Cryptochrome (CRY/DmCRY, type I/Drosophila-type) is a FAD-binding blue-light photoreceptor that provides light input to the Drosophila circadian clock. Its core, best-established function is light-dependent entrainment: blue light absorbed by FAD drives photoreduction (via a Trp triad/tetrad) and a conformational switch (C-terminal tail undocking) that enables CRY to bind TIMELESS (TIM) and trigger TIM ubiquitination/proteasomal degradation via the E3 ligase JETLAG (JET)/CUL1, resetting the PER/TIM oscillator. This is mechanistically DISTINCT from mammalian CRY1/2 (type II), which are light-independent transcriptional repressors. In Drosophila, CRY can also act as a transcriptional repressor of CLK/CYC targets, but this is a secondary role confined to peripheral clocks. CRY additionally has non-canonical, tissue-dependent roles including light-dependent magnetosensitivity, modulation of neuronal excitability/arousal, a structural (actin/signalplex) role in eye rhabdomeres, and metabolic regulation.
| GO Term | Evidence | Action | Reason |
|---|---|---|---|
|
GO:0005634
nucleus
|
IBA
GO_REF:0000033 |
ACCEPT |
Summary: UniProt-curated localization includes nuclear CRY, consistent with light-driven nuclear translocation.
Reason: Subcellular location evidence indicates CRY accumulates in the nucleus after light perception, supporting nuclear localization.
Supporting Evidence:
UniProtKB:O77059
SUBCELLULAR LOCATION: Cytoplasm ... Nucleus.
|
|
GO:0005737
cytoplasm
|
IBA
GO_REF:0000033 |
ACCEPT |
Summary: UniProt-curated localization includes cytoplasmic CRY.
Reason: CRY is reported in cytoplasm and perinuclear region prior to nuclear translocation, supporting cytoplasmic localization.
Supporting Evidence:
UniProtKB:O77059
SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:10417378,
|
|
GO:0045892
negative regulation of DNA-templated transcription
|
IBA
GO_REF:0000033 |
KEEP AS NON CORE |
Summary: CRY can act as a transcriptional repressor of CLK/CYC-activated clock genes
(Collins et al. 2006), but this is a Drosophila-specific secondary role confined
to peripheral clocks, NOT the canonical mammalian-type light-independent repression.
Drosophila CRY (type I) is mechanistically distinct from mammalian CRY1/2 (type II):
the falcon deep research establishes that the best-established / primary function of
DmCRY is as a blue-light photoreceptor that triggers light-dependent TIM degradation,
whereas light-independent transcriptional repression is the defining role of the
type II (mammalian) cryptochromes. The IBA inference (from the phylogenetic family)
therefore over-weights a repressor role that, in flies, is non-core and peripheral.
Reason: Genuine but secondary/non-core in Drosophila. Collins et al. (PMID:16527739) show
repression of CLK/CYC targets is "confined to peripheral clocks" and does not
significantly affect pacemaker-neuron or behavioral rhythms; the core DmCRY function
is light input via TIM degradation, not transcriptional repression. Distinct from the
mammalian type II cryptochrome repressor role that drives this phylogenetic inference.
Supporting Evidence:
UniProtKB:O77059
Genes directly activated by the transcription factors Clock (Clk) and cycle (cyc) are repressed by cry.
PMID:16527739
Here we demonstrate that Drosophila CRY also functions as a transcriptional repressor.
file:DROME/CRY/CRY-deep-research-falcon.md
This Drosophila light-sensing role is mechanistically distinct from **vertebrate/mammalian-type (type II) cryptochromes**, which are described primarily as **light-independent transcriptional repressors** in the core clock feedback loop.
|
|
GO:0003677
DNA binding
|
IBA
GO_REF:0000033 |
REMOVE |
Summary: CRY lacks photolyase activity and functions as a photoreceptor rather than a DNA-binding repair enzyme.
Reason: Evidence indicates CRY is a blue-light photoreceptor without photolyase activity; DNA binding is not supported.
Supporting Evidence:
PMID:10063806
the protein is not a DNA repair enzyme but a blue-light photoreceptor.
|
|
GO:0032922
circadian regulation of gene expression
|
IBA
GO_REF:0000033 |
ACCEPT |
Summary: CRY regulates expression of CLK/CYC target genes, consistent with circadian regulation of gene expression.
