# Pair analysis: agxta / agxtb  (run 2026-09-28)

## 1. Ensembl Compara: paralogue call and orthologues

agxta / agxtb: Compara type within_species_paralog, duplication node Osteoglossocephalai, %id 67.5192 / 62.4113

| species | Ensembl gene | protein | length | orthology to agxta | agxtb |
|---|---|---|---|---|---|
| lepisosteus_oculatus | ENSLOCG00000006520 | ENSLOCP00000007880 | 428 | ortholog_one2many | ortholog_one2many |
| latimeria_chalumnae | ENSLACG00000006522 | ENSLACP00000007350 | 426 | ortholog_one2many | ortholog_one2many |
| xenopus_tropicalis | ENSXETG00000012149 | ENSXETP00000026515 | 415 | ortholog_one2many | ortholog_one2many |
| gallus_gallus | ENSGALG00010024959 | ENSGALP00010037702 | 467 | ortholog_one2many | ortholog_one2many |
| homo_sapiens | ENSG00000172482 | ENSP00000302620 | 392 | ortholog_one2many | ortholog_one2many |
| mus_musculus | ENSMUSG00000026272 | ENSMUSP00000027491 | 414 | ortholog_one2many | ortholog_one2many |
| scleropages_formosus | ENSSFOG00015015377 | ENSSFOP00015023942 | 428 | ortholog_one2one | - |
| scleropages_formosus | ENSSFOG00015018968 | ENSSFOP00015077858 | 435 | - | ortholog_one2one |
| clupea_harengus | ENSCHAG00020020275 | ENSCHAP00020045996 | 414 | ortholog_one2one | - |
| clupea_harengus | ENSCHAG00020020462 | ENSCHAP00020046567 | 470 | - | ortholog_one2one |
| astyanax_mexicanus | ENSAMXG00000004368 | ENSAMXP00000004469 | 391 | ortholog_one2one | - |
| astyanax_mexicanus | ENSAMXG00000006054 | ENSAMXP00000006214 | 419 | - | ortholog_one2one |
| esox_lucius | ENSELUG00000006718 | ENSELUP00000051719 | 423 | ortholog_one2one | - |
| esox_lucius | ENSELUG00000022332 | ENSELUP00000041476 | 428 | - | ortholog_one2one |
| salmo_salar | ENSSSAG00000015444 | ENSSSAP00000137625 | 409 | ortholog_one2one | - |
| salmo_salar | ENSSSAG00000052770 | ENSSSAP00000053908 | 430 | - | ortholog_one2one |
| gadus_morhua | ENSGMOG00000009858 | ENSGMOP00000043510 | 415 | ortholog_one2one | - |
| gadus_morhua | ENSGMOG00000010512 | ENSGMOP00000057906 | 518 | - | ortholog_one2one |
| oryzias_latipes | ENSORLG00000019350 | ENSORLP00000024097 | 461 | ortholog_one2one | - |
| oryzias_latipes | ENSORLG00000016389 | ENSORLP00000020520 | 454 | - | ortholog_one2one |
| gasterosteus_aculeatus | ENSGACG00000004497 | ENSGACP00000052692 | 392 | ortholog_one2one | - |
| gasterosteus_aculeatus | ENSGACG00000013666 | ENSGACP00000018105 | 430 | - | ortholog_one2one |
| takifugu_rubripes | ENSTRUG00000007149 | ENSTRUP00000066127 | 417 | - | ortholog_one2one |
| oreochromis_niloticus | ENSONIG00000019283 | ENSONIP00000062514 | 422 | ortholog_one2one | - |
| oreochromis_niloticus | ENSONIG00000009868 | ENSONIP00000012399 | 430 | - | ortholog_one2one |

