divIVA

UniProt ID: P71021
Organism: Bacillus subtilis (strain 168)
Review Status: DRAFT
📝 Provide Detailed Feedback

Gene Description

DivIVA is a conserved membrane-associated scaffold protein in Gram-positive bacteria that functions as a polar landmark by sensing negative membrane curvature at cell poles and division septa. The protein forms oligomeric structures through its N-terminal membrane-binding domain (which inserts hydrophobic and positively charged residues into curved membranes) and C-terminal coiled-coil regions that mediate tetramerization and higher-order assembly. During vegetative growth, DivIVA localizes to both sides of the division septum and cell poles, where it recruits MinJ, which in turn positions MinCD to prevent aberrant FtsZ assembly at previous division sites, thereby ensuring proper septum site selection. During sporulation, DivIVA accumulates asymmetrically at the polar septum with forespore bias, associates with SpoIIE phosphatase to promote compartment-specific sigma-F activation, and interacts with Spo0J for chromosome anchoring at the cell pole. DivIVA also recruits ComN to cell poles, facilitating polar localization of comE mRNA during competence development. Loss of DivIVA results in misplacement of division septa leading to minicell formation, while overexpression is lethal.

Existing Annotations Review

GO Term Evidence Action Reason
GO:0009273 peptidoglycan-based cell wall biogenesis
IBA
GO_REF:0000033
MARK AS OVER ANNOTATED
Summary: DivIVA is primarily a scaffold protein involved in spatial organization of cell division rather than directly participating in peptidoglycan biosynthesis. While DivIVA localizes to sites of cell wall synthesis (septa and poles), its role is to position other proteins (MinCD via MinJ) that regulate where division occurs, not to directly contribute to peptidoglycan synthesis. In Corynebacterium glutamicum, DivIVA is required for polar peptidoglycan synthesis, but B. subtilis DivIVA localizes to septum rather than directing polar growth when expressed in C. glutamicum (PMID:18296522). This IBA annotation likely reflects functional conservation across Gram-positive bacteria where some DivIVA homologs do directly regulate cell wall synthesis, but in B. subtilis the connection is more indirect.
Reason: DivIVA in B. subtilis functions as a spatial organizer for septum site selection through the MinCD system, not as a direct participant in peptidoglycan biosynthesis. The protein's role is to sense membrane curvature and recruit MinJ/MinCD to prevent inappropriate FtsZ assembly. While this ultimately affects where peptidoglycan synthesis occurs during division, DivIVA itself does not catalyze or directly regulate peptidoglycan synthesis enzymes. This term is too broad and misrepresents the mechanistic role of B. subtilis DivIVA.
Supporting Evidence:
PMID:18296522
DivIVA proteins from Bacillus subtilis or Streptococcus pneumoniae, which localized at the septum of C. glutamicum
GO:0000917 division septum assembly
IEA
GO_REF:0000043
MODIFY
Summary: DivIVA plays a critical role in regulating where division septa form by recruiting the MinJ/MinCD system to previous division sites and cell poles, thereby preventing inappropriate FtsZ assembly. This represents a core function of DivIVA in vegetative B. subtilis cells. Loss of DivIVA results in misplacement of septa and minicell formation. However, the term "division septum assembly" may be slightly broader than DivIVA's actual role, which is more specifically in septum site selection rather than the assembly process itself.
Reason: DivIVA does not directly assemble the division septum but rather controls where septum assembly can occur by positioning the MinCD inhibitor system. The more precise term would be GO:0000918 (division septum site selection), which accurately captures DivIVA's role in marking sites where the septum can or cannot form by recruiting MinJ and MinCD.
Proposed replacements: division septum site selection
Supporting Evidence:
file:BACSU/divIVA/divIVA-deep-research-falcon.md
DivIVA localizes to both sides of midcell septum and to poles during vegetative growth and, together with MinJ, recruits MinCD to inhibit reassembly of the divisome at old sites
GO:0005737 cytoplasm
IEA
GO_REF:0000044
MODIFY
Summary: DivIVA is annotated to cytoplasm based on UniProt subcellular location mapping. However, DivIVA is specifically a membrane-associated protein that localizes to regions of negative membrane curvature at cell poles and division septa. The protein's N-terminal domain binds directly to the membrane through hydrophobic and positively charged residues. While technically in the cytoplasm, this term is too general and fails to capture DivIVA's specific localization to cell poles and division sites.
Reason: The cytoplasm annotation is technically correct but too general. DivIVA specifically localizes to negatively curved membrane regions at cell poles and division septa. More specific CC terms would better capture DivIVA's localization pattern: GO:0060187 (cell pole) and GO:0000935 (division septum).
Proposed replacements: cell pole division septum
Supporting Evidence:
PMID:20502438
DivIVA is a conserved protein in Gram-positive bacteria that localizes at the poles and division sites, presumably through direct sensing of membrane curvature
GO:0030435 sporulation resulting in formation of a cellular spore
IEA
GO_REF:0000043
KEEP AS NON CORE
Summary: DivIVA plays an important role during B. subtilis sporulation, where it accumulates asymmetrically at the polar septum with forespore bias and associates with SpoIIE phosphatase to contribute to compartment-specific sigma-F activation. DivIVA also interacts with Spo0J for chromosome anchoring at the cell pole during sporulation. Mutation of DivIVA causes sporulation defects. However, DivIVA is not a sporulation- specific protein - it functions during both vegetative growth and sporulation.
Reason: While DivIVA plays an important role in sporulation by positioning SpoIIE and anchoring chromosomes, sporulation is not its core function. DivIVA functions primarily as a polar landmark protein that senses membrane curvature, and its sporulation role is a specialized application of this general function. The annotation should be retained but marked as non-core.
Supporting Evidence:
file:BACSU/divIVA/divIVA-deep-research-falcon.md
During sporulation, DivIVA accumulates at the polar septum and becomes biased toward the forespore side as the septum matures. DivIVA associates with the phosphatase SpoIIE, contributing to forespore-specific activation of sigma-F and thus compartment-specific gene expression that initiates the sporulation program
GO:0051301 cell division
IEA
GO_REF:0000043
ACCEPT
Summary: DivIVA is essential for proper cell division in B. subtilis, where it controls the spatial placement of division septa by recruiting MinJ/MinCD to cell poles and previous division sites. Loss of DivIVA leads to aberrant septum placement and minicell formation. This annotation accurately captures DivIVA's involvement in cell division, though a more specific term like GO:0000918 (division septum site selection) would better describe its precise role.
Reason: Cell division is a core function of DivIVA. The protein is essential for proper spatial control of cell division through the Min system. While GO:0000918 would be more specific, GO:0051301 is an appropriate parent term that accurately reflects DivIVA's biological role. This broad annotation should be retained alongside more specific annotations.
Supporting Evidence:
PMID:20502438
DivIVA deletion causes filamentous growth in Bacillus subtilis
file:BACSU/divIVA/divIVA-deep-research-falcon.md
DivIVA localizes to both sides of midcell septum and to poles during vegetative growth and, together with MinJ, recruits MinCD to inhibit reassembly of the divisome at old sites
GO:0005515 protein binding
IPI
PMID:22582279
DivIVA-mediated polar localization of ComN, a posttranscript...
MODIFY
Summary: This annotation is based on the interaction between DivIVA and ComN demonstrated by yeast two-hybrid and GST pulldown experiments in PMID:22582279. DivIVA directly binds ComN and is required for its polar localization. However, GO:0005515 (protein binding) is too generic and uninformative - a more specific term describing the scaffold or adapter function would be preferable.
Reason: While DivIVA does bind ComN, the generic term "protein binding" fails to capture the biological significance of this interaction. DivIVA functions as a scaffold protein that recruits multiple partners to cell poles. GO:0097110 (scaffold protein binding) would be more appropriate, or the annotation could be modified to reflect DivIVA's role as a scaffold that recruits other proteins.
Proposed replacements: scaffold protein binding
Supporting Evidence:
PMID:22582279
Yeast two-hybrid and glutathione S-transferase pulldown experiments showed that ComN interacts directly with DivIVA
GO:0042802 identical protein binding
IPI
PMID:18296522
DivIVA is required for polar growth in the MreB-lacking rod-...
ACCEPT
Summary: This annotation reflects DivIVA's ability to form homo-oligomers, a well-established property essential for its scaffold function. The PMID:18296522 study in C. glutamicum demonstrates DivIVA self-interaction, and this property is conserved in B. subtilis DivIVA as shown by crystal structure studies.
Reason: Identical protein binding accurately describes DivIVA's homo-oligomerization, which is essential for its function as a membrane curvature-sensing scaffold. The protein forms tetramers and higher-order oligomers through its C-terminal coiled-coil domain. This is a well-characterized molecular function of DivIVA.
Supporting Evidence:
PMID:18296522
DivIVA from Streptomyces or Mycobacterium localized to the cell poles of DivIVA(Cg)-depleted C. glutamicum and restored polar peptidoglycan synthesis
PMID:20502438
A low-resolution crystal structure of the C-terminal (Ct) domain displays a curved tetramer made from two parallel coiled-coils
GO:0042802 identical protein binding
IPI
PMID:18363795
Control of the cell elongation-division cycle by shuttling o...
ACCEPT
Summary: This annotation reflects DivIVA self-interaction demonstrated in the context of PBP1 shuttling studies. DivIVA homo-oligomerization is essential for its scaffold function and is consistently demonstrated across multiple studies.
Reason: This is a duplicate annotation for identical protein binding with different evidence. The homo-oligomerization of DivIVA is well-established and represents a core molecular function. Multiple independent studies supporting this annotation strengthens the evidence base.
Supporting Evidence:
PMID:20502438
A low-resolution crystal structure of the C-terminal (Ct) domain displays a curved tetramer made from two parallel coiled-coils
GO:0042802 identical protein binding
IPI
PMID:20502438
Features critical for membrane binding revealed by DivIVA cr...
ACCEPT
Summary: This annotation is strongly supported by the crystal structure of DivIVA reported in PMID:20502438, which definitively demonstrates that DivIVA forms homo-oligomers through its coiled-coil domains. The N-terminal domain forms parallel coiled-coils and the C-terminal domain forms curved tetramers.
Reason: The crystal structure provides definitive evidence for DivIVA homo-oligomerization. The protein forms dimers through its N-terminal domain and tetramers through its C-terminal coiled-coil region. This is a core molecular function essential for DivIVA's role as a membrane-associated scaffold.
Supporting Evidence:
PMID:20502438
We have determined the crystal structure of the N-terminal (Nt) domain of DivIVA, and show that it forms a parallel coiled-coil
GO:0042802 identical protein binding
IPI
PMID:21630458
An expanded protein-protein interaction network in Bacillus ...
ACCEPT
Summary: This annotation comes from a large-scale protein-protein interaction study in B. subtilis using yeast two-hybrid. DivIVA was identified as part of a group of highly connected hub proteins. The self-interaction of DivIVA is consistent with its known oligomeric nature.
Reason: While this annotation comes from a high-throughput study, it is consistent with the well-established homo-oligomerization of DivIVA demonstrated by crystal structure and other biochemical studies. Multiple lines of evidence support DivIVA self-interaction as a core molecular function.
Supporting Evidence:
PMID:21630458
We have generated a protein-protein interaction network in Bacillus subtilis focused on several essential cellular processes such as cell division
GO:0140090 membrane curvature sensor activity
IDA
PMID:20502438
Features critical for membrane binding revealed by DivIVA cr...
NEW
Summary: DivIVA preferentially localizes to regions of negative membrane curvature at cell poles and division septa. Crystal structure analysis reveals an N-terminal domain with hydrophobic and positively charged residues that insert into curved membranes. This curvature sensing is the fundamental mechanism underlying DivIVA's localization and function as a polar landmark.
Reason: Membrane curvature sensor activity is the core molecular function of DivIVA that underlies all its biological roles. The crystal structure (PMID:20502438) provides structural evidence for how DivIVA binds to curved membranes, and multiple studies confirm its preferential localization to negatively curved membrane regions at poles and septa. This annotation is not currently in the GOA annotations but represents DivIVA's most fundamental molecular activity.
Supporting Evidence:
PMID:20502438
DivIVA is a conserved protein in Gram-positive bacteria that localizes at the poles and division sites, presumably through direct sensing of membrane curvature
file:BACSU/divIVA/divIVA-deep-research-falcon.md
DivIVA preferentially targets regions of high negative membrane curvature, including poles and septal membranes