Reason: Repression of clock-controlled transcription by CRY supports circadian regulation of gene expression.
Supporting Evidence:
UniProtKB:O77059
Genes directly activated by the transcription factors Clock (Clk) and cycle (cyc) are repressed by cry.
|
|
GO:0043153
entrainment of circadian clock by photoperiod
|
IBA
GO_REF:0000033 |
ACCEPT |
Summary: Loss of CRY disrupts synchronization to light-dark cycles, indicating a role in
photoperiod entrainment. The falcon deep research details the canonical mechanism:
light-activated CRY binds TIM and triggers TIM degradation via recruitment of the
E3 ubiquitin ligase Jetlag (JET)/CUL1, leading to TIM ubiquitination and proteasomal
degradation, thereby resetting the PER/TIM negative arm and entraining behavioral
rhythms. This is the core, best-established DmCRY function.
Reason: Core biological process. CRY is the primary photoreceptor for entrainment of the fly circadian clock and acts by light-dependent TIM degradation.
Supporting Evidence:
UniProtKB:O77059
Flies exhibit poor synchronization to light-dark cycles and show no response to brief light pulses.
PMID:37100907
the photoreceptor Cryptochrome (Cry) entrains the clock by triggering Tim degradation in light
PMID:16794082
Expression of JET along with the circadian photoreceptor cryptochrome (CRY) in cultured S2R cells confers light-dependent degradation onto TIM,
PMID:22080955
is the primary photoreceptor for entrainment of the fly circadian clock
file:DROME/CRY/CRY-deep-research-falcon.md
In the canonical pathway, light-activated CRY **binds Timeless (TIM)** and triggers **TIM degradation** via recruitment of the **E3 ubiquitin ligase Jetlag (JET)**, thereby resetting the circadian oscillator.
file:DROME/CRY/CRY-deep-research-falcon.md
The canonical output of CRY photoreception is **light-dependent TIM degradation**
|
|
GO:0071949
FAD binding
|
IBA
GO_REF:0000033 |
ACCEPT |
Summary: CRY binds FAD as the principal blue-light chromophore/cofactor in the photolyase
homology region (PHR). The falcon deep research notes that FAD binding is both
photochemical (it is the chromophore that absorbs blue light) and a structural
requirement for CRY to reach a signaling-competent native fold.
Reason: Core molecular function. UniProt-curated cofactor annotations specify one FAD per subunit, and FAD binding is essential for both photoreception and folding.
Supporting Evidence:
UniProtKB:O77059
Binds 1 FAD per subunit.
PMID:24297896
contains a C-terminal tail (CTT) helix that binds beside a FAD cofactor
PDB:8DD7
FAD (Subject of Investigation/LOI)
file:DROME/CRY/CRY-deep-research-falcon.md
cryptochromes have a conserved **photolyase homology region (PHR)** that binds **FAD** as the principal blue-light chromophore
file:DROME/CRY/CRY-deep-research-falcon.md
FAD binding is not only photochemical but also a structural requirement** to reach a signaling-competent native fold.
|
|
GO:0000166
nucleotide binding
|
IEA
GO_REF:0000043 |
KEEP AS NON CORE |
Summary: CRY binds a flavin adenine dinucleotide cofactor, supporting nucleotide binding.
Reason: FAD is a nucleotide cofactor; the term is generic but consistent with known cofactor binding.
Supporting Evidence:
UniProtKB:O77059
Binds 1 FAD per subunit.
|
|
GO:0005634
nucleus
|
IEA
GO_REF:0000044 |
ACCEPT |
Summary: UniProt-curated localization includes nuclear CRY.
Reason: Subcellular location annotations indicate nuclear accumulation after light perception.
Supporting Evidence:
UniProtKB:O77059
SUBCELLULAR LOCATION: Cytoplasm ... Nucleus.
PMID:18663237
CRY is present in both the nucleus and the cytoplasm of these neurons,
|
|
GO:0005737
cytoplasm
|
IEA
GO_REF:0000044 |
ACCEPT |
Summary: UniProt-curated localization includes cytoplasmic CRY.
Reason: CRY localizes to cytoplasm and perinuclear region prior to nuclear translocation.
Supporting Evidence:
UniProtKB:O77059
SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:10417378,
PMID:18663237
CRY is present in both the nucleus and the cytoplasm of these neurons,
|
|
GO:0009416
response to light stimulus
|
IEA
GO_REF:0000117 |
ACCEPT |
Summary: CRY expression and function are light regulated, supporting a response to light stimulus.