## 2. Pairwise identities

length agxta: 391 aa
length agxtb: 423 aa
length human AGXT: 392 aa
identity agxta vs agxtb: 62.4% over 423 columns
identity agxta vs human AGXT: 58.8% over 393 columns
identity agxtb vs human AGXT: 53.4% over 423 columns
identity agxta vs gar ENSLOCG00000006520 (428 aa): 61.5% over 429 columns
identity agxtb vs gar ENSLOCG00000006520 (428 aa): 71.8% over 429 columns
identity human AGXT vs gar ENSLOCG00000006520: 58.2% over 428 columns

## 3. Conservation of annotated sites of the human reference

| human position | annotation | agxta | agxtb | latimeria:ENSLACG00000006522 | lepisosteus:ENSLOCG00000006520 | oryzias:ENSORLG00000019350 | oryzias:ENSORLG00000016389 |
|---|---|---|---|---|---|---|---|
| T9 | Modified residue: Phosphothreonine | L | P | P | P | P | P |
| K209 | Modified residue: N6-(pyridoxal phosphate)lysine | K | K | K | K | K | K |
| K225 | Modified residue: N6-acetyllysine; alternate | R | R | K | Q | R | R |
| K225 | Modified residue: N6-succinyllysine; alternate | R | R | K | Q | R | R |
| K234 | Modified residue: N6-acetyllysine | K | K | K | K | R | K |
| K312 | Modified residue: N6-acetyllysine | Q | K | K | K | K | P |
| R360 | Binding site: substrate | R | R | R | R | R | R |

## 4. Targeting signals: N-terminal extension before human Met1, and C-terminal tripeptide (PTS1)

PTS1 consensus for reference: C-terminal [SAC]-[KRH]-[LM]; human AGXT ends KKL.
| gene | species | length | N-ext before human Met1 | C-term 3 | orthology |
|---|---|---|---|---|---|
| agxta | danio_rerio | 391 | 0 | SRV | - |
| agxtb | danio_rerio | 423 | 32 | SKA | - |
| ENSLOCG00000006520 | lepisosteus_oculatus | 428 | 38 | SKV | agxta:ortholog_one2many,agxtb:ortholog_one2many |
| ENSLACG00000006522 | latimeria_chalumnae | 426 | 34 | NKM | agxta:ortholog_one2many,agxtb:ortholog_one2many |
| ENSXETG00000012149 | xenopus_tropicalis | 415 | 23 | NKM | agxta:ortholog_one2many,agxtb:ortholog_one2many |
