pathway activation that is distinct from mutations in downstream Wnt pathway components like β-catenin or APC.
The therapeutic implications are noteworthy: targeting CGRRF1 or the ERAD pathway components that regulate Evi/WLS could provide an alternative approach to blocking Wnt secretion in Wnt-driven malignancies (glaeser2018erad‐dependentcontrolof pages 1-2, glaeser2018erad‐dependentcontrolof pages 13-14). Current clinical trials are exploring Porcupine inhibitors like LGK974 to block Wnt secretion, but modulation of the CGRRF1-mediated ERAD pathway represents an unexplored therapeutic avenue.
Given CGRRF1's role in ER protein quality control and its stress-responsive expression, the protein may have relevance to diseases involving ER proteostasis dysfunction. Recent work has highlighted the importance of ER-resident E3 ligases in maintaining cellular protein homeostasis and responding to metabolic challenges (christianson2023mechanismsofsubstrate pages 50-53, wang2025sel1lhrd1mediatederadin pages 6-8). However, no direct genetic associations between CGRRF1 mutations and human disease have been reported to date, unlike other ERAD components such as SEL1L and HRD1, which are linked to neurodevelopmental disorders (wang2025sel1lhrd1mediatederadin pages 6-8).
Despite significant advances in understanding CGRRF1's role in Evi/WLS regulation and Wnt secretion, several important questions remain:
Substrate repertoire: Beyond Evi/WLS, the full spectrum of CGRRF1 substrates is unknown. Proximity labeling studies suggest potential involvement in nuclear envelope protein regulation, but these remain to be validated (cheng2022sharedanddistinctivea pages 6-7, cheng2022sharedanddistinctivea pages 3-4).
Structural mechanism: High-resolution structural information for CGRRF1 is not available. The mechanistic details of how CGRRF1 recognizes substrates, engages UBE2J2, and coordinates with other ERAD factors remain to be elucidated at the atomic level.
Tissue-specific roles: The physiological importance of CGRRF1 in different tissues and developmental stages is poorly characterized. Generation of tissue-specific knockout mouse models would help address this gap.
Regulation: The mechanisms controlling CGRRF1 expression beyond ER stress, as well as potential post-translational modifications that regulate its activity, are not well understood.
Clinical validation: While CGRRF1 expression correlates with cancer outcomes in database analyses, direct experimental evidence linking CGRRF1 loss to tumor progression or therapeutic response is limited (glaeser2018erad‐dependentcontrolof pages 13-14).
Recent comprehensive reviews of ERAD mechanisms acknowledge CGRRF1 as an important but incompletely characterized member of the ER-resident E3 ligase family (christianson2023mechanismsofsubstrate pages 50-53, christianson2023mechanismsofsubstrate pages 26-30).
| Feature | Summary for human CGRRF1 | Key evidence/citation |
|---|---|---|
| Protein identity | CGRRF1 = cell growth regulator with RING finger domain protein 1; aliases include CGR19 and RNF197. Literature on ERAD/Wnt regulation refers to the same human ER-associated RING finger protein. | (glaeser2018erad‐dependentcontrolof pages 1-2, kaneko2016genomewideidentificationand pages 1-2) |
| Primary molecular function | Best-supported function is an ER-resident RING-type E3 ubiquitin ligase involved in ER-associated degradation (ERAD) and regulatory control of membrane protein abundance, especially the Wnt cargo receptor Evi/WLS. | (glaeser2018erad‐dependentcontrolof pages 1-2, wolf2021eviwlsfunctionis pages 1-2, glaeser2018erad‐dependentcontrolof pages 13-14) |
| Enzymatic activity status | CGRRF1 was reported in one screen to lack detectable in vitro autoubiquitination activity when tested with a promiscuous E2 (UbcH5a), but later substrate-focused work showed that CGRRF1 is required for Evi ubiquitination and degradation, consistent with E2- and substrate-specific E3 activity. | (kaneko2016genomewideidentificationand pages 1-2, glaeser2018erad‐dependentcontrolof pages 13-14, glaeser2018erad‐dependentcontrolof pages 10-12) |
| Structural features | CGRRF1 is a single-pass membrane protein with a predicted transmembrane segment near aa 15-37 and a cytosolic C3HC4 RING domain at aa 274-315. The RING contains conserved cysteine/histidine residues required for catalytic function. | (glaeser2018erad‐dependentcontrolof pages 10-12, kaneko2016genomewideidentificationand pages 1-2) |