Reason: Light-regulated expression and photoreceptor function indicate response to light stimulus.
Supporting Evidence:
UniProtKB:O77059
Regulation of expression by light suggests a role in photoreception for locomotor activity rhythms.
|
|
GO:0009881
photoreceptor activity
|
IEA
GO_REF:0000043 |
ACCEPT |
Summary: CRY is a blue-light-dependent photoreceptor in the circadian system. The falcon deep
research establishes that this is the best-established/core function of DmCRY: blue
light absorbed by FAD drives photoreduction via a Trp triad/tetrad, producing a
conformational change (CTT undocking) that enables light-dependent TIM binding and
JET-dependent TIM degradation, resetting the circadian oscillator.
Reason: UniProt function description explicitly identifies CRY as a blue-light-dependent regulator in the circadian loop; falcon synthesis confirms photoreceptor activity as the core molecular function.
Supporting Evidence:
UniProtKB:O77059
Blue light-dependent regulator that is the input of the circadian feedback loop.
PMID:21187431
Cryptochrome (CRY) is a blue-light sensitive flavoprotein that functions as the primary circadian photoreceptor in Drosophila melanogaster.
PMID:10839367
encodes a critical circadian photoreceptor in Drosophila.
file:genes/DROME/CRY/CRY-deep-research-cyberian.md
Cryptochrome (CRY) is a blue light-sensitive flavoprotein that serves as the primary dedicated circadian photoreceptor in
file:DROME/CRY/CRY-deep-research-falcon.md
blue-light absorption by **FAD** drives photoreduction via a **Trp triad/tetrad**
|
|
GO:0048471
perinuclear region of cytoplasm
|
IEA
GO_REF:0000044 |
ACCEPT |
Summary: CRY accumulates in the perinuclear region before nuclear translocation.
Reason: The perinuclear accumulation is documented as part of CRY light-dependent trafficking.
Supporting Evidence:
UniProtKB:O77059
Accumulates in the perinuclear region about one hour before translocation into the nucleus.
|
|
GO:0048511
rhythmic process
|
IEA
GO_REF:0000043 |
ACCEPT |
Summary: CRY functions within the circadian feedback loop, supporting a rhythmic process annotation.
Reason: CRY is a blue-light-dependent regulator in the circadian feedback loop.
Supporting Evidence:
UniProtKB:O77059
Blue light-dependent regulator that is the input of the circadian feedback loop.
|
|
GO:0005515
protein binding
|
IPI
PMID:17418796 The Drosophila circadian network is a seasonal timer. |
MARK AS OVER ANNOTATED |
Summary: The cited study is focused on circadian network/photoperiod effects and does not present direct CRY binding assays; light-dependent CRY-TIM interaction is documented elsewhere.
Reason: Protein binding is overly generic and the PMID cited does not provide direct binding evidence for CRY. Specific interactions (e.g., CRYβTIM) are better captured with partner-specific evidence when available.
Supporting Evidence:
PMID:17418796
Previous work in Drosophila has defined two populations of circadian brain neurons, morning cells (M-cells) and evening cells (E-cells),
PMID:10417378
CRY and TIM are part of the same complex and directly interact in yeast in a light-dependent fashion.
|
|
GO:0005829
cytosol
|
IDA
PMID:10417378 Light-dependent sequestration of TIMELESS by CRYPTOCHROME. |
ACCEPT |
Summary: CRY can be detected in cytoplasm as well as nucleus.
Reason: Cytoplasmic accumulation is documented in studies of CRY localization; nuclear localization does not exclude cytosolic presence.
Supporting Evidence:
PMID:10417378
PER/TIM and CRY influence the subcellular distribution of these protein complexes, which reside primarily in the nucleus after the perception of a light signal.
PMID:14960620
it accumulated in both the nucleus and the cytoplasm, including some neuritic projections.
|
|
GO:0007623
circadian rhythm
|
IPI
PMID:10417378 Light-dependent sequestration of TIMELESS by CRYPTOCHROME. |
ACCEPT |
Summary: CRY acts as a circadian photoreceptor interacting with core clock components, supporting a role in circadian rhythm.
Reason: The paper explicitly describes CRY as a circadian photoreceptor acting via core clock components, consistent with circadian rhythm involvement.