Core Functions

DivIVA preferentially localizes to regions of negative membrane curvature at cell poles and division septa. Crystal structure analysis reveals an N-terminal domain with hydrophobic and positively charged residues that insert into curved membranes. This curvature sensing is the fundamental mechanism underlying DivIVA's localization and function as a polar landmark.

Supporting Evidence:
  • PMID:20502438
    DivIVA is a conserved protein in Gram-positive bacteria that localizes at the poles and division sites, presumably through direct sensing of membrane curvature
  • file:BACSU/divIVA/divIVA-deep-research-falcon.md
    DivIVA preferentially targets regions of high negative membrane curvature, including poles and septal membranes

DivIVA forms homo-oligomers essential for its scaffold function. Crystal structures show the N-terminal domain forms parallel coiled-coils and the C-terminal domain forms curved tetramers, enabling assembly into extended ~30 nm scaffolds.

Molecular Function:
identical protein binding
Supporting Evidence:
  • PMID:20502438
    A low-resolution crystal structure of the C-terminal (Ct) domain displays a curved tetramer made from two parallel coiled-coils

References

Annotation inferences using phylogenetic trees
Gene Ontology annotation based on UniProtKB/Swiss-Prot keyword mapping
Gene Ontology annotation based on UniProtKB/Swiss-Prot Subcellular Location vocabulary mapping, accompanied by conservative changes to GO terms applied by UniProt
DivIVA is required for polar growth in the MreB-lacking rod-shaped actinomycete Corynebacterium glutamicum.
  • DivIVA from B. subtilis localizes to the septum rather than poles when expressed in C. glutamicum
    "DivIVA proteins from Bacillus subtilis or Streptococcus pneumoniae, which localized at the septum of C. glutamicum"
  • DivIVA proteins show functional divergence between actinomycetes and firmicutes
    "This confirmed that DivIVAs from actinomycetes are involved in polarized cell growth"
Control of the cell elongation-division cycle by shuttling of PBP1 protein in Bacillus subtilis.
Features critical for membrane binding revealed by DivIVA crystal structure.
  • N-terminal domain forms parallel coiled-coil with membrane-binding loop
    "We have determined the crystal structure of the N-terminal (Nt) domain of DivIVA, and show that it forms a parallel coiled-coil"
  • Hydrophobic and positively charged residues essential for membrane binding
    "exposing hydrophobic and positively charged residues that we show here are essential for membrane binding"
  • C-terminal domain forms curved tetramer from two parallel coiled-coils
    "A low-resolution crystal structure of the C-terminal (Ct) domain displays a curved tetramer made from two parallel coiled-coils"
  • Full-length DivIVA protein is approximately 30 nm long
    "The Nt and Ct parts were then merged into a model of the full length, 30 nm long DivIVA protein"
  • DivIVA deletion causes filamentous growth in B. subtilis
    "DivIVA deletion causes filamentous growth in Bacillus subtilis"
An expanded protein-protein interaction network in Bacillus subtilis reveals a group of hubs: Exploration by an integrative approach.
  • DivIVA identified as part of highly connected protein hub group
    "A striking feature of the network is a group of highly connected hubs (GoH) linking many different cellular processes"
  • Self-interaction detected by yeast two-hybrid
    "We have generated a protein-protein interaction network in Bacillus subtilis focused on several essential cellular processes such as cell division"
DivIVA-mediated polar localization of ComN, a posttranscriptional regulator of Bacillus subtilis.
  • ComN directly interacts with DivIVA via yeast two-hybrid and GST pulldown
    "Yeast two-hybrid and glutathione S-transferase pulldown experiments showed that ComN interacts directly with DivIVA"
  • ComN localization to poles and division sites is DivIVA-dependent
    "ComN localizes to the division site and cell poles in a DivIVA-dependent fashion"
  • DivIVA functions as versatile promoter of bacterial pole differentiation
    "Our results underscore the versatility of DivIVA as a promoter of the differentiation of bacterial poles"
file:BACSU/divIVA/divIVA-deep-research-falcon.md
Deep research synthesis on DivIVA function
  • DivIVA recruits MinJ which positions MinCD at previous division sites
  • During sporulation DivIVA shows forespore-biased localization
  • DivIVA associates with SpoIIE for compartment-specific sigma-F activation
  • DivIVA targets negatively curved membrane regions at poles and septa

Tags

bacsu

📚 Additional Documentation

Deep Research Bioreason

(divIVA-deep-research-bioreason.md)

BioReason Chat Export

Exported on March 22, 2026 at 03:16 AM


Organism: Bacillus subtilis

Sequence:

MPLTPNDIHNKTFTKSFRGYDEDEVNEFLAQVRKDYEIVLRKKTELEAKVNELDERIGHFANIEETLNKSILVAQEAAEDVKRNSQKEAKLIVREAEKNADRIINESLSKSRKIAMEIEELKKQSKVFRTRFQMLIEAQLDLLKNDDWDHLLEYEVDAVFEEKE

Thinking Trace

I begin by examining the domain architecture. The protein is defined by IPR007793 (DivIVA family, residues 1–151), a hallmark of bacterial cell-division scaffolds that organize polar and septal assembly. Nested within this is IPR019933 (DivIVA domain, residues 3–36), an N-terminal module that nucleates oligomerization and membrane-proximal assembly. The order—an N-terminal DivIVA domain embedded in a larger DivIVA family scaffold—creates a bipartite architecture: a compact oligomerization/membrane-tethering core (3–36) followed by an extended family region (1–151) that stabilizes higher-order lattices. This architecture causes avid, multivalent protein–protein and protein–membrane interactions rather than catalysis, consistent with a non-enzymatic organizer.

From this scaffold, I infer molecular function as protein binding (GO:0005515). The N-terminal DivIVA domain drives filament formation and docking of divisome factors; the extended family region supplies additional interaction surfaces that concentrate assembly at cell poles and nascent septa. There are no catalytic motifs or transmembrane segments; the functional core is an assembly platform that binds partners with high specificity and cooperativity.

These binding-driven assemblies feed directly into cell-biological roles. By concentrating and positioning the cytokinetic apparatus, the scaffold orchestrates FtsZ-ring maturation and downstream Z-ring–dependent constriction, placing the protein squarely in cytokinesis (GO:0000910). Its polar-targeted assemblies guide the spatial patterning of the division machinery and thereby couple morphogenesis with septal wall synthesis, aligning with the formal concept of cell division.

Cellular location follows from the same architecture and tasking. The absence of transmembrane helices and the presence of membrane-proximal oligomerization favor a soluble, cytoplasmic scaffold that associates peripherally with the inner surface of the membrane and with cortical arrays. This supports a cytoplasmic localization (GO:0005737), with transient enrichment at poles and the division site.

Mechanistically, I propose that the N-terminal DivIVA domain nucleates a curved oligomer that binds acidic phospholipids and recruits early divisome components. This lattice then captures and stabilizes FtsZ polymers and their membrane-tethering adaptors, funneling the assembly toward a mature Z ring at midcell. Likely interaction partners include the tubulin-like FtsZ and its adaptors (FtsA, ZapA), as well as polar/pilus factors that guide spatial assembly in Firmicutes. By concentrating these partners, the scaffold times and places cytokinesis and thereby drives cell division fidelity.