| ENSGALG00010024959 | gallus_gallus | 467 | 24 | SRL | agxta:ortholog_one2many,agxtb:ortholog_one2many |
| ENSG00000172482 | homo_sapiens | 392 | 0 | KKL | agxta:ortholog_one2many,agxtb:ortholog_one2many |
| ENSMUSG00000026272 | mus_musculus | 414 | 22 | NKL | agxta:ortholog_one2many,agxtb:ortholog_one2many |
| ENSSFOG00015015377 | scleropages_formosus | 428 | 35 | SKV | agxta:ortholog_one2one |
| ENSSFOG00015018968 | scleropages_formosus | 435 | 42 | SKV | agxtb:ortholog_one2one |
| ENSCHAG00020020275 | clupea_harengus | 414 | 24 | SRV | agxta:ortholog_one2one |
| ENSCHAG00020020462 | clupea_harengus | 470 | 73 | SKA | agxtb:ortholog_one2one |
| ENSAMXG00000004368 | astyanax_mexicanus | 391 | 0 | SRV | agxta:ortholog_one2one |
| ENSAMXG00000006054 | astyanax_mexicanus | 419 | 26 | SKA | agxtb:ortholog_one2one |
| ENSELUG00000006718 | esox_lucius | 423 | 19 | SRV | agxta:ortholog_one2one |
| ENSELUG00000022332 | esox_lucius | 428 | 37 | SKA | agxtb:ortholog_one2one |
| ENSSSAG00000015444 | salmo_salar | 409 | 0 | SKV | agxta:ortholog_one2one |
| ENSSSAG00000052770 | salmo_salar | 430 | 35 | SKA | agxtb:ortholog_one2one |
| ENSGMOG00000009858 | gadus_morhua | 415 | 24 | SKV | agxta:ortholog_one2one |
| ENSGMOG00000010512 | gadus_morhua | 518 | 39 | VKR | agxtb:ortholog_one2one |
| ENSORLG00000019350 | oryzias_latipes | 461 | 0 | SNK | agxta:ortholog_one2one |
| ENSORLG00000016389 | oryzias_latipes | 454 | 63 | SKA | agxtb:ortholog_one2one |
| ENSGACG00000004497 | gasterosteus_aculeatus | 392 | 0 | NKM | agxta:ortholog_one2one |
| ENSGACG00000013666 | gasterosteus_aculeatus | 430 | 37 | SKV | agxtb:ortholog_one2one |
| ENSTRUG00000007149 | takifugu_rubripes | 417 | 24 | SKA | agxtb:ortholog_one2one |
| ENSONIG00000019283 | oreochromis_niloticus | 422 | 31 | SKV | agxta:ortholog_one2one |
| ENSONIG00000009868 | oreochromis_niloticus | 430 | 39 | SKA | agxtb:ortholog_one2one |
| AGXT (UniProt) | homo_sapiens | 392 | 0 | KKL | - |