Supporting Evidence:
PMID:10417378
Thus, CRY acts as a circadian photoreceptor by directly interacting with core components of the circadian clock.
|
|
GO:0007623
circadian rhythm
|
IMP
PMID:11357134 A new role for cryptochrome in a Drosophila circadian oscill... |
ACCEPT |
Summary: CRY mediates light input to circadian oscillators in brain and peripheral tissues, supporting circadian rhythm function.
Reason: The abstract states CRY acts as a photoreceptor mediating light input to circadian oscillators, indicating a role in circadian rhythms.
Supporting Evidence:
PMID:11357134
In Drosophila, cryptochrome (CRY) acts as a photoreceptor that mediates light input to circadian oscillators in both brain and peripheral tissue.
|
|
GO:0007623
circadian rhythm
|
IGI
PMID:9845370 The cryb mutation identifies cryptochrome as a circadian pho... |
ACCEPT |
Summary: The cryb mutation identifies cryptochrome as a circadian photoreceptor, consistent with circadian rhythm involvement.
Reason: Genetic evidence from cryb mutants establishes cryptochrome as a circadian photoreceptor in Drosophila.
Supporting Evidence:
PMID:9845370
The cryb mutation identifies cryptochrome as a circadian photoreceptor in Drosophila.
|
|
GO:0009881
photoreceptor activity
|
IDA
PMID:10417378 Light-dependent sequestration of TIMELESS by CRYPTOCHROME. |
ACCEPT |
Summary: CRY is described as a circadian photoreceptor acting via light-dependent interactions with core clock components.
Reason: The cited study explicitly characterizes CRY as a circadian photoreceptor, supporting photoreceptor activity.
Supporting Evidence:
PMID:10417378
Thus, CRY acts as a circadian photoreceptor by directly interacting with core components of the circadian clock.
|
|
GO:0007623
circadian rhythm
|
IMP
PMID:9845369 CRY, a Drosophila clock and light-regulated cryptochrome, is... |
ACCEPT |
Summary: CRY is a major contributor to circadian rhythm resetting and photosensitivity, supporting circadian rhythm involvement.
Reason: The abstract directly links CRY to circadian rhythm resetting, which is central to circadian rhythm processes.
Supporting Evidence:
PMID:9845369
CRY, a Drosophila clock and light-regulated cryptochrome, is a major contributor to circadian rhythm resetting and photosensitivity.
|
|
GO:0009637
response to blue light
|
IMP
PMID:9845369 CRY, a Drosophila clock and light-regulated cryptochrome, is... |
ACCEPT |
Summary: CRY mediates blue-light-evoked neuronal responses in pacemaker neurons, supporting a response to blue light.
Reason: Blue-light responsiveness is explicitly reported for CRY in pacemaker neurons; the original study supports CRY as a photosensitive cryptochrome.
Supporting Evidence:
PMID:28489826
Loss of either cry or
rh7 caused minor defects in photoentrainment, whereas loss of both caused
profound impairment
PMID:9845369
All characterized family members are directly photosensitive and include plant blue light photoreceptors.
|
|
GO:0043153
entrainment of circadian clock by photoperiod
|
IGI
PMID:28840790 A New Rhodopsin Influences Light-dependent Daily Activity Pa... |
ACCEPT |
Summary: Genetic interaction data support CRY contributions to photoentrainment and synchronization to light-dark cycles.
Reason: The cited study reports altered synchronization in blue light and stronger effects when cryptochrome-based light input is absent; additional evidence shows cry loss affects photoentrainment.
Supporting Evidence:
PMID:28840790
However, in blue light (470 nm), Rh70 mutants needed significantly longer to synchronize than wild-type controls,
PMID:28489826
Loss of either cry or
rh7 caused minor defects in photoentrainment, whereas loss of both caused
profound impairment
|
|
GO:0032922
circadian regulation of gene expression
|
IMP
PMID:28489826 A rhodopsin in the brain functions in circadian photoentrain... |
ACCEPT |
Summary: CRY contributes to circadian clock regulation and acts as a transcriptional repressor of clock-controlled genes.
Reason: Photoentrainment phenotypes in cry mutants support circadian regulation, and CRY represses CLK/CYC-driven transcription.