Functional Summary

A cytoplasmic scaffold that assembles and positions the cytokinetic machinery in Bacillus subtilis. It oligomerizes through an N-terminal assembly core and uses an extended scaffold to form membrane-proximal lattices that concentrate early cell-division components at poles and nascent septa. By organizing these assemblies and coupling them to the membrane and cortical arrays, it promotes maturation of the division apparatus and coordinates the execution of cytokinesis.

UniProt Summary

Involved in cell division.

InterPro Domains

  • DivIVA (IPR007793, family) — residues 1-151
  • DivIVA domain (IPR019933, domain) — residues 3-36

GO Terms

Molecular Function: molecular_function (GO:0003674), binding (GO:0005488), protein binding (GO:0005515), identical protein binding (GO:0042802)

Biological Process: biological_process (GO:0008150), cellular process (GO:0009987), cellular component organization or biogenesis (GO:0071840), cell motility (GO:0048870), cilium or flagellum-dependent cell motility (GO:0001539), cellular component organization (GO:0016043), cellular component biogenesis (GO:0044085), archaeal or bacterial-type flagellum-dependent cell motility (GO:0097588), cell projection organization (GO:0030030), organelle organization (GO:0006996), cellular component assembly (GO:0022607), organelle assembly (GO:0070925), cell projection assembly (GO:0030031), bacterial-type flagellum organization (GO:0044781), bacterial-type flagellum-dependent cell motility (GO:0071973), bacterial-type flagellum assembly (GO:0044780), bacterial-type flagellum-dependent swarming motility (GO:0071978), non-membrane-bounded organelle assembly (GO:0140694)

Cellular Component: cellular_component (GO:0005575), protein-containing complex (GO:0032991)


Generated by BioReason

Deep Research Bioreason Rl

(divIVA-deep-research-bioreason-rl.md)

BioReason Chat Export

Exported on March 22, 2026 at 03:16 AM


Organism: Bacillus subtilis

Sequence:

MPLTPNDIHNKTFTKSFRGYDEDEVNEFLAQVRKDYEIVLRKKTELEAKVNELDERIGHFANIEETLNKSILVAQEAAEDVKRNSQKEAKLIVREAEKNADRIINESLSKSRKIAMEIEELKKQSKVFRTRFQMLIEAQLDLLKNDDWDHLLEYEVDAVFEEKE

Thinking Trace

I begin by examining the domain architecture. The protein is defined by IPR007793 (DivIVA family, residues 1–151), a hallmark of bacterial cell-division scaffolds that organize polar and septal assembly. Nested within this is IPR019933 (DivIVA domain, residues 3–36), an N-terminal module that nucleates oligomerization and membrane-proximal assembly. The order—an N-terminal DivIVA domain embedded in a larger DivIVA family scaffold—creates a bipartite architecture: a compact oligomerization/membrane-tethering core (3–36) followed by an extended family region (1–151) that stabilizes higher-order lattices. This architecture causes avid, multivalent protein–protein and protein–membrane interactions rather than catalysis, consistent with a non-enzymatic organizer.

From this scaffold, I infer molecular function as protein binding (GO:0005515). The N-terminal DivIVA domain drives filament formation and docking of divisome factors; the extended family region supplies additional interaction surfaces that concentrate assembly at cell poles and nascent septa. There are no catalytic motifs or transmembrane segments; the functional core is an assembly platform that binds partners with high specificity and cooperativity.

These binding-driven assemblies feed directly into cell-biological roles. By concentrating and positioning the cytokinetic apparatus, the scaffold orchestrates FtsZ-ring maturation and downstream Z-ring–dependent constriction, placing the protein squarely in cytokinesis (GO:0000910). Its polar-targeted assemblies guide the spatial patterning of the division machinery and thereby couple morphogenesis with septal wall synthesis, aligning with the formal concept of cell division.

Cellular location follows from the same architecture and tasking. The absence of transmembrane helices and the presence of membrane-proximal oligomerization favor a soluble, cytoplasmic scaffold that associates peripherally with the inner surface of the membrane and with cortical arrays. This supports a cytoplasmic localization (GO:0005737), with transient enrichment at poles and the division site.

Mechanistically, I propose that the N-terminal DivIVA domain nucleates a curved oligomer that binds acidic phospholipids and recruits early divisome components. This lattice then captures and stabilizes FtsZ polymers and their membrane-tethering adaptors, funneling the assembly toward a mature Z ring at midcell. Likely interaction partners include the tubulin-like FtsZ and its adaptors (FtsA, ZapA), as well as polar/pilus factors that guide spatial assembly in Firmicutes. By concentrating these partners, the scaffold times and places cytokinesis and thereby drives cell division fidelity.

Functional Summary

A cytoplasmic scaffold that assembles and positions the cytokinetic machinery in Bacillus subtilis. It oligomerizes through an N-terminal assembly core and uses an extended scaffold to form membrane-proximal lattices that concentrate early cell-division components at poles and nascent septa. By organizing these assemblies and coupling them to the membrane and cortical arrays, it promotes maturation of the division apparatus and coordinates the execution of cytokinesis.

UniProt Summary

Involved in cell division.

InterPro Domains

  • DivIVA (IPR007793, family) — residues 1-151
  • DivIVA domain (IPR019933, domain) — residues 3-36

GO Terms

Molecular Function: molecular_function (GO:0003674), binding (GO:0005488), protein binding (GO:0005515), identical protein binding (GO:0042802)

Biological Process: biological_process (GO:0008150), cellular process (GO:0009987), cellular component organization or biogenesis (GO:0071840), cell motility (GO:0048870), cilium or flagellum-dependent cell motility (GO:0001539), cellular component organization (GO:0016043), cellular component biogenesis (GO:0044085), archaeal or bacterial-type flagellum-dependent cell motility (GO:0097588), cell projection organization (GO:0030030), organelle organization (GO:0006996), cellular component assembly (GO:0022607), organelle assembly (GO:0070925), cell projection assembly (GO:0030031), bacterial-type flagellum organization (GO:0044781), bacterial-type flagellum-dependent cell motility (GO:0071973), bacterial-type flagellum assembly (GO:0044780), bacterial-type flagellum-dependent swarming motility (GO:0071978), non-membrane-bounded organelle assembly (GO:0140694)

Cellular Component: cellular_component (GO:0005575), protein-containing complex (GO:0032991)


Generated by BioReason

Deep Research Falcon

(divIVA-deep-research-falcon.md)

provider: falcon
model: Edison Scientific Literature
cached: false
start_time: '2025-12-17T23:25:12.061159'
end_time: '2025-12-17T23:30:32.870775'
duration_seconds: 320.81
template_file: templates/gene_research_go_focused.md
template_variables:
organism: BACSU
gene_id: divIVA
gene_symbol: divIVA
uniprot_accession: P71021
protein_description: 'RecName: Full=Septum site-determining protein DivIVA; AltName:
Full=Cell division initiation protein DivIVA; AltName: Full=Minicell-associated
protein DivIVA;'
gene_info: Name=divIVA; Synonyms=ylmJ; OrderedLocusNames=BSU15420;
organism_full: Bacillus subtilis (strain 168).
protein_family: Belongs to the DivIVA family. .
protein_domains: DivIVA_domain. (IPR019933); DivIVA_fam. (IPR007793); DivIVA (PF05103)
provider_config:
timeout: 600
max_retries: 3
parameters:
allowed_domains: []
temperature: 0.1
citation_count: 18


Question

Gene Research for Functional Annotation

⚠️ CRITICAL: Gene/Protein Identification Context

BEFORE YOU BEGIN RESEARCH: You MUST verify you are researching the CORRECT gene/protein. Gene symbols can be ambiguous, especially for less well-characterized genes from non-model organisms.

Target Gene/Protein Identity (from UniProt):

  • UniProt Accession: P71021
  • Protein Description: RecName: Full=Septum site-determining protein DivIVA; AltName: Full=Cell division initiation protein DivIVA; AltName: Full=Minicell-associated protein DivIVA;
  • Gene Information: Name=divIVA; Synonyms=ylmJ; OrderedLocusNames=BSU15420;
  • Organism (full): Bacillus subtilis (strain 168).
  • Protein Family: Belongs to the DivIVA family. .
  • Key Domains: DivIVA_domain. (IPR019933); DivIVA_fam. (IPR007793); DivIVA (PF05103)

MANDATORY VERIFICATION STEPS:

  1. Check if the gene symbol "divIVA" matches the protein description above
  2. Verify the organism is correct: Bacillus subtilis (strain 168).
  3. Check if protein family/domains align with what you find in literature
  4. If you find literature for a DIFFERENT gene with the same or similar symbol, STOP

If Gene Symbol is Ambiguous or You Cannot Find Relevant Literature:

DO NOT PROCEED WITH RESEARCH ON A DIFFERENT GENE. Instead:
- State clearly: "The gene symbol 'divIVA' is ambiguous or literature is limited for this specific protein"
- Explain what you found (e.g., "Found extensive literature on a different gene with the same symbol in a different organism")
- Describe the protein based ONLY on the UniProt information provided above
- Suggest that the protein function can be inferred from domain/family information

Research Target:

Please provide a comprehensive research report on the gene divIVA (gene ID: divIVA, UniProt: P71021) in BACSU.

The research report should be a detailed narrative explaining the function, biological processes, and localization of the gene product. Citations should be given for all claims.

You should prioritize authoritative reviews and primary scientific literature when conducting research. You can supplement
this with annotations you find in gene/protein databases, but these can be outdated or inaccurate.

We are specifically interested in the primary function of the gene - for enzymes, what reaction is catalyzed, and what is the substrate specificity? For transporters, what is the substrate? For structural proteins or adapters, what is the broader structural role? For signaling molecules, what is the role in the pathway.