First 45 residues of each sequence:
- agxta (danio_rerio): MSSLSVLPPECLLKPFPVPQRLMLGPGPSNVPARISAAGAQPMLG
- agxtb (danio_rerio): MMPRTVLSRCARLTQQVPLESALSGKQSVQRGMSSLSVPPPACML
- ENSLOCG00000006520 (lepisosteus_oculatus): MMQRTLFCRGAFLAQQVALESALPTRVSASLVPRYRRTMSSLSVP
- ENSLACG00000006522 (latimeria_chalumnae): MQRAVLSGRTILQQAASQAGSPGLFGVPLAQSCHRAMSSLTVPPP
- ENSXETG00000012149 (xenopus_tropicalis): MQGSVRSISSSLLCAARLSASVRIMSSLATIPPPSALLQPLNVPQ
- ENSGALG00010024959 (gallus_gallus): MHRAAALPISIAALLRACSTAGRAMAASTPFVPPPRELLRPLAVP
- ENSG00000172482 (homo_sapiens): MASHKLLVTPPKALLKPLSIPNQLLLGPGPSNLPPRIMAAGGLQM
- ENSMUSG00000026272 (mus_musculus): MFRMLAKASVTLGSRAAGWVRTMGSYQLLVPPPEALSKPLSVPTR
- ENSSFOG00015015377 (scleropages_formosus): MLTALSHRGVILARGVNAHSCLSRVLHPPSACRSRRAMGSVSIPP
- ENSSFOG00015018968 (scleropages_formosus): MSLMKTRSVLRRCAFLAHRQHLALDSALPSGIAPGAAARLRRCAS
- ENSCHAG00020020275 (clupea_harengus): IILYCTDQLCASLSKQCRGSVHKNMLSETIPPPTCLLKSYVVPHR
- ENSCHAG00020020462 (clupea_harengus): MTYIGDLRVKGSVCQRFSSESPNLKPTNKCASHRHTLARAPNMMH
- ENSAMXG00000004368 (astyanax_mexicanus): MSSLSVPPPQCLLQPYTVPHRYLLGPGPSNVPPRISTAGAQPMLG
- ENSAMXG00000006054 (astyanax_mexicanus): MLPKALLSRGAALAALDLSLPVRTAQRAASSVTIPPPACMLQPLE
- ENSELUG00000006718 (esox_lucius): ENNGQGLLLTVLAHKCPGWQAMSSLYVPPPKCLEKRFVAPQRHMF
- ENSELUG00000022332 (esox_lucius): MMQRGLFRRGALLAQQAAVESSLPPMISPLQPRLDRSMSSLTIPP
- ENSSSAG00000015444 (salmo_salar): MSSVSVPPPKCLQKTFVAPRRHMFGPGPSNVPPRILAAGAEPIIG
- ENSSSAG00000052770 (salmo_salar): MMQRTLFRRGALLAQKAAVEVSLLPMSAPLQPRLDRAMSSVTIPP
- ENSGMOG00000009858 (gadus_morhua): MKINLLDEMWNLCSSRLVHRRSGTMSSLSVPKPACLNKPFVAPHR
- ENSGMOG00000010512 (gadus_morhua): MMQRAVFSRGALLAQNTAAALESSLAPRSAPLLMRLDRSMSSLTI
- ENSORLG00000019350 (oryzias_latipes): MSALSIPPPSCLLKPFVVPQRHMFGPGPSNVPPRILEAGAKPVIG
- ENSORLG00000016389 (oryzias_latipes): MAESGMLGEADDISSIIRASPPVSHRKTPLWWSVLLAQQAAAALD
- ENSGACG00000004497 (gasterosteus_aculeatus): MLPPPITHPIFCMSQIMSDIKSGIQYMFQTRNSMTFAVSGTGHTA
- ENSGACG00000013666 (gasterosteus_aculeatus): VMQRALLRRSAPLAQQAAAAFDSQLAARSAPLLQRLDRSMSCVTI
- ENSTRUG00000007149 (takifugu_rubripes): LKHSVTEISTCLLSRSAPLLQQLERSMSTVTIPPPACMLRPLEAP
- ENSONIG00000019283 (oreochromis_niloticus): AFITSRLDSEVCLLWFHSSLRFGFACYAAGNMSSISVPPPKCLQK
- ENSONIG00000009868 (oreochromis_niloticus): MMQRALFSRGALLAQQTSAALEGPLGAKSAPVLLRLDRSMSSVTI
- AGXT (UniProt) (homo_sapiens): MASHKLLVTPPKALLKPLSIPNQLLLGPGPSNLPPRIMAAGGLQM