Supporting Evidence:
PMID:28489826
Loss of either cry or
rh7 caused minor defects in photoentrainment, whereas loss of both caused
profound impairment
PMID:16527739
Drosophila CRY also functions as a transcriptional repressor.
|
|
GO:0032922
circadian regulation of gene expression
|
IGI
PMID:28489826 A rhodopsin in the brain functions in circadian photoentrain... |
ACCEPT |
Summary: Genetic interaction data link CRY to circadian regulation and transcriptional repression.
Reason: cry-dependent photoentrainment plus CRY transcriptional repression supports circadian regulation of gene expression.
Supporting Evidence:
PMID:28489826
Loss of either cry or
rh7 caused minor defects in photoentrainment, whereas loss of both caused
profound impairment
PMID:16527739
Drosophila CRY also functions as a transcriptional repressor.
|
|
GO:0043153
entrainment of circadian clock by photoperiod
|
IMP
PMID:28489826 A rhodopsin in the brain functions in circadian photoentrain... |
ACCEPT |
Summary: CRY contributes to photoentrainment of the circadian clock.
Reason: Loss of cry impairs photoentrainment, especially when combined with loss of rh7.
Supporting Evidence:
PMID:28489826
Loss of either cry or
rh7 caused minor defects in photoentrainment, whereas loss of both caused
profound impairment
|
|
GO:0043153
entrainment of circadian clock by photoperiod
|
IGI
PMID:28489826 A rhodopsin in the brain functions in circadian photoentrain... |
ACCEPT |
Summary: Genetic interaction evidence supports CRY-dependent photoentrainment.
Reason: Combined loss of cry and rh7 causes strong defects in photoentrainment.
Supporting Evidence:
PMID:28489826
Loss of either cry or
rh7 caused minor defects in photoentrainment, whereas loss of both caused
profound impairment
|
|
GO:0048512
circadian behavior
|
IMP
PMID:28489826 A rhodopsin in the brain functions in circadian photoentrain... |
ACCEPT |
Summary: CRY affects circadian behavioral outputs via photoentrainment pathways.
Reason: cry loss disrupts photoentrainment and alters behavioral responses to light cycles.
Supporting Evidence:
PMID:28489826
Loss of either cry or
rh7 caused minor defects in photoentrainment, whereas loss of both caused
profound impairment
|
|
GO:0048512
circadian behavior
|
IGI
PMID:28489826 A rhodopsin in the brain functions in circadian photoentrain... |
ACCEPT |
Summary: Genetic interaction between cry and rh7 affects circadian behavioral entrainment.
Reason: Combined mutations show profound behavioral photoentrainment defects.
Supporting Evidence:
PMID:28489826
Loss of either cry or
rh7 caused minor defects in photoentrainment, whereas loss of both caused
profound impairment
|
|
GO:0071482
cellular response to light stimulus
|
IMP
PMID:28489826 A rhodopsin in the brain functions in circadian photoentrain... |
ACCEPT |
Summary: CRY mediates cellular light responses in pacemaker neurons.
Reason: Light-evoked neuronal responses depend on CRY, supporting cellular response to light stimulus.
Supporting Evidence:
PMID:28489826
Loss of either cry or
rh7 caused minor defects in photoentrainment, whereas loss of both caused
profound impairment
|
|
GO:0005654
nucleoplasm
|
TAS
Reactome:R-DME-432371 |
ACCEPT |
Summary: Reactome places CRY in nucleoplasm during circadian signaling.
Reason: UniProt subcellular location evidence includes nuclear CRY.
Supporting Evidence:
UniProtKB:O77059
SUBCELLULAR LOCATION: Cytoplasm ... Nucleus.
|
|
GO:0005654
nucleoplasm
|
TAS
Reactome:R-DME-432378 |
ACCEPT |
Summary: Reactome places CRY in nucleoplasm during clock-regulatory steps.
Reason: Nuclear localization of CRY is documented in curated UniProt annotations.
Supporting Evidence:
UniProtKB:O77059
SUBCELLULAR LOCATION: Cytoplasm ... Nucleus.
|
|
GO:0005654
nucleoplasm
|
TAS
Reactome:R-DME-432424 |
ACCEPT |
Summary: Reactome annotates CRY in nucleoplasm for TIM-related steps.
Reason: CRY translocates to the nucleus after light perception.
Supporting Evidence:
UniProtKB:O77059
SUBCELLULAR LOCATION: Cytoplasm ... Nucleus.
|
|
GO:0005654
nucleoplasm
|
TAS
Reactome:R-DME-432652 |
ACCEPT |
Summary: Reactome assigns CRY to nucleoplasm, consistent with light-induced nuclear localization.