| Catalytic importance of RING domain | Mutation of conserved cysteines in the CGRRF1 RING domain stabilized interaction with endogenous Evi and increased Evi steady-state levels, indicating that the intact RING domain is required for substrate turnover. | (glaeser2018erad‐dependentcontrolof pages 10-12) |
| Subcellular localization | CGRRF1 is partially localized to the endoplasmic reticulum and is considered one of the ER membrane-embedded ubiquitin ligases. Its topology places the catalytic RING domain on the cytosolic side of the ER membrane. | (kaneko2016genomewideidentificationand pages 1-2, fenech2020interactionmappingof pages 1-2, glaeser2018erad‐dependentcontrolof pages 10-12) |
| Additional localization inference | Proximity-labeling studies of nuclear-envelope proteins identified CGRRF1 in the emerin/LBR neighborhood, suggesting presence in the ER–nuclear envelope continuum and possible access to the inner nuclear membrane proteostasis environment. | (cheng2022sharedanddistinctivea pages 6-7, cheng2022sharedanddistinctivea pages 3-4) |
| Known substrate: Evi/WLS | The strongest experimentally supported substrate is Evi/WLS (GPR177), the Wnt cargo receptor. In the absence of Wnt ligands, Evi is ubiquitinated and degraded by ERAD, requiring CGRRF1. | (glaeser2018erad‐dependentcontrolof pages 1-2, wolf2021eviwlsfunctionis pages 1-2, glaeser2018erad‐dependentcontrolof pages 10-12) |
| Evidence for Evi substrate assignment | siRNA knockdown of CGRRF1 increased Evi abundance; TUBE pulldown showed reduced ubiquitinated Evi after CGRRF1 knockdown; CGRRF1 co-immunoprecipitated with Evi. | (glaeser2018erad‐dependentcontrolof pages 10-12, wolf2021eviwlsfunctionis pages 1-2) |
| Other candidate substrates | A proteomics study suggested that CGRRF1 may influence lamin B receptor (LBR) abundance, but this remains preliminary/candidate-level evidence, not yet a firmly established direct substrate relationship. | (cheng2022sharedanddistinctivea pages 6-7) |
| E2 enzyme partner(s) | The best-supported cognate E2 is UBE2J2, which works with CGRRF1 in Evi ubiquitination. UBE2J2 and CGRRF1 depletion produce similar stabilization of Evi and reduced Evi ubiquitination. | (glaeser2018erad‐dependentcontrolof pages 1-2, glaeser2018erad‐dependentcontrolof pages 10-12, glaeser2018erad‐dependentcontrolof pages 13-14) |
| Interacting proteins/cofactors | Factors linked to the same Evi ERAD route include VCP/p97 for extraction/dislocation, Porcn as a triage factor coupling cargo loading versus degradation, and ERLIN2, which links EVI/WLS to the ubiquitination machinery. | (glaeser2018erad‐dependentcontrolof pages 1-2, glaeser2018erad‐dependentcontrolof pages 6-7, wolf2021eviwlsfunctionis pages 1-2) |
| ERAD role | CGRRF1 participates in regulatory ERAD rather than only disposal of misfolded proteins, helping tune the abundance of a mature secretory-pathway factor (Evi/WLS) according to cellular need. | (glaeser2018erad‐dependentcontrolof pages 1-2, wolf2021eviwlsfunctionis pages 1-2, christianson2023mechanismsofsubstrate pages 50-53) |
| Wnt pathway role | By limiting or permitting Evi/WLS abundance, CGRRF1 indirectly regulates the capacity for Wnt ligand secretion. Thus, CGRRF1 functions upstream of extracellular Wnt signaling by controlling cargo-receptor availability in Wnt-producing cells. | (glaeser2018erad‐dependentcontrolof pages 1-2, glaeser2018erad‐dependentcontrolof pages 6-7, glaeser2018erad‐dependentcontrolof pages 13-14) |
| Mechanistic model in Wnt-producing cells | Without palmitoleated Wnt, Evi is polyubiquitinated and sent to ERAD via CGRRF1/UBE2J2/VCP. With Wnt present, Evi is stabilized, increasing secretory capacity for Wnt export. | (glaeser2018erad‐dependentcontrolof pages 1-2, glaeser2018erad‐dependentcontrolof pages 6-7, glaeser2018erad‐dependentcontrolof pages 3-4) |
| Ubiquitin chain context | EVI/WLS was reported to carry K11, K48, and K63-linked ubiquitin modifications in the broader pathway analysis; CGRRF1 is specifically implicated in the Evi ubiquitination step together with UBE2J2. | (wolf2021eviwlsfunctionis pages 1-2, glaeser2018erad‐dependentcontrolof pages 10-12) |
| ER stress regulation | CGRRF1 transcript levels were identified as significantly upregulated by ER stress in a genome-wide survey of candidate ERAD E3 ligases, supporting a role in ER proteostasis. | (kaneko2016genomewideidentificationand pages 1-2) |
| Broader ER-E3 classification | Reviews of ERAD place CGRRF1 among the set of ER-resident transmembrane E3 ligases whose functions extend beyond classic quality control to regulated control of signaling and metabolic proteins. | (fenech2020interactionmappingof pages 1-2, christianson2023mechanismsofsubstrate pages 50-53, wang2025sel1lhrd1mediatederadin pages 6-8) |