N-terminal extensions (composition; MTS are typically Arg-rich, acid-poor amphipathic helices):
- agxtb (danio_rerio): MMPRTVLSRCARLTQQVPLESALSGKQSVQRG (len 32; R+K 5, D+E 1, net +4; max 18-aa hydrophobic moment 0.45)
- ENSLOCG00000006520 (lepisosteus_oculatus): MMQRTLFCRGAFLAQQVALESALPTRVSASLVPRYRRT (len 38; R+K 6, D+E 1, net +5; max 18-aa hydrophobic moment 0.34)
- ENSLACG00000006522 (latimeria_chalumnae): MQRAVLSGRTILQQAASQAGSPGLFGVPLAQSCH (len 34; R+K 2, D+E 0, net +2; max 18-aa hydrophobic moment 0.41)
- ENSXETG00000012149 (xenopus_tropicalis): MQGSVRSISSSLLCAARLSASVR (len 23; R+K 3, D+E 0, net +3; max 18-aa hydrophobic moment 0.46)
- ENSGALG00010024959 (gallus_gallus): MHRAAALPISIAALLRACSTAGRA (len 24; R+K 3, D+E 0, net +3; max 18-aa hydrophobic moment 0.40)
- ENSMUSG00000026272 (mus_musculus): MFRMLAKASVTLGSRAAGWVRT (len 22; R+K 4, D+E 0, net +4; max 18-aa hydrophobic moment 0.40)
- ENSSFOG00015015377 (scleropages_formosus): MLTALSHRGVILARGVNAHSCLSRVLHPPSACRSR (len 35; R+K 5, D+E 0, net +5; max 18-aa hydrophobic moment 0.41)
- ENSSFOG00015018968 (scleropages_formosus): MSLMKTRSVLRRCAFLAHRQHLALDSALPSGIAPGAAARLRR (len 42; R+K 8, D+E 1, net +7; max 18-aa hydrophobic moment 0.41)
- ENSCHAG00020020275 (clupea_harengus): IILYCTDQLCASLSKQCRGSVHKN (len 24; R+K 3, D+E 1, net +2; max 18-aa hydrophobic moment 0.38)
- ENSCHAG00020020462 (clupea_harengus): MTYIGDLRVKGSVCQRFSSESPNLKPTNKCASHRHTLARAPNMMHRALISRSARLVQQATTDGSLLARNAPAV (len 73; R+K 11, D+E 3, net +8; max 18-aa hydrophobic moment 0.51)
- ENSAMXG00000006054 (astyanax_mexicanus): MLPKALLSRGAALAALDLSLPVRTAQ (len 26; R+K 3, D+E 1, net +2; max 18-aa hydrophobic moment 0.33)
- ENSELUG00000006718 (esox_lucius): ENNGQGLLLTVLAHKCPGW (len 19; R+K 1, D+E 1, net +0; max 18-aa hydrophobic moment 0.09)
- ENSELUG00000022332 (esox_lucius): MMQRGLFRRGALLAQQAAVESSLPPMISPLQPRLDRS (len 37; R+K 5, D+E 2, net +3; max 18-aa hydrophobic moment 0.38)
- ENSSSAG00000052770 (salmo_salar): MMQRTLFRRGALLAQKAAVEVSLLPMSAPLQPRLD (len 35; R+K 5, D+E 2, net +3; max 18-aa hydrophobic moment 0.44)
- ENSGMOG00000009858 (gadus_morhua): MKINLLDEMWNLCSSRLVHRRSGT (len 24; R+K 4, D+E 2, net +2; max 18-aa hydrophobic moment 0.25)
- ENSGMOG00000010512 (gadus_morhua): MMQRAVFSRGALLAQNTAAALESSLAPRSAPLLMRLDRS (len 39; R+K 5, D+E 2, net +3; max 18-aa hydrophobic moment 0.40)
- ENSORLG00000016389 (oryzias_latipes): MAESGMLGEADDISSIIRASPPVSHRKTPLWWSVLLAQQAAAALDSPLVGKSASVMQRMDHRS (len 63; R+K 6, D+E 6, net +0; max 18-aa hydrophobic moment 0.42)
- ENSGACG00000013666 (gasterosteus_aculeatus): VMQRALLRRSAPLAQQAAAAFDSQLAARSAPLLQRLD (len 37; R+K 5, D+E 2, net +3; max 18-aa hydrophobic moment 0.44)
- ENSTRUG00000007149 (takifugu_rubripes): LKHSVTEISTCLLSRSAPLLQQLE (len 24; R+K 2, D+E 2, net +0; max 18-aa hydrophobic moment 0.32)
- ENSONIG00000019283 (oreochromis_niloticus): AFITSRLDSEVCLLWFHSSLRFGFACYAAGN (len 31; R+K 2, D+E 2, net +0; max 18-aa hydrophobic moment 0.29)
- ENSONIG00000009868 (oreochromis_niloticus): MMQRALFSRGALLAQQTSAALEGPLGAKSAPVLLRLDRS (len 39; R+K 5, D+E 2, net +3; max 18-aa hydrophobic moment 0.32)