Reason: Curated localization places CRY in the nucleus.
Supporting Evidence:
UniProtKB:O77059
SUBCELLULAR LOCATION: Cytoplasm ... Nucleus.
|
|
GO:0005829
cytosol
|
TAS
Reactome:R-DME-432401 |
ACCEPT |
Summary: Reactome assigns CRY to cytosol in light-input pathway steps.
Reason: Cytosolic localization of CRY is supported by UniProt curated evidence.
Supporting Evidence:
UniProtKB:O77059
SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:10417378,
|
|
GO:0005829
cytosol
|
TAS
Reactome:R-DME-432426 |
ACCEPT |
Summary: Reactome assigns CRY to cytosol during TIM-related interactions.
Reason: Cytoplasmic localization is curated for CRY.
Supporting Evidence:
UniProtKB:O77059
SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:10417378,
|
|
GO:0005829
cytosol
|
TAS
Reactome:R-DME-432428 |
ACCEPT |
Summary: Reactome assigns CRY to cytosol during degradation steps.
Reason: CRY is documented in cytosolic compartments before nuclear translocation.
Supporting Evidence:
UniProtKB:O77059
SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:10417378,
|
|
GO:0005829
cytosol
|
TAS
Reactome:R-DME-432593 |
ACCEPT |
Summary: Reactome assigns CRY to cytosol in ubiquitination steps.
Reason: Cytosolic localization of CRY is supported by curated UniProt evidence.
Supporting Evidence:
UniProtKB:O77059
SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:10417378,
|
|
GO:0005829
cytosol
|
TAS
Reactome:R-DME-881988 |
ACCEPT |
Summary: Reactome assigns CRY to cytosol for phosphorylation steps.
Reason: CRY is documented in cytosol/perinuclear regions prior to nuclear translocation.
Supporting Evidence:
UniProtKB:O77059
SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:10417378,
|
|
GO:0045187
regulation of circadian sleep/wake cycle, sleep
|
IMP
PMID:25148297 Effects of light interruption on sleep and viability of Dros... |
ACCEPT |
Summary: Disruption of CRY rhythms by nocturnal light affects sleep regulation.
Reason: Light interruption dampens CRY rhythms and impacts sleep, indicating CRY involvement in circadian sleep/wake regulation.
Supporting Evidence:
PMID:25148297
the discontinuous light
stimulation damped the daily rhythm of a circadian light-sensitive protein
cryptochrome both at the mRNA and protein levels,
|
|
GO:0005515
protein binding
|
IPI
PMID:24297896 Flavin reduction activates Drosophila cryptochrome. |
MARK AS OVER ANNOTATED |
Summary: TIM binds dCRY in light, but the generic protein-binding term is uninformative.
Reason: The paper supports specific CRY-TIM interaction; use of a generic binding term is over-annotated.
Supporting Evidence:
PMID:24297896
the corresponding peptide binds dCRY in light and protects the flavin from oxidation
|
|
GO:0043153
entrainment of circadian clock by photoperiod
|
IMP
PMID:22306971 Rhodopsin 5- and Rhodopsin 6-mediated clock synchronization ... |
ACCEPT |
Summary: CRY contributes to light synchronization of the circadian clock.
Reason: The study notes that cryptochrome in brain clock neurons contributes to clock synchronization.
Supporting Evidence:
PMID:22306971
the blue-light photoreceptor Cryptochrome expressed within the brain clock neurons contribute to this clock synchronization.
|
|
GO:0043153
entrainment of circadian clock by photoperiod
|
IGI
PMID:22306971 Rhodopsin 5- and Rhodopsin 6-mediated clock synchronization ... |
ACCEPT |
Summary: Genetic data in the context of light synchronization support CRY-dependent photoentrainment.
Reason: Cryptochrome contributes to clock synchronization alongside visual photoreceptors.
Supporting Evidence:
PMID:22306971
the blue-light photoreceptor Cryptochrome expressed within the brain clock neurons contribute to this clock synchronization.
|
|
GO:0071949
FAD binding
|
IDA
PMID:23746849 Structures of Drosophila cryptochrome and mouse cryptochrome... |
ACCEPT |
Summary: dCRY is a FAD-dependent photoreceptor.
Reason: Structural analysis identifies dCRY as FAD-dependent, supporting FAD binding.