| Disease/cancer relevance | The most direct disease relevance from available evidence is indirect: CGRRF1 mRNA is reduced in some cancers (including endometrial and colon adenocarcinomas in TCGA-based analysis discussed by Glaeser et al.), which could contribute to elevated Evi/Wnt secretory activity. | (glaeser2018erad‐dependentcontrolof pages 13-14) |
| Functional implication in cancer biology | Because Evi/WLS and Wnt secretion are frequently dysregulated in cancer, CGRRF1 is proposed as a potential modulator of Wnt-driven malignancy, though this remains a mechanistic inference rather than a clinically validated biomarker/target. | (glaeser2018erad‐dependentcontrolof pages 1-2, glaeser2018erad‐dependentcontrolof pages 13-14) |
| Current limitations of knowledge | CGRRF1 remains poorly characterized outside the Evi/WLS pathway: substrate scope, structural mechanism, tissue-specific roles, and disease causality are still incompletely defined. Recent ERAD reviews cite CGRRF1 mainly as an example of a specialized ER-E3 in Wnt cargo-receptor control. | (christianson2023mechanismsofsubstrate pages 50-53, wang2025sel1lhrd1mediatederadin pages 6-8) |
Table: This table compiles the main experimentally supported features of human CGRRF1, including its identity, structure, localization, enzymatic role, pathway context, and disease relevance. It is useful as a concise evidence-based reference for functional annotation of this relatively understudied ER-associated RING finger protein.
CGRRF1 (Cell Growth Regulator with RING Finger Domain Protein 1, also known as CGR19 or RNF197) is an ER membrane-embedded E3 ubiquitin ligase that plays a specialized role in regulatory ER-associated degradation (ERAD). The protein functions primarily to control the abundance of the Wnt cargo receptor Evi/WLS, thereby regulating cellular capacity for Wnt ligand secretion. CGRRF1 works in partnership with the E2 enzyme UBE2J2 to ubiquitinate substrates marked for proteasomal degradation. The protein's activity is regulated by Wnt ligand availability, creating a feedback mechanism that adjusts Evi levels to match secretory demand. CGRRF1 is transcriptionally upregulated by ER stress and may have broader roles in ER and nuclear envelope proteostasis. Reduced CGRRF1 expression in certain cancers suggests potential involvement in Wnt-driven malignancies, though the clinical significance requires further validation. While CGRRF1's role in Evi/WLS regulation is well-established through multiple experimental approaches, the full substrate repertoire, structural mechanism, and physiological importance in different tissues remain areas for future investigation.
References
(kaneko2016genomewideidentificationand pages 1-2): Masayuki Kaneko, Ikuko Iwase, Yuki Yamasaki, Tomoko Takai, Yan Wu, Soshi Kanemoto, Koji Matsuhisa, Rie Asada, Yasunobu Okuma, Takeshi Watanabe, Kazunori Imaizumi, and Yausyuki Nomura. Genome-wide identification and gene expression profiling of ubiquitin ligases for endoplasmic reticulum protein degradation. Scientific Reports, Aug 2016. URL: https://doi.org/10.1038/srep30955, doi:10.1038/srep30955. This article has 92 citations and is from a peer-reviewed journal.
(glaeser2018erad‐dependentcontrolof pages 1-2): Kathrin Glaeser, Manuela Urban, Emma Fenech, Oksana Voloshanenko, Dominique Kranz, Federica Lari, John C Christianson, and Michael Boutros. Erad‐dependent control of the wnt secretory factor evi. The EMBO Journal, Jan 2018. URL: https://doi.org/10.15252/embj.201797311, doi:10.15252/embj.201797311. This article has 71 citations.
(fenech2020interactionmappingof pages 1-2): Emma J Fenech, Federica Lari, Philip D Charles, Roman Fischer, Marie Laétitia-Thézénas, Katrin Bagola, Adrienne W Paton, James C Paton, Mads Gyrd-Hansen, Benedikt M Kessler, and John C Christianson. Interaction mapping of endoplasmic reticulum ubiquitin ligases identifies modulators of innate immune signalling. eLife, Jul 2020. URL: https://doi.org/10.7554/elife.57306, doi:10.7554/elife.57306. This article has 107 citations and is from a domain leading peer-reviewed journal.
(wolf2021eviwlsfunctionis pages 1-2): Lucie M. Wolf, Annika M. Lambert, Julie Haenlin, and Michael Boutros. Evi/wls function is regulated by ubiquitylation and is linked to er-associated degradation by erlin2. Journal of Cell Science, Aug 2021. URL: https://doi.org/10.1242/jcs.257790, doi:10.1242/jcs.257790. This article has 31 citations and is from a domain leading peer-reviewed journal.