## 5. Upstream in-frame ATG check (5' of the annotated start codon)

For each zebrafish gene and for human AGXT: 5' UTR of the Ensembl canonical transcript and 300 nt of genomic sequence 5' of the start codon, read in frame with the CDS back to the first in-frame stop. An in-frame ATG in this stretch could encode an N-terminal extension (as for the mammalian AGXT 'ATG1' that encodes the MTS).

### agxta (ENSDARG00000052099); protein-coding transcripts: ENSDART00000073881 (391 aa, canonical)
canonical ENSDART00000073881: 5' UTR length 101 nt; CDS starts ATG
- 5' UTR: first in-frame stop 16 codons upstream; in-frame ATG(s) before it at codon(s) none upstream; open upstream peptide (translated) 'LELTITSVSQCTGSI'
- genomic 300 nt: first in-frame stop 16 codons upstream; in-frame ATG(s) before it at codon(s) none upstream; open upstream peptide (translated) 'LELTITSVSQCTGSI'

### agxtb (ENSDARG00000018478); protein-coding transcripts: ENSDART00000013863 (423 aa, canonical)
canonical ENSDART00000013863: 5' UTR length 34 nt; CDS starts ATG
- 5' UTR: first in-frame stop not reached codons upstream; in-frame ATG(s) before it at codon(s) none upstream; open upstream peptide (translated) 'ILQSNSRARGI'
- genomic 300 nt: first in-frame stop 20 codons upstream; in-frame ATG(s) before it at codon(s) none upstream; open upstream peptide (translated) 'NVGETQSFILQSNSRARGI'

### human AGXT (ENSG00000172482); protein-coding transcripts: ENST00000307503 (392 aa, canonical), ENST00000908227 (340 aa), ENST00000908228 (398 aa), ENST00000908229 (406 aa), ENST00000908230 (389 aa), ENST00000908231 (375 aa), ENST00000908232 (409 aa), ENST00000908233 (360 aa), ENST00000908234 (330 aa), ENST00000908235 (483 aa), ENST00000908236 (455 aa), ENST00000908237 (349 aa), ENST00000908238 (388 aa), ENST00000908239 (302 aa), ENST00000908240 (370 aa), ENST00000908241 (373 aa), ENST00000908242 (391 aa), ENST00000908243 (398 aa), ENST00000908244 (417 aa), ENST00000908245 (398 aa), ENST00000908246 (441 aa), ENST00000908247 (419 aa), ENST00000999413 (368 aa), ENST00000999414 (151 aa), ENST00000999416 (199 aa), ENST00000999417 (358 aa), ENST00000999421 (125 aa), ENST00000999423 (334 aa), ENST00000999424 (364 aa), ENST00000999426 (243 aa), ENST00000999428 (128 aa), ENST00000999431 (243 aa), ENST00000999432 (270 aa), ENST00000999434 (126 aa), ENST00000999435 (203 aa), ENST00000999436 (281 aa), ENST00000999437 (303 aa), ENST00000999443 (373 aa), ENST00000999444 (128 aa), ENST00000999451 (358 aa), ENST00000999454 (125 aa), ENST00000999455 (303 aa), ENST00000999459 (291 aa), ENST00000999461 (286 aa), ENST00000999462 (333 aa), ENST00001025489 (126 aa), ENST00001118872 (424 aa), ENST00001118873 (419 aa), ENST00001118874 (399 aa), ENST00001118875 (402 aa), ENST00001118876 (417 aa), ENST00001140411 (392 aa)
canonical ENST00000307503: 5' UTR length 42 nt; CDS starts ATG
- 5' UTR: first in-frame stop not reached codons upstream; in-frame ATG(s) before it at codon(s) none upstream; open upstream peptide (translated) 'SAAPGSRAAGWVRT'
- genomic 300 nt: first in-frame stop 51 codons upstream; in-frame ATG(s) before it at codon(s) none upstream; open upstream peptide (translated) 'ASGNKRQGCHGSPSTNPHLSPLCPPCWEIFQALAKASAAPGSRAAGWVRT'

## 6. Tajima-style relative-rate test (outgroup = gar)

gar ENSLOCG00000006520 positions aligned in both copies: 390
changes unique to agxta (m1): 59; unique to agxtb (m2): 32; chi2 (1 df) = 8.01 (P<0.05)