Supporting Evidence:
PMID:23746849
Drosophila cryptochrome (dCRY) is a FAD-dependent circadian photoreceptor,
|
|
GO:0050958
magnetoreception
|
IMP
PMID:20098414 Animal cryptochromes mediate magnetoreception by an unconven... |
KEEP AS NON CORE |
Summary: CRY mediates light-dependent magnetoreception. The falcon deep research frames this
as a non-canonical, tissue-dependent CRY function: cry mutants lose magnetic-field-
dependent behaviors, with proposed radical-pair photochemistry tied to flavin redox.
Reason: Genuine but non-core. Magnetosensitivity is a proposed/secondary CRY function relative
to the canonical circadian photoreceptor / TIM-degradation role, and the underlying
radical-pair mechanism remains a hypothesis.
Supporting Evidence:
PMID:20098414
the light-dependent magnetic sense of Drosophila melanogaster is mediated by the ultraviolet (UV)-A/blue light photoreceptor cryptochrome (Cry)
file:DROME/CRY/CRY-deep-research-falcon.md
CRY-dependent magnetosensitivity is frequently discussed in Drosophila, with reviews summarizing that cry mutants lose magnetic-field-dependent behaviors
|
|
GO:0071000
response to magnetism
|
IMP
PMID:20098414 Animal cryptochromes mediate magnetoreception by an unconven... |
KEEP AS NON CORE |
Summary: CRY is required for light-dependent responses to magnetic fields. Per falcon, this is
a non-canonical CRY function relative to the core circadian photoreceptor role.
Reason: CRY-dependent magnetosensory responses under UV-A/blue light are genuine but secondary
to the core circadian photoreceptor / TIM-degradation function.
Supporting Evidence:
PMID:20098414
the light-dependent magnetic sense of Drosophila melanogaster is mediated by the ultraviolet (UV)-A/blue light photoreceptor cryptochrome (Cry)
file:DROME/CRY/CRY-deep-research-falcon.md
CRY-dependent magnetosensitivity is frequently discussed in Drosophila, with reviews summarizing that cry mutants lose magnetic-field-dependent behaviors
|
|
GO:0009785
blue light signaling pathway
|
IMP
PMID:10063806 A putative blue-light receptor from Drosophila melanogaster. |
ACCEPT |
Summary: CRY is a blue-light photoreceptor that lacks photolyase activity.
Reason: The study characterizes CRY as a blue-light photoreceptor, supporting a role in blue-light signaling.
Supporting Evidence:
PMID:10063806
the protein is not a DNA repair enzyme but a blue-light photoreceptor.
|
|
GO:0009649
entrainment of circadian clock
|
IDA
PMID:21135155 Cryptochrome-positive and -negative clock neurons in Drosoph... |
ACCEPT |
Summary: CRY is a key component for preferential entrainment to light.
Reason: The study shows CRY-positive neurons preferentially entrain to light cycles.
Supporting Evidence:
PMID:21135155
CRY is a key component for the preferential entrainment to light.
|
|
GO:0042752
regulation of circadian rhythm
|
IDA
PMID:21135155 Cryptochrome-positive and -negative clock neurons in Drosoph... |
ACCEPT |
Summary: CRY participates in light synchronization of circadian rhythms.
Reason: CRY is required for light-driven entrainment of circadian rhythms in clock neurons.
Supporting Evidence:
PMID:21135155
The blue-light photoreceptive protein Cryptochrome (CRY) plays an important role in the light synchronization of the Drosophila circadian clock.
|
|
GO:0005515
protein binding
|
IPI
PMID:10417378 Light-dependent sequestration of TIMELESS by CRYPTOCHROME. |
MARK AS OVER ANNOTATED |
Summary: CRY interacts with TIM in a light-dependent complex, but generic protein binding is
over-annotated. The falcon deep research provides the specific structural basis: a 2023
cryo-EM structure shows TIM inserts its N-terminus into the CRY flavin pocket, replacing
the autoinhibitory C-terminal tail (CTT) and forming the major interface.
Reason: The evidence supports specific light-dependent CRY-TIM interaction rather than nonspecific protein binding.