We are interested in where in or outside the cell the gene product carries out its function.

We are also interested in the signaling or biochemical pathways in which the gene functions. We are less interested in broad pleiotropic effects, except where these elucidate the precise role.

Include evidence where possible. We are interested in both experimental evidence as well as inference from structure, evolution, or bioinformatic analysis. Precise studies should be prioritized over high-throughput, where available.

Output

Question: You are an expert researcher providing comprehensive, well-cited information.

Provide detailed information focusing on:
1. Key concepts and definitions with current understanding
2. Recent developments and latest research (prioritize 2023-2024 sources)
3. Current applications and real-world implementations
4. Expert opinions and analysis from authoritative sources
5. Relevant statistics and data from recent studies

Format as a comprehensive research report with proper citations. Include URLs and publication dates where available.
Always prioritize recent, authoritative sources and provide specific citations for all major claims.

Gene Research for Functional Annotation

⚠️ CRITICAL: Gene/Protein Identification Context

BEFORE YOU BEGIN RESEARCH: You MUST verify you are researching the CORRECT gene/protein. Gene symbols can be ambiguous, especially for less well-characterized genes from non-model organisms.

Target Gene/Protein Identity (from UniProt):

  • UniProt Accession: P71021
  • Protein Description: RecName: Full=Septum site-determining protein DivIVA; AltName: Full=Cell division initiation protein DivIVA; AltName: Full=Minicell-associated protein DivIVA;
  • Gene Information: Name=divIVA; Synonyms=ylmJ; OrderedLocusNames=BSU15420;
  • Organism (full): Bacillus subtilis (strain 168).
  • Protein Family: Belongs to the DivIVA family. .
  • Key Domains: DivIVA_domain. (IPR019933); DivIVA_fam. (IPR007793); DivIVA (PF05103)

MANDATORY VERIFICATION STEPS:

  1. Check if the gene symbol "divIVA" matches the protein description above
  2. Verify the organism is correct: Bacillus subtilis (strain 168).
  3. Check if protein family/domains align with what you find in literature
  4. If you find literature for a DIFFERENT gene with the same or similar symbol, STOP

If Gene Symbol is Ambiguous or You Cannot Find Relevant Literature:

DO NOT PROCEED WITH RESEARCH ON A DIFFERENT GENE. Instead:
- State clearly: "The gene symbol 'divIVA' is ambiguous or literature is limited for this specific protein"
- Explain what you found (e.g., "Found extensive literature on a different gene with the same symbol in a different organism")
- Describe the protein based ONLY on the UniProt information provided above
- Suggest that the protein function can be inferred from domain/family information

Research Target:

Please provide a comprehensive research report on the gene divIVA (gene ID: divIVA, UniProt: P71021) in BACSU.

The research report should be a detailed narrative explaining the function, biological processes, and localization of the gene product. Citations should be given for all claims.

You should prioritize authoritative reviews and primary scientific literature when conducting research. You can supplement
this with annotations you find in gene/protein databases, but these can be outdated or inaccurate.

We are specifically interested in the primary function of the gene - for enzymes, what reaction is catalyzed, and what is the substrate specificity? For transporters, what is the substrate? For structural proteins or adapters, what is the broader structural role? For signaling molecules, what is the role in the pathway.

We are interested in where in or outside the cell the gene product carries out its function.

We are also interested in the signaling or biochemical pathways in which the gene functions. We are less interested in broad pleiotropic effects, except where these elucidate the precise role.

Include evidence where possible. We are interested in both experimental evidence as well as inference from structure, evolution, or bioinformatic analysis. Precise studies should be prioritized over high-throughput, where available.

Comprehensive research report: Bacillus subtilis DivIVA (divIVA; UniProt P71021)

Verification of target identity and family context
- Identity and organism: DivIVA in Bacillus subtilis (strain 168) is a polar/septal scaffold central to cell division topology and sporulation-associated polarity. Its study is well established in B. subtilis, matching the target gene symbol and organism specified (divIVA, BACSU). Recent overviews of B. subtilis cell biology explicitly place DivIVA as a polar scaffold in this organism (Stülke et al., 2023, Journal of Bacteriology; published May 2023) (stulke2023bacillussubtilisa pages 2-5).
- Family and domains: DivIVA proteins are conserved coiled-coil scaffolds that oligomerize and target curved membranes in Gram-positive bacteria, consistent with the DivIVA family/domain annotations. Structural and comparative work highlights N-terminal membrane-binding elements and C-terminal coiled-coils mediating higher-order assemblies, aligning with DivIVA family/domain descriptions (Lubbers et al., 2025, bioRxiv; Chaudhary et al., 2023, Microbiology Spectrum) (lubbers2025definingtheminimal pages 10-12, lubbers2025definingtheminimal pages 1-3, chaudhary2023divivaphosphorylationaffects pages 18-18).

1) Key concepts and definitions with current understanding
- Primary function (vegetative growth): DivIVA is a membrane-associated scaffold that localizes to both sides of the division septum and to cell poles during vegetative growth. Together with MinJ, DivIVA recruits MinCD to previously used division sites, preventing aberrant reassembly of the divisome and ensuring correct spatial control of cytokinesis (Stülke et al., 2023) (stulke2023bacillussubtilisa pages 2-5).
- Primary function (sporulation): During sporulation, DivIVA accumulates at the polar septum and becomes biased toward the forespore side as the septum matures. DivIVA associates with the phosphatase SpoIIE, contributing to forespore-specific activation of σF and thus compartment-specific gene expression that initiates the sporulation program (Chareyre et al., 2023, bioRxiv, Aug 2023) (chareyre2023celldivisionmachinery pages 15-18, chareyre2023celldivisionmachinery pages 1-6, chareyre2023celldivisionmachinery pages 11-15).
- Localization principle (curvature/poles/septa): DivIVA preferentially targets regions of high negative membrane curvature, including poles and septal membranes, a property underlying its pole/septum localization and scaffolding functions (Chareyre et al., 2023; Chaudhary et al., 2023) (chareyre2023celldivisionmachinery pages 1-6, chaudhary2023divivaphosphorylationaffects pages 18-18).
- Structural features: DivIVA is a coiled-coil oligomer. Evidence indicates an N-terminal membrane-binding/dimerization region and a C-terminal coiled-coil mediating tetramers/higher-order oligomers, which together support lattice-like assemblies at curved membranes (Chaudhary et al., 2023; Lubbers et al., 2025) (chaudhary2023divivaphosphorylationaffects pages 18-18, lubbers2025definingtheminimal pages 10-12, lubbers2025definingtheminimal pages 1-3).

2) Recent developments and latest research (2023–2024 priority)
- Sporulation-specific asymmetric localization and divisome coupling: Chareyre et al. (2023) showed that in B. subtilis the polar septum is thinner than vegetative septa and that DivIVA and SpoIIE exhibit forespore-biased accumulation at the polar septum, while FtsA/FtsZ show mother-cell bias. A DivIVA point mutant (R94N) diminished forespore-biased localization (DivIVAR94N-GFP ~46% forespore bias vs WT ~72%), reduced forespore-specific σF activation (~40% of cells), and impaired sporulation efficiency (~0.18× WT). Mild overproduction of both FtsA and FtsZ rescued DivIVA/SpoIIE asymmetry and septal thickness, supporting a reciprocal coupling between SpoIIE/DivIVA and the cytokinetic machinery (dual-color 3D-SIM and TEM) (bioRxiv preprint, Aug 2023; provides quantitative updates on localization dynamics) (chareyre2023celldivisionmachinery pages 1-6, chareyre2023celldivisionmachinery pages 11-15, chareyre2023celldivisionmachinery pages 15-18).
- Broad context of DivIVA-family regulation and phosphorylation: While centered on D. radiodurans, Chaudhary et al. (2023) comprehensively compile foundational B. subtilis DivIVA literature (polar targeting, crystal-structure insights for membrane binding, Min system regulation), underscoring conserved principles of DivIVA curvature sensing and oligomerization. This 2023 review-style synthesis anchors DivIVA’s structure–function relationships relevant to B. subtilis (Microbiology Spectrum, Apr 2023) (chaudhary2023divivaphosphorylationaffects pages 18-18).
- Model organism perspective in 2023: Stülke et al. (2023) summarize B. subtilis cell biology, explicitly noting DivIVA’s role as a polar scaffold that partners with MinJ to recruit MinCD and prevent reuse of prior division sites, situating DivIVA in current B. subtilis cell-cycle frameworks (Journal of Bacteriology, May 2023) (stulke2023bacillussubtilisa pages 2-5).

3) Current applications and real-world implementations
- Cell biology imaging and localization reporters: DivIVA has been repeatedly used as a localization marker via fluorescent protein fusions (e.g., DivIVA–GFP/mCherry) to visualize poles and septa in B. subtilis. This practical implementation enables tracking of polar/septal dynamics and is widely deployed in studies of division and sporulation (Stülke et al., 2023) (stulke2023bacillussubtilisa pages 2-5).
- Synthetic biology potential: While our gathered sources do not document engineered DivIVA-based “polarity tags” beyond microscopy reporters, the robust polar/septal localization of DivIVA fusions in B. subtilis suggests its utility as a targeting module for engineering spatially controlled processes at poles or septa. Direct engineered applications were not explicitly described in the retrieved 2023–2024 sources (Stülke et al., 2023) (stulke2023bacillussubtilisa pages 2-5).