## 7. Whole-embryo time course, E-ERAD-475 (TPM, median of replicates)

| stage | agxta | agxtb |
|---|---|---|
| zygote | 0 | 0 |
| cleavage 2-cell | 0 | 0 |
| blastula 128-cell | 0 | 0 |
| blastula 1k-cell | 0 | 0 |
| blastula dome | 0 | 1 |
| gastrula 50%-epiboly | 0 | 0 |
| gastrula shield | 0 | 0.5 |
| gastrula 75%-epiboly | 0 | 0 |
| segmentation 1-4 somites | 0 | 0.8 |
| segmentation 14-19 somites | 0 | 0.7 |
| segmentation 20-25 somites | 0 | 0 |
| pharyngula prim-5 | 0.7 | 0 |
| pharyngula prim-15 | 0.9 | 0 |
| pharyngula prim-25 | 1 | 0 |
| hatching long-pec | 4 | 0.9 |
| larval protruding mouth | 24 | 62 |
| larval day 4 | 40 | 128 |
| larval day 5 | 50 | 175 |

## 8. Bgee expressed calls per anatomical entity (score 0-100; only 'expressed' calls are returned)

### agxta: 21 calls
- liver: 98.8 (gold; Affymetrix,in situ hybridization,RNA-Seq)
- spleen: 97.1 (gold; RNA-Seq)
- mesonephros: 96.3 (gold; in situ hybridization,RNA-Seq)
- intestine: 96.2 (gold; RNA-Seq)
- head kidney: 96.1 (gold; RNA-Seq)
- bone element: 91.6 (gold; RNA-Seq)
- larva: 80.8 (gold; Affymetrix,RNA-Seq)
- swim bladder: 65.4 (gold; RNA-Seq)
- tail: 64.6 (gold; Affymetrix,RNA-Seq)
- kidney epithelium: 63.5 (gold; in situ hybridization)
- renal duct: 63.2 (gold; in situ hybridization)
- pronephric duct: 63.0 (gold; in situ hybridization)
- granulocyte: 60.8 (gold; RNA-Seq)
- caudal fin: 51.6 (silver; Affymetrix)
- head: 45.5 (gold; Affymetrix,RNA-Seq)
- muscle tissue: 40.6 (gold; RNA-Seq)
- heart: 40.2 (gold; Affymetrix,RNA-Seq)
- embryo: 37.6 (silver; Affymetrix,RNA-Seq)
- integument: 37.4 (gold; Affymetrix,RNA-Seq)
- testis: 37.1 (gold; RNA-Seq)
- zone of skin: 37.1 (gold; RNA-Seq)
### agxtb: 16 calls
- liver: 99.6 (gold; EST,RNA-Seq)
- head kidney: 98.7 (gold; RNA-Seq)
- spleen: 97.0 (gold; RNA-Seq)
- intestine: 92.9 (gold; RNA-Seq)
- bone element: 90.5 (gold; RNA-Seq)
- tail: 84.8 (gold; RNA-Seq)
- larva: 84.6 (gold; RNA-Seq)
- swim bladder: 74.3 (gold; RNA-Seq)
- granulocyte: 73.3 (gold; RNA-Seq)
- head: 56.8 (gold; RNA-Seq)
- heart: 46.4 (gold; RNA-Seq)
- zone of skin: 40.7 (gold; RNA-Seq)
- male organism: 40.0 (gold; EST,RNA-Seq)
- testis: 40.0 (gold; EST,RNA-Seq)
- muscle tissue: 38.1 (gold; RNA-Seq)
- pharyngeal gill: 28.9 (silver; RNA-Seq)
### gar ENSLOCG00000006520: 9 calls
- embryo: 96.9 (gold; RNA-Seq)
- larva: 93.4 (gold; RNA-Seq)
- liver: 93.1 (gold; RNA-Seq)
- mesonephros: 81.8 (gold; RNA-Seq)
- intestine: 50.1 (gold; RNA-Seq)
- muscle tissue: 28.7 (silver; RNA-Seq)
- gonad: 25.6 (silver; RNA-Seq)
- zone of skin: 24.5 (silver; RNA-Seq)
- testis: 23.3 (silver; RNA-Seq)