(christianson2023mechanismsofsubstrate pages 50-53): John C. Christianson, Ernst Jarosch, and Thomas Sommer. Mechanisms of substrate processing during er-associated protein degradation. Nature Reviews Molecular Cell Biology, 24:777-796, Aug 2023. URL: https://doi.org/10.1038/s41580-023-00633-8, doi:10.1038/s41580-023-00633-8. This article has 193 citations and is from a domain leading peer-reviewed journal.
(glaeser2018erad‐dependentcontrolof pages 10-12): Kathrin Glaeser, Manuela Urban, Emma Fenech, Oksana Voloshanenko, Dominique Kranz, Federica Lari, John C Christianson, and Michael Boutros. Erad‐dependent control of the wnt secretory factor evi. The EMBO Journal, Jan 2018. URL: https://doi.org/10.15252/embj.201797311, doi:10.15252/embj.201797311. This article has 71 citations.
(glaeser2018erad‐dependentcontrolof pages 13-14): Kathrin Glaeser, Manuela Urban, Emma Fenech, Oksana Voloshanenko, Dominique Kranz, Federica Lari, John C Christianson, and Michael Boutros. Erad‐dependent control of the wnt secretory factor evi. The EMBO Journal, Jan 2018. URL: https://doi.org/10.15252/embj.201797311, doi:10.15252/embj.201797311. This article has 71 citations.
(cheng2022sharedanddistinctivea pages 6-7): Li-Chun Cheng, Xi Zhang, Kanishk Abhinav, Julie A Nguyen, Sabyasachi Baboo, Salvador Martinez-Bartolomé, Tess C Branon, Alice Y Ting, Esther Loose, John R Yates, and Larry Gerace. Shared and distinctive neighborhoods of emerin and lamin b receptor revealed by proximity labeling and quantitative proteomics. Journal of Proteome Research, 21:2197-2210, Aug 2022. URL: https://doi.org/10.1021/acs.jproteome.2c00281, doi:10.1021/acs.jproteome.2c00281. This article has 14 citations and is from a peer-reviewed journal.
(cheng2022sharedanddistinctivea pages 3-4): Li-Chun Cheng, Xi Zhang, Kanishk Abhinav, Julie A Nguyen, Sabyasachi Baboo, Salvador Martinez-Bartolomé, Tess C Branon, Alice Y Ting, Esther Loose, John R Yates, and Larry Gerace. Shared and distinctive neighborhoods of emerin and lamin b receptor revealed by proximity labeling and quantitative proteomics. Journal of Proteome Research, 21:2197-2210, Aug 2022. URL: https://doi.org/10.1021/acs.jproteome.2c00281, doi:10.1021/acs.jproteome.2c00281. This article has 14 citations and is from a peer-reviewed journal.
(glaeser2018erad‐dependentcontrolof pages 6-7): Kathrin Glaeser, Manuela Urban, Emma Fenech, Oksana Voloshanenko, Dominique Kranz, Federica Lari, John C Christianson, and Michael Boutros. Erad‐dependent control of the wnt secretory factor evi. The EMBO Journal, Jan 2018. URL: https://doi.org/10.15252/embj.201797311, doi:10.15252/embj.201797311. This article has 71 citations.
(glaeser2018erad‐dependentcontrolof pages 3-4): Kathrin Glaeser, Manuela Urban, Emma Fenech, Oksana Voloshanenko, Dominique Kranz, Federica Lari, John C Christianson, and Michael Boutros. Erad‐dependent control of the wnt secretory factor evi. The EMBO Journal, Jan 2018. URL: https://doi.org/10.15252/embj.201797311, doi:10.15252/embj.201797311. This article has 71 citations.
(wang2025sel1lhrd1mediatederadin pages 6-8): Huilun Helen Wang, Ida Biunno, Shengyi Sun, and Ling Qi. Sel1l-hrd1-mediated erad in mammals. Nature cell biology, 27:1063-1073, Jun 2025. URL: https://doi.org/10.1038/s41556-025-01690-1, doi:10.1038/s41556-025-01690-1. This article has 24 citations and is from a highest quality peer-reviewed journal.
(christianson2023mechanismsofsubstrate pages 26-30): John C. Christianson, Ernst Jarosch, and Thomas Sommer. Mechanisms of substrate processing during er-associated protein degradation. Nature Reviews Molecular Cell Biology, 24:777-796, Aug 2023. URL: https://doi.org/10.1038/s41580-023-00633-8, doi:10.1038/s41580-023-00633-8. This article has 193 citations and is from a domain leading peer-reviewed journal.