4) Expert opinions and analysis from authoritative sources
- Authoritative organismal review: Stülke et al. (2023) describe DivIVA as a principal polar scaffold in B. subtilis that, with MinJ, positions MinCD to enforce topological specificity of division—an expert synthesis placing DivIVA at the core of spatial regulation of cytokinesis (Journal of Bacteriology, 2023) (stulke2023bacillussubtilisa pages 2-5).
- Mechanistic synthesis and cross-system grounding: Chaudhary et al. (2023) discuss DivIVA family membrane targeting, structural determinants, and Min regulation, citing foundational B. subtilis work (e.g., Min activity regulation, structural determinants for membrane binding), reinforcing conserved mechanistic principles underpinning DivIVA’s role in B. subtilis (Microbiology Spectrum, 2023) (chaudhary2023divivaphosphorylationaffects pages 18-18).
- Sporulation-specific coupling to the divisome: Chareyre et al. (2023) provide a mechanistic model linking DivIVA/SpoIIE asymmetry to FtsA/FtsZ redeployment and septum architecture during sporulation, highlighting how divisome features drive compartment-specific gene activation via DivIVA-tethered SpoIIE (bioRxiv, 2023) (chareyre2023celldivisionmachinery pages 15-18, chareyre2023celldivisionmachinery pages 1-6, chareyre2023celldivisionmachinery pages 11-15).

5) Relevant statistics and data from recent studies
- Forespore-biased localization: DivIVA-GFP forespore bias at polar septa is ~72% in WT vs ~46% in DivIVAR94N mutant; SpoIIE asymmetry similarly reduced in the mutant and restored by FtsA+FtsZ overexpression (Chareyre et al., 2023) (chareyre2023celldivisionmachinery pages 11-15).
- σF activation and sporulation efficiency: DivIVAR94N exhibits ~40% forespore-specific σF activation and ~0.18× WT sporulation efficiency; both improved substantially upon FtsA+FtsZ overproduction (Chareyre et al., 2023) (chareyre2023celldivisionmachinery pages 11-15).
- Septum architecture: Polar septum thickness increased in DivIVAR94N (~36 nm) compared to WT (~20 nm), and was reduced toward normal (~10 nm) by FtsA+FtsZ overproduction (Chareyre et al., 2023) (chareyre2023celldivisionmachinery pages 11-15).

Interaction partners and pathways (B. subtilis)
- MinJ/MinCD: DivIVA recruits MinJ, which positions MinCD at prior division sites to prevent FtsZ reassembly at old septa, enforcing spatial fidelity of new division events (Stülke et al., 2023) (stulke2023bacillussubtilisa pages 2-5).
- SpoIIE (sporulation): DivIVA associates with SpoIIE at the polar septum; their asymmetric distribution supports forespore-specific σF activation. Coupling to divisome components FtsA and FtsZ influences septal architecture and DivIVA/SpoIIE asymmetry (Chareyre et al., 2023) (chareyre2023celldivisionmachinery pages 15-18, chareyre2023celldivisionmachinery pages 1-6, chareyre2023celldivisionmachinery pages 11-15).
- Other classic partners (RacA, Soj/ParA, ComN): Although these interactions are well known historically for B. subtilis sporulation polarity and chromosome anchoring, specific primary-source details were not captured within our gathered evidence set; thus, we refrain from citing them here to maintain strict source fidelity.

Structural biology and localization mechanism
- Coiled-coil scaffold and oligomerization: DivIVA comprises an N-terminal membrane-binding/dimer interface and C-terminal coiled-coils that assemble into higher-order oligomers, enabling scaffolding at curved membranes. Structural/crystallographic insights and modeling support this modular architecture (Chaudhary et al., 2023; Lubbers et al., 2025) (chaudhary2023divivaphosphorylationaffects pages 18-18, lubbers2025definingtheminimal pages 10-12, lubbers2025definingtheminimal pages 1-3).
- Curvature sensing and pole/septum targeting: DivIVA’s affinity for negatively curved membranes underlies its accumulation at cell poles and septal regions, explaining its role in organizing polar/septal protein complexes (Chareyre et al., 2023; Chaudhary et al., 2023) (chareyre2023celldivisionmachinery pages 1-6, chaudhary2023divivaphosphorylationaffects pages 18-18).

Limitations and scope note
- While multiple authoritative studies describe interactions of DivIVA with proteins such as RacA, Soj/ParA, and ComN during sporulation and chromosome anchoring in B. subtilis, those specific primary references were not included among the retrieved texts in our evidence set for this report. Accordingly, we have limited claims to those directly supported by the gathered sources.

Embedded summary artifact
| Category | Specific claim | Evidence details (quantitative where present) | Source |
|---|---|---|---|
| Identity & family | DivIVA is a conserved septum/pole scaffold (DivIVA family); coiled-coil protein family member | Conserved DivIVA family protein implicated in septum/pole determination and polarity across Firmicutes; coiled-coil architecture reported (inferred from UniProt-family descriptions and recent reviews) (lubbers2025definingtheminimal pages 10-12, stulke2023bacillussubtilisa pages 2-5). | Stülke et al., 2023; Journal of Bacteriology; https://doi.org/10.1128/jb.00102-23 (stulke2023bacillussubtilisa pages 2-5); Lubbers et al., 2025; bioRxiv; https://doi.org/10.1101/2025.06.24.661030 (lubbers2025definingtheminimal pages 10-12) |
| Vegetative localization & MinJ/MinCD recruitment | Localizes to division septum and cell poles; recruits MinJ which positions MinCD at previous division sites to inhibit aberrant FtsZ assembly | DivIVA localizes to both sides of midcell septum and to poles during vegetative growth and, together with MinJ, recruits MinCD to inhibit reassembly of the divisome at old sites (stulke2023bacillussubtilisa pages 2-5, sutton2023therolesof pages 12-13). | Stülke et al., 2023; Journal of Bacteriology; https://doi.org/10.1128/jb.00102-23 (stulke2023bacillussubtilisa pages 2-5); Sutton et al., 2023; Frontiers in Microbiology; https://doi.org/10.3389/fmicb.2023.1241249 (sutton2023therolesof pages 12-13) |
| Sporulation: asymmetric localization, SpoIIE interaction, σF activation | DivIVA shows forespore-biased localization at the polar septum, binds/associates with SpoIIE and contributes to compartment-specific σF activation; perturbation alters σF activation and sporulation efficiency | Chareyre et al., 2023: WT DivIVA-GFP forespore bias ~72% vs DivIVAR94N-GFP ~46%; DivIVAR94N reduces compartment-specific σF activation (~40% of cells) and lowers sporulation efficiency to ~0.18× WT; overproduction of FtsA+FtsZ rescues localization, σF activation and septum thickness (methods: dual-color 3D SIM, TEM) (chareyre2023celldivisionmachinery pages 1-6, chareyre2023celldivisionmachinery pages 11-15). | Chareyre et al., 2023; bioRxiv; https://doi.org/10.1101/2023.08.10.552768 (chareyre2023celldivisionmachinery pages 1-6, chareyre2023celldivisionmachinery pages 11-15) |
| Curvature / pole targeting | Preferential targeting to negatively curved membranes (poles); curvature acts as localization cue | Multiple studies report DivIVA preference for highly negatively curved membrane regions (poles/septa), supporting curvature-dependent recruitment as a localization mechanism (chareyre2023celldivisionmachinery pages 1-6, chaudhary2023divivaphosphorylationaffects pages 18-18). | Chareyre et al., 2023; bioRxiv; https://doi.org/10.1101/2023.08.10.552768 (chareyre2023celldivisionmachinery pages 1-6); Chaudhary et al., 2023; Microbiology Spectrum; https://doi.org/10.1128/spectrum.03141-22 (chaudhary2023divivaphosphorylationaffects pages 18-18) |
| Structural features (coiled-coils, oligomerization) | N-terminal membrane/dimer interface + C-terminal coiled-coil mediating oligomerization; forms multimers/filaments; C-terminal deletions impair function | Structural/crystal and modeling studies indicate an N-terminal membrane-binding/dimerization region and C-terminal coiled-coil(s) that mediate higher-order oligomerization (tetramers/filaments); mutations/deletions in coiled-coil regions disrupt assembly and morphology (chaudhary2023divivaphosphorylationaffects pages 18-18, lubbers2025definingtheminimal pages 10-12, lubbers2025definingtheminimal pages 1-3). | Chaudhary et al., 2023; Microbiology Spectrum; https://doi.org/10.1128/spectrum.03141-22 (chaudhary2023divivaphosphorylationaffects pages 18-18); Lubbers et al., 2025; bioRxiv; https://doi.org/10.1101/2025.06.24.661030 (lubbers2025definingtheminimal pages 10-12, lubbers2025definingtheminimal pages 1-3) |
| Use as localization tag / reporter | DivIVA has been visualized using fluorescent protein fusions (GFP/mCherry) to report pole/septum localization; explicit engineered 'polarity-tag' applications in B. subtilis not documented in gathered sources | Historical and recent imaging studies use DivIVA–FP fusions to map pole/septum localization, supporting its practical use as a localization reporter; no direct evidence in the gathered set for widespread engineered synthetic-biology 'tag' use beyond microscopy reporters (stulke2023bacillussubtilisa pages 2-5). | Stülke et al., 2023; Journal of Bacteriology; https://doi.org/10.1128/jb.00102-23 (stulke2023bacillussubtilisa pages 2-5) |

Table: Compact, evidence-linked summary of key findings about Bacillus subtilis DivIVA (divIVA, UniProt P71021), including function, localization, structural features, and quantitated sporulation impacts, with direct sources and URLs for each claim.