RNA-Seq-supported entities, agxta only: ['embryo', 'integument', 'mesonephros']
RNA-Seq-supported entities, agxtb only: ['male organism', 'pharyngeal gill']
RNA-Seq-supported entities, both: ['bone element', 'granulocyte', 'head', 'head kidney', 'heart', 'intestine', 'larva', 'liver', 'muscle tissue', 'spleen', 'swim bladder', 'tail', 'testis', 'zone of skin']

Score comparison in shared RNA-Seq entities (score difference >= 10 flagged):
- bone element: agxta 91.6 vs agxtb 90.5
- granulocyte: agxta 60.8 vs agxtb 73.3 <--
- head: agxta 45.5 vs agxtb 56.8 <--
- head kidney: agxta 96.1 vs agxtb 98.7
- heart: agxta 40.2 vs agxtb 46.4
- intestine: agxta 96.2 vs agxtb 92.9
- larva: agxta 80.8 vs agxtb 84.6
- liver: agxta 98.8 vs agxtb 99.6
- muscle tissue: agxta 40.6 vs agxtb 38.1
- spleen: agxta 97.1 vs agxtb 97.0
- swim bladder: agxta 65.4 vs agxtb 74.3
- tail: agxta 64.6 vs agxtb 84.8 <--
- testis: agxta 37.1 vs agxtb 40.0
- zone of skin: agxta 37.1 vs agxtb 40.7

## 9. ZFIN curated wild-type expression

### agxta: 5 records
- liver | Larval:Day 5 | mRNA in situ hybridization | ZDB-PUB-040907-1
- liver | Pharyngula:High-pec | mRNA in situ hybridization | ZDB-PUB-040907-1
- liver | Pharyngula:Prim-15 | mRNA in situ hybridization | ZDB-PUB-040907-1
- pronephric duct | Pharyngula:Prim-15 | mRNA in situ hybridization | ZDB-PUB-040907-1
- pronephric duct | Segmentation:20-25 somites | mRNA in situ hybridization | ZDB-PUB-040907-1
### agxtb: 2 records
- male organism > kidney | Adult | Reverse transcription PCR | ZDB-PUB-230601-33
- whole organism | Hatching:Long-pec | Reverse transcription PCR | ZDB-PUB-150311-2

## 10. Local synteny between the two copies (Ensembl REST)

agxta: chr6:27112884-27123327
agxtb: chr2:22676743-22688651

agxta +/- 1.5 Mb: 34 other protein-coding genes (0 homology queries failed); 7 have a teleost-level (Teleostei/Osteoglossocephalai/Clupeocephala) zebrafish paralogue; 6 of those paralogues lie within 1.5 Mb of agxtb:
- hs2st1b -> hs2st1a (chr2:22363824)
- stk25a -> stk25b (chr2:22617675)
- espnla -> espnlb (chr2:22765492)
- amotl2a -> amotl2b (chr2:22851832)
- sap130a -> sap130b (chr2:22931159)
- myo7ba -> myo7bb (chr2:22880605)

agxtb +/- 1.5 Mb: 81 other protein-coding genes (0 homology queries failed); 35 have a teleost-level (Teleostei/Osteoglossocephalai/Clupeocephala) zebrafish paralogue; 6 of those paralogues lie within 1.5 Mb of agxta:
- stk25b -> stk25a (chr6:27041594)
- espnlb -> espnla (chr6:27304503)
- amotl2b -> amotl2a (chr6:27991943)
- myo7bb -> myo7ba (chr6:28051978)
- sap130b -> sap130a (chr6:28018390)
- hs2st1a -> hs2st1b (chr6:26063962)