Citations with URLs and publication dates
- Stülke J, Grüppen A, Bramkamp M, Pelzer S. Bacillus subtilis, a Swiss Army Knife in Science and Biotechnology. Journal of Bacteriology. 205(5):e00102-23. Published May 2023. URL: https://doi.org/10.1128/jb.00102-23 (stulke2023bacillussubtilisa pages 2-5)
- Chareyre S, Li X, Anjuwon-Foster BR, et al. Cell division machinery drives cell-specific gene activation during bacterial differentiation. bioRxiv. Posted Aug 2023. URL: https://doi.org/10.1101/2023.08.10.552768 (chareyre2023celldivisionmachinery pages 15-18, chareyre2023celldivisionmachinery pages 1-6, chareyre2023celldivisionmachinery pages 11-15)
- Chaudhary R, Kota S, Misra HS. DivIVA Phosphorylation Affects Its Dynamics and Cell Cycle in Radioresistant Deinococcus radiodurans. Microbiology Spectrum. 11(2):e03141-22. Published Apr 2023. URL: https://doi.org/10.1128/spectrum.03141-22 (chaudhary2023divivaphosphorylationaffects pages 18-18)
- Lubbers M, Bajramović B, Ongenae V, et al. Defining the minimal structural requirements of DivIVA in filamentous Actinomycetota. bioRxiv. Posted Jun 2025. URL: https://doi.org/10.1101/2025.06.24.661030 (lubbers2025definingtheminimal pages 10-12, lubbers2025definingtheminimal pages 1-3)
- Sutton JAF, Cooke M, Tinajero-Trejo M, et al. The roles of GpsB and DivIVA in Staphylococcus aureus growth and division. Frontiers in Microbiology. Published Aug 2023. URL: https://doi.org/10.3389/fmicb.2023.1241249 (sutton2023therolesof pages 12-13)

References

  1. (stulke2023bacillussubtilisa pages 2-5): Jörg Stülke, Anika Grüppen, Marc Bramkamp, and Stefan Pelzer. Bacillus subtilis, a swiss army knife in science and biotechnology. Journal of Bacteriology, May 2023. URL: https://doi.org/10.1128/jb.00102-23, doi:10.1128/jb.00102-23. This article has 85 citations and is from a peer-reviewed journal.

  2. (lubbers2025definingtheminimal pages 10-12): Maarten Lubbers, Belmin Bajramović, Véronique Ongenae, Joost Willemse, Dieuwertje de Bruin, Niels Mulder, Bastienne Vriesendorp, Francisco Barona-Gómez, Ariane Briegel, Gilles P. van Wezel, Klas Flärdh, and Dennis Claessen. Defining the minimal structural requirements of diviva in filamentous actinomycetota. bioRxiv, Jun 2025. URL: https://doi.org/10.1101/2025.06.24.661030, doi:10.1101/2025.06.24.661030. This article has 0 citations and is from a poor quality or predatory journal.

  3. (lubbers2025definingtheminimal pages 1-3): Maarten Lubbers, Belmin Bajramović, Véronique Ongenae, Joost Willemse, Dieuwertje de Bruin, Niels Mulder, Bastienne Vriesendorp, Francisco Barona-Gómez, Ariane Briegel, Gilles P. van Wezel, Klas Flärdh, and Dennis Claessen. Defining the minimal structural requirements of diviva in filamentous actinomycetota. bioRxiv, Jun 2025. URL: https://doi.org/10.1101/2025.06.24.661030, doi:10.1101/2025.06.24.661030. This article has 0 citations and is from a poor quality or predatory journal.

  4. (chaudhary2023divivaphosphorylationaffects pages 18-18): Reema Chaudhary, Swathi Kota, and Hari S. Misra. Diviva phosphorylation affects its dynamics and cell cycle in radioresistant deinococcus radiodurans. Microbiology Spectrum, Apr 2023. URL: https://doi.org/10.1128/spectrum.03141-22, doi:10.1128/spectrum.03141-22. This article has 8 citations and is from a domain leading peer-reviewed journal.

  5. (chareyre2023celldivisionmachinery pages 15-18): Sylvia Chareyre, Xuesong Li, Brandon R. Anjuwon-Foster, Sarah Clifford, Anna Brogan, Yijun Su, Hari Shroff, and Kumaran S. Ramamurthi. Cell division machinery drives cell-specific gene activation during bacterial differentiation. bioRxiv, Aug 2023. URL: https://doi.org/10.1101/2023.08.10.552768, doi:10.1101/2023.08.10.552768. This article has 0 citations and is from a poor quality or predatory journal.

  6. (chareyre2023celldivisionmachinery pages 1-6): Sylvia Chareyre, Xuesong Li, Brandon R. Anjuwon-Foster, Sarah Clifford, Anna Brogan, Yijun Su, Hari Shroff, and Kumaran S. Ramamurthi. Cell division machinery drives cell-specific gene activation during bacterial differentiation. bioRxiv, Aug 2023. URL: https://doi.org/10.1101/2023.08.10.552768, doi:10.1101/2023.08.10.552768. This article has 0 citations and is from a poor quality or predatory journal.

  7. (chareyre2023celldivisionmachinery pages 11-15): Sylvia Chareyre, Xuesong Li, Brandon R. Anjuwon-Foster, Sarah Clifford, Anna Brogan, Yijun Su, Hari Shroff, and Kumaran S. Ramamurthi. Cell division machinery drives cell-specific gene activation during bacterial differentiation. bioRxiv, Aug 2023. URL: https://doi.org/10.1101/2023.08.10.552768, doi:10.1101/2023.08.10.552768. This article has 0 citations and is from a poor quality or predatory journal.

  8. (sutton2023therolesof pages 12-13): Joshua A. F. Sutton, Mark Cooke, Mariana Tinajero-Trejo, Katarzyna Wacnik, Bartłomiej Salamaga, Callum Portman-Ross, Victoria A. Lund, Jamie K. Hobbs, and Simon J. Foster. The roles of gpsb and diviva in staphylococcus aureus growth and division. Frontiers in Microbiology, Aug 2023. URL: https://doi.org/10.3389/fmicb.2023.1241249, doi:10.3389/fmicb.2023.1241249. This article has 14 citations and is from a poor quality or predatory journal.

Citations

  1. stulke2023bacillussubtilisa pages 2-5
  2. chaudhary2023divivaphosphorylationaffects pages 18-18
  3. chareyre2023celldivisionmachinery pages 11-15
  4. lubbers2025definingtheminimal pages 10-12
  5. sutton2023therolesof pages 12-13
  6. chareyre2023celldivisionmachinery pages 1-6
  7. lubbers2025definingtheminimal pages 1-3
  8. chareyre2023celldivisionmachinery pages 15-18
  9. https://doi.org/10.1128/jb.00102-23
  10. https://doi.org/10.1101/2025.06.24.661030
  11. https://doi.org/10.3389/fmicb.2023.1241249
  12. https://doi.org/10.1101/2023.08.10.552768
  13. https://doi.org/10.1128/spectrum.03141-22
  14. https://doi.org/10.1128/jb.00102-23,
  15. https://doi.org/10.1101/2025.06.24.661030,
  16. https://doi.org/10.1128/spectrum.03141-22,
  17. https://doi.org/10.1101/2023.08.10.552768,
  18. https://doi.org/10.3389/fmicb.2023.1241249,

Bioreason Rl Review

(divIVA-bioreason-rl-review.md)

BioReason-Pro RL Review: divIVA (B. subtilis)

Source: divIVA-deep-research-bioreason-rl.md

  • Correctness: 3/5
  • Completeness: 2/5

Functional Summary Review

The BioReason functional summary reads:

A cytoplasmic scaffold that assembles and positions the cytokinetic machinery in Bacillus subtilis. It oligomerizes through an N-terminal assembly core and uses an extended scaffold to form membrane-proximal lattices that concentrate early cell-division components at poles and nascent septa. By organizing these assemblies and coupling them to the membrane and cortical arrays, it promotes maturation of the division apparatus and coordinates the execution of cytokinesis.

The summary correctly identifies DivIVA as a scaffold involved in cell division that oligomerizes and localizes to poles and septa. However, several significant errors and omissions reduce accuracy:

  1. Missed core molecular function: The curated review identifies membrane curvature sensor activity (GO:0140090) as the fundamental molecular function of DivIVA. This is what drives its localization to negatively curved membrane regions at cell poles and division septa. BioReason misses this entirely, defaulting to generic "protein binding" (GO:0005515).

  2. Wrong mechanism: BioReason describes DivIVA as directly promoting "maturation of the division apparatus" and orchestrating "FtsZ-ring maturation." The curated review clarifies that DivIVA's actual role in B. subtilis is division septum site selection (GO:0000918) -- it recruits MinJ/MinCD to prevent inappropriate FtsZ assembly at old division sites, rather than directly promoting FtsZ ring maturation. This is a conceptually different mechanism.

  3. Missing localization specificity: BioReason assigns cytoplasm (GO:0005737); the curated review specifically notes cell pole (GO:0060187) and division septum (GO:0000935) as more appropriate localizations.

  4. Missing sporulation role: The curated review describes DivIVA's role during sporulation (asymmetric polar septum localization, SpoIIE association, chromosome anchoring via Spo0J), which BioReason completely omits.

  5. Erroneous GO predictions: The BioReason GO term predictions include flagellum-related terms (bacterial-type flagellum assembly, swarming motility) which are completely wrong for DivIVA.

Comparison with interpro2go:

The interpro2go annotations for divIVA map to protein binding and identical protein binding, plus flagellum-related BP terms. BioReason's GO predictions closely mirror these interpro2go mappings, including the erroneous flagellum terms. The flagellar annotations likely derive from the IPR007793 DivIVA family being associated with some flagellar terms in InterPro2GO through organisms where DivIVA homologs play flagellar roles. BioReason recapitulates these interpro2go errors without correction and adds no insight beyond interpro2go.

Notes on thinking trace

The trace correctly identifies the DivIVA domain architecture and infers an oligomeric scaffold function. However, the inference that DivIVA "captures and stabilizes FtsZ polymers" misrepresents its actual function as a negative spatial regulator of FtsZ via the Min system, rather than a direct FtsZ stabilizer. The assignment of cytokinesis (GO:0000910) as the primary BP, while broadly correct, obscures the more specific septum site selection role.

📄 View Raw YAML

id: P71021
gene_symbol: divIVA
product_type: PROTEIN
status: DRAFT
taxon:
  id: NCBITaxon:224308
  label: Bacillus subtilis (strain 168)
description: DivIVA is a conserved membrane-associated scaffold protein in Gram-positive
  bacteria that functions as a polar landmark by sensing negative membrane curvature
  at cell poles and division septa. The protein forms oligomeric structures through
  its N-terminal membrane-binding domain (which inserts hydrophobic and positively
  charged residues into curved membranes) and C-terminal coiled-coil regions that
  mediate tetramerization and higher-order assembly. During vegetative growth, DivIVA
  localizes to both sides of the division septum and cell poles, where it recruits
  MinJ, which in turn positions MinCD to prevent aberrant FtsZ assembly at previous
  division sites, thereby ensuring proper septum site selection. During sporulation,
  DivIVA accumulates asymmetrically at the polar septum with forespore bias, associates
  with SpoIIE phosphatase to promote compartment-specific sigma-F activation, and
  interacts with Spo0J for chromosome anchoring at the cell pole. DivIVA also recruits
  ComN to cell poles, facilitating polar localization of comE mRNA during competence
  development. Loss of DivIVA results in misplacement of division septa leading to
  minicell formation, while overexpression is lethal.
existing_annotations:
- term:
    id: GO:0009273
    label: peptidoglycan-based cell wall biogenesis
  evidence_type: IBA
  original_reference_id: GO_REF:0000033
  review:
    summary: DivIVA is primarily a scaffold protein involved in spatial organization
      of cell division rather than directly participating in peptidoglycan biosynthesis.
      While DivIVA localizes to sites of cell wall synthesis (septa and poles), its
      role is to position other proteins (MinCD via MinJ) that regulate where division
      occurs, not to directly contribute to peptidoglycan synthesis. In Corynebacterium
      glutamicum, DivIVA is required for polar peptidoglycan synthesis, but B. subtilis
      DivIVA localizes to septum rather than directing polar growth when expressed
      in C. glutamicum (PMID:18296522). This IBA annotation likely reflects functional
      conservation across Gram-positive bacteria where some DivIVA homologs do directly
      regulate cell wall synthesis, but in B. subtilis the connection is more indirect.
    action: MARK_AS_OVER_ANNOTATED
    reason: DivIVA in B. subtilis functions as a spatial organizer for septum site
      selection through the MinCD system, not as a direct participant in peptidoglycan
      biosynthesis. The protein's role is to sense membrane curvature and recruit
      MinJ/MinCD to prevent inappropriate FtsZ assembly. While this ultimately affects
      where peptidoglycan synthesis occurs during division, DivIVA itself does not
      catalyze or directly regulate peptidoglycan synthesis enzymes. This term is
      too broad and misrepresents the mechanistic role of B. subtilis DivIVA.
    supported_by:
    - reference_id: PMID:18296522
      supporting_text: DivIVA proteins from Bacillus subtilis or Streptococcus pneumoniae,
        which localized at the septum of C. glutamicum
- term:
    id: GO:0000917
    label: division septum assembly
  evidence_type: IEA
  original_reference_id: GO_REF:0000043
  review:
    summary: DivIVA plays a critical role in regulating where division septa form
      by recruiting the MinJ/MinCD system to previous division sites and cell poles,
      thereby preventing inappropriate FtsZ assembly. This represents a core function
      of DivIVA in vegetative B. subtilis cells. Loss of DivIVA results in misplacement
      of septa and minicell formation. However, the term "division septum assembly"
      may be slightly broader than DivIVA's actual role, which is more specifically
      in septum site selection rather than the assembly process itself.
    action: MODIFY
    reason: DivIVA does not directly assemble the division septum but rather controls
      where septum assembly can occur by positioning the MinCD inhibitor system. The
      more precise term would be GO:0000918 (division septum site selection), which
      accurately captures DivIVA's role in marking sites where the septum can or cannot
      form by recruiting MinJ and MinCD.
    proposed_replacement_terms:
    - id: GO:0000918
      label: division septum site selection
    supported_by:
    - reference_id: file:BACSU/divIVA/divIVA-deep-research-falcon.md
      supporting_text: DivIVA localizes to both sides of midcell septum and to poles
        during vegetative growth and, together with MinJ, recruits MinCD to inhibit
        reassembly of the divisome at old sites
- term:
    id: GO:0005737
    label: cytoplasm
  evidence_type: IEA
  original_reference_id: GO_REF:0000044
  review:
    summary: DivIVA is annotated to cytoplasm based on UniProt subcellular location
      mapping. However, DivIVA is specifically a membrane-associated protein that
      localizes to regions of negative membrane curvature at cell poles and division
      septa. The protein's N-terminal domain binds directly to the membrane through
      hydrophobic and positively charged residues. While technically in the cytoplasm,
      this term is too general and fails to capture DivIVA's specific localization
      to cell poles and division sites.
    action: MODIFY
    reason: 'The cytoplasm annotation is technically correct but too general. DivIVA
      specifically localizes to negatively curved membrane regions at cell poles and
      division septa. More specific CC terms would better capture DivIVA''s localization
      pattern: GO:0060187 (cell pole) and GO:0000935 (division septum).'
    proposed_replacement_terms:
    - id: GO:0060187
      label: cell pole
    - id: GO:0000935
      label: division septum
    supported_by:
    - reference_id: PMID:20502438
      supporting_text: DivIVA is a conserved protein in Gram-positive bacteria that
        localizes at the poles and division sites, presumably through direct sensing
        of membrane curvature
- term:
    id: GO:0030435
    label: sporulation resulting in formation of a cellular spore
  evidence_type: IEA
  original_reference_id: GO_REF:0000043
  review:
    summary: DivIVA plays an important role during B. subtilis sporulation, where
      it accumulates asymmetrically at the polar septum with forespore bias and associates
      with SpoIIE phosphatase to contribute to compartment-specific sigma-F activation.
      DivIVA also interacts with Spo0J for chromosome anchoring at the cell pole during
      sporulation. Mutation of DivIVA causes sporulation defects. However, DivIVA
      is not a sporulation- specific protein - it functions during both vegetative
      growth and sporulation.
    action: KEEP_AS_NON_CORE
    reason: While DivIVA plays an important role in sporulation by positioning SpoIIE
      and anchoring chromosomes, sporulation is not its core function. DivIVA functions
      primarily as a polar landmark protein that senses membrane curvature, and its
      sporulation role is a specialized application of this general function. The
      annotation should be retained but marked as non-core.
    supported_by:
    - reference_id: file:BACSU/divIVA/divIVA-deep-research-falcon.md
      supporting_text: During sporulation, DivIVA accumulates at the polar septum
        and becomes biased toward the forespore side as the septum matures. DivIVA
        associates with the phosphatase SpoIIE, contributing to forespore-specific
        activation of sigma-F and thus compartment-specific gene expression that initiates
        the sporulation program
- term:
    id: GO:0051301
    label: cell division
  evidence_type: IEA
  original_reference_id: GO_REF:0000043
  review:
    summary: DivIVA is essential for proper cell division in B. subtilis, where it
      controls the spatial placement of division septa by recruiting MinJ/MinCD to
      cell poles and previous division sites. Loss of DivIVA leads to aberrant septum
      placement and minicell formation. This annotation accurately captures DivIVA's
      involvement in cell division, though a more specific term like GO:0000918 (division
      septum site selection) would better describe its precise role.
    action: ACCEPT
    reason: Cell division is a core function of DivIVA. The protein is essential for
      proper spatial control of cell division through the Min system. While GO:0000918
      would be more specific, GO:0051301 is an appropriate parent term that accurately
      reflects DivIVA's biological role. This broad annotation should be retained
      alongside more specific annotations.
    supported_by:
    - reference_id: PMID:20502438
      supporting_text: DivIVA deletion causes filamentous growth in Bacillus subtilis
    - reference_id: file:BACSU/divIVA/divIVA-deep-research-falcon.md
      supporting_text: DivIVA localizes to both sides of midcell septum and to poles
        during vegetative growth and, together with MinJ, recruits MinCD to inhibit
        reassembly of the divisome at old sites
- term:
    id: GO:0005515
    label: protein binding
  evidence_type: IPI
  original_reference_id: PMID:22582279
  review:
    summary: This annotation is based on the interaction between DivIVA and ComN demonstrated
      by yeast two-hybrid and GST pulldown experiments in PMID:22582279. DivIVA directly
      binds ComN and is required for its polar localization. However, GO:0005515 (protein
      binding) is too generic and uninformative - a more specific term describing
      the scaffold or adapter function would be preferable.
    action: MODIFY
    reason: While DivIVA does bind ComN, the generic term "protein binding" fails
      to capture the biological significance of this interaction. DivIVA functions
      as a scaffold protein that recruits multiple partners to cell poles. GO:0097110
      (scaffold protein binding) would be more appropriate, or the annotation could
      be modified to reflect DivIVA's role as a scaffold that recruits other proteins.
    proposed_replacement_terms:
    - id: GO:0097110
      label: scaffold protein binding
    supported_by:
    - reference_id: PMID:22582279
      supporting_text: Yeast two-hybrid and glutathione S-transferase pulldown experiments
        showed that ComN interacts directly with DivIVA
- term:
    id: GO:0042802
    label: identical protein binding
  evidence_type: IPI
  original_reference_id: PMID:18296522
  review:
    summary: This annotation reflects DivIVA's ability to form homo-oligomers, a well-established
      property essential for its scaffold function. The PMID:18296522 study in C.
      glutamicum demonstrates DivIVA self-interaction, and this property is conserved
      in B. subtilis DivIVA as shown by crystal structure studies.
    action: ACCEPT
    reason: Identical protein binding accurately describes DivIVA's homo-oligomerization,
      which is essential for its function as a membrane curvature-sensing scaffold.
      The protein forms tetramers and higher-order oligomers through its C-terminal
      coiled-coil domain. This is a well-characterized molecular function of DivIVA.
    supported_by:
    - reference_id: PMID:18296522
      supporting_text: DivIVA from Streptomyces or Mycobacterium localized to the
        cell poles of DivIVA(Cg)-depleted C. glutamicum and restored polar peptidoglycan
        synthesis
    - reference_id: PMID:20502438
      supporting_text: A low-resolution crystal structure of the C-terminal (Ct) domain
        displays a curved tetramer made from two parallel coiled-coils
- term:
    id: GO:0042802
    label: identical protein binding
  evidence_type: IPI
  original_reference_id: PMID:18363795
  review:
    summary: This annotation reflects DivIVA self-interaction demonstrated in the
      context of PBP1 shuttling studies. DivIVA homo-oligomerization is essential
      for its scaffold function and is consistently demonstrated across multiple studies.
    action: ACCEPT
    reason: This is a duplicate annotation for identical protein binding with different
      evidence. The homo-oligomerization of DivIVA is well-established and represents
      a core molecular function. Multiple independent studies supporting this annotation
      strengthens the evidence base.
    supported_by:
    - reference_id: PMID:20502438
      supporting_text: A low-resolution crystal structure of the C-terminal (Ct) domain
        displays a curved tetramer made from two parallel coiled-coils
- term:
    id: GO:0042802
    label: identical protein binding
  evidence_type: IPI
  original_reference_id: PMID:20502438
  review:
    summary: This annotation is strongly supported by the crystal structure of DivIVA
      reported in PMID:20502438, which definitively demonstrates that DivIVA forms
      homo-oligomers through its coiled-coil domains. The N-terminal domain forms
      parallel coiled-coils and the C-terminal domain forms curved tetramers.
    action: ACCEPT
    reason: The crystal structure provides definitive evidence for DivIVA homo-oligomerization.
      The protein forms dimers through its N-terminal domain and tetramers through
      its C-terminal coiled-coil region. This is a core molecular function essential
      for DivIVA's role as a membrane-associated scaffold.
    supported_by:
    - reference_id: PMID:20502438
      supporting_text: We have determined the crystal structure of the N-terminal
        (Nt) domain of DivIVA, and show that it forms a parallel coiled-coil
- term:
    id: GO:0042802
    label: identical protein binding
  evidence_type: IPI
  original_reference_id: PMID:21630458
  review:
    summary: This annotation comes from a large-scale protein-protein interaction
      study in B. subtilis using yeast two-hybrid. DivIVA was identified as part of
      a group of highly connected hub proteins. The self-interaction of DivIVA is
      consistent with its known oligomeric nature.
    action: ACCEPT
    reason: While this annotation comes from a high-throughput study, it is consistent
      with the well-established homo-oligomerization of DivIVA demonstrated by crystal
      structure and other biochemical studies. Multiple lines of evidence support
      DivIVA self-interaction as a core molecular function.
    supported_by:
    - reference_id: PMID:21630458
      supporting_text: We have generated a protein-protein interaction network in
        Bacillus subtilis focused on several essential cellular processes such as
        cell division
- term:
    id: GO:0140090
    label: membrane curvature sensor activity
  evidence_type: IDA
  original_reference_id: PMID:20502438
  review:
    summary: DivIVA preferentially localizes to regions of negative membrane curvature
      at cell poles and division septa. Crystal structure analysis reveals an N-terminal
      domain with hydrophobic and positively charged residues that insert into curved
      membranes. This curvature sensing is the fundamental mechanism underlying DivIVA's
      localization and function as a polar landmark.
    action: NEW
    reason: Membrane curvature sensor activity is the core molecular function of DivIVA
      that underlies all its biological roles. The crystal structure (PMID:20502438)
      provides structural evidence for how DivIVA binds to curved membranes, and multiple
      studies confirm its preferential localization to negatively curved membrane
      regions at poles and septa. This annotation is not currently in the GOA annotations
      but represents DivIVA's most fundamental molecular activity.
    supported_by:
    - reference_id: PMID:20502438
      supporting_text: DivIVA is a conserved protein in Gram-positive bacteria that
        localizes at the poles and division sites, presumably through direct sensing
        of membrane curvature
    - reference_id: file:BACSU/divIVA/divIVA-deep-research-falcon.md
      supporting_text: DivIVA preferentially targets regions of high negative membrane
        curvature, including poles and septal membranes
core_functions:
- molecular_function:
    id: GO:0140090
    label: membrane curvature sensor activity
  description: DivIVA preferentially localizes to regions of negative membrane curvature
    at cell poles and division septa. Crystal structure analysis reveals an N-terminal
    domain with hydrophobic and positively charged residues that insert into curved
    membranes. This curvature sensing is the fundamental mechanism underlying DivIVA's
    localization and function as a polar landmark.
  supported_by:
  - reference_id: PMID:20502438
    supporting_text: DivIVA is a conserved protein in Gram-positive bacteria that
      localizes at the poles and division sites, presumably through direct sensing
      of membrane curvature
  - reference_id: file:BACSU/divIVA/divIVA-deep-research-falcon.md
    supporting_text: DivIVA preferentially targets regions of high negative membrane
      curvature, including poles and septal membranes
  locations:
  - id: GO:0060187
    label: cell pole
  - id: GO:0000935
    label: division septum
  directly_involved_in:
  - id: GO:0000918
    label: division septum site selection
- molecular_function:
    id: GO:0042802
    label: identical protein binding
  description: DivIVA forms homo-oligomers essential for its scaffold function. Crystal
    structures show the N-terminal domain forms parallel coiled-coils and the C-terminal
    domain forms curved tetramers, enabling assembly into extended ~30 nm scaffolds.
  supported_by:
  - reference_id: PMID:20502438
    supporting_text: A low-resolution crystal structure of the C-terminal (Ct) domain
      displays a curved tetramer made from two parallel coiled-coils
references:
- id: GO_REF:0000033
  title: Annotation inferences using phylogenetic trees
  findings: []
- id: GO_REF:0000043
  title: Gene Ontology annotation based on UniProtKB/Swiss-Prot keyword mapping
  findings: []
- id: GO_REF:0000044
  title: Gene Ontology annotation based on UniProtKB/Swiss-Prot Subcellular Location
    vocabulary mapping, accompanied by conservative changes to GO terms applied by
    UniProt
  findings: []
- id: PMID:18296522
  title: DivIVA is required for polar growth in the MreB-lacking rod-shaped actinomycete
    Corynebacterium glutamicum.
  findings:
  - statement: DivIVA from B. subtilis localizes to the septum rather than poles when
      expressed in C. glutamicum
    supporting_text: DivIVA proteins from Bacillus subtilis or Streptococcus pneumoniae,
      which localized at the septum of C. glutamicum
  - statement: DivIVA proteins show functional divergence between actinomycetes and
      firmicutes
    supporting_text: This confirmed that DivIVAs from actinomycetes are involved in
      polarized cell growth
- id: PMID:18363795
  title: Control of the cell elongation-division cycle by shuttling of PBP1 protein
    in Bacillus subtilis.
  findings: []
- id: PMID:20502438
  title: Features critical for membrane binding revealed by DivIVA crystal structure.
  findings:
  - statement: N-terminal domain forms parallel coiled-coil with membrane-binding
      loop
    supporting_text: We have determined the crystal structure of the N-terminal (Nt)
      domain of DivIVA, and show that it forms a parallel coiled-coil
  - statement: Hydrophobic and positively charged residues essential for membrane
      binding
    supporting_text: exposing hydrophobic and positively charged residues that we
      show here are essential for membrane binding
  - statement: C-terminal domain forms curved tetramer from two parallel coiled-coils
    supporting_text: A low-resolution crystal structure of the C-terminal (Ct) domain
      displays a curved tetramer made from two parallel coiled-coils
  - statement: Full-length DivIVA protein is approximately 30 nm long
    supporting_text: The Nt and Ct parts were then merged into a model of the full
      length, 30 nm long DivIVA protein
  - statement: DivIVA deletion causes filamentous growth in B. subtilis
    supporting_text: DivIVA deletion causes filamentous growth in Bacillus subtilis
- id: PMID:21630458
  title: 'An expanded protein-protein interaction network in Bacillus subtilis reveals
    a group of hubs: Exploration by an integrative approach.'
  findings:
  - statement: DivIVA identified as part of highly connected protein hub group
    supporting_text: A striking feature of the network is a group of highly connected
      hubs (GoH) linking many different cellular processes
  - statement: Self-interaction detected by yeast two-hybrid
    supporting_text: We have generated a protein-protein interaction network in Bacillus
      subtilis focused on several essential cellular processes such as cell division
- id: PMID:22582279
  title: DivIVA-mediated polar localization of ComN, a posttranscriptional regulator
    of Bacillus subtilis.
  findings:
  - statement: ComN directly interacts with DivIVA via yeast two-hybrid and GST pulldown
    supporting_text: Yeast two-hybrid and glutathione S-transferase pulldown experiments
      showed that ComN interacts directly with DivIVA
  - statement: ComN localization to poles and division sites is DivIVA-dependent
    supporting_text: ComN localizes to the division site and cell poles in a DivIVA-dependent
      fashion
  - statement: DivIVA functions as versatile promoter of bacterial pole differentiation
    supporting_text: Our results underscore the versatility of DivIVA as a promoter
      of the differentiation of bacterial poles
- id: file:BACSU/divIVA/divIVA-deep-research-falcon.md
  title: Deep research synthesis on DivIVA function
  findings:
  - statement: DivIVA recruits MinJ which positions MinCD at previous division sites
  - statement: During sporulation DivIVA shows forespore-biased localization
  - statement: DivIVA associates with SpoIIE for compartment-specific sigma-F activation
  - statement: DivIVA targets negatively curved membrane regions at poles and septa
tags:
- bacsu