Supporting Evidence:
PMID:10417378
CRY and TIM are part of the same complex and directly interact in yeast in a light-dependent fashion.
file:DROME/CRY/CRY-deep-research-falcon.md
TIM inserts its N-terminus into the CRY flavin pocket**, replacing the CRY CTT and forming a major interface.
|
|
GO:0071000
response to magnetism
|
IMP
PMID:18641630 Cryptochrome mediates light-dependent magnetosensitivity in ... |
KEEP AS NON CORE |
Summary: CRY is necessary for light-dependent magnetosensitive responses. Per falcon, this is
a non-canonical CRY function relative to the core circadian photoreceptor role.
Reason: Cry-deficient flies lack magnetic responses under light, but magnetosensitivity is a
secondary function relative to the core circadian photoreceptor / TIM-degradation role.
Supporting Evidence:
PMID:18641630
the ultraviolet-A/blue-light photoreceptor cryptochrome (Cry) is necessary for light-dependent magnetosensitive responses in Drosophila melanogaster.
file:DROME/CRY/CRY-deep-research-falcon.md
CRY-dependent magnetosensitivity is frequently discussed in Drosophila, with reviews summarizing that cry mutants lose magnetic-field-dependent behaviors
|
|
GO:0009649
entrainment of circadian clock
|
IMP
PMID:18044989 Light activates output from evening neurons and inhibits out... |
ACCEPT |
Summary: CRY mediates light input that resets the circadian oscillator. The falcon deep
research adds mechanistic detail: TIM then associates with CRY and JET/CUL1, leading
to TIM ubiquitination and proteasomal degradation; a 2023 cryo-EM structure shows TIM
inserts its N-terminus into the CRY flavin pocket, replacing the autoinhibitory CTT.
Reason: Light-activated CRY binding to TIM promotes degradation and clock resetting, supporting entrainment. Core biological process.
Supporting Evidence:
PMID:18044989
Light-activated CRY binds to the TIMELESS (TIM) protein and induces its degradation, which is likely to reset the molecular oscillator
file:DROME/CRY/CRY-deep-research-falcon.md
TIM then associates with CRY and **JET/CUL1**, leading to **TIM ubiquitination and proteasomal degradation**
|
|
GO:0050958
magnetoreception
|
IMP
PMID:19355790 Cryptochrome mediates light-dependent magnetosensitivity of ... |
KEEP AS NON CORE |
Summary: CRY-dependent magnetic sensitivity of the circadian clock supports magnetoreception.
Per falcon, this is a non-canonical, tissue-dependent CRY function relative to the
core circadian photoreceptor / TIM-degradation role.
Reason: Magnetic field effects on the clock are light- and CRY-dependent, but magnetosensitivity
is a secondary/proposed function, not the core circadian photoreceptor role.
Supporting Evidence:
PMID:19355790
Drosophila's circadian clock is sensitive to magnetic
fields and that this sensitivity depends on light activation of CRY and on the
applied field strength
file:DROME/CRY/CRY-deep-research-falcon.md
CRY-dependent magnetosensitivity is frequently discussed in Drosophila, with reviews summarizing that cry mutants lose magnetic-field-dependent behaviors
|
|
GO:0005634
nucleus
|
IDA
PMID:18399544 Cryptochrome is present in the compound eyes and a subset of... |
ACCEPT |
Summary: CRY localizes to the nucleus in light/dark conditions.
Reason: Independent evidence shows nuclear accumulation of CRY in brain neurons.
Supporting Evidence:
PMID:14960620
it accumulated in both the nucleus and the cytoplasm, including some neuritic projections.
|
|
GO:0005737
cytoplasm
|
IDA
PMID:18399544 Cryptochrome is present in the compound eyes and a subset of... |
ACCEPT |
Summary: CRY localizes to cytoplasm in brain neurons.
Reason: Independent evidence shows cytoplasmic accumulation of CRY in light/dark conditions.
Supporting Evidence:
PMID:14960620
it accumulated in both the nucleus and the cytoplasm, including some neuritic projections.
|
|
GO:0003913
DNA photolyase activity
|
IMP
NOT
PMID:10063806 A putative blue-light receptor from Drosophila melanogaster. |
ACCEPT |
Summary: CRY lacks DNA photolyase activity (negated).
Reason: Recombinant CRY does not show photolyase activity for CPD or 6-4 photoproducts.
Supporting Evidence:
PMID:10063806
The recombinant protein did not show photolyase activity for either cyclobutane pyrimidine dimers or 6-4 photoproducts in vitro
|
|
GO:0005515
protein binding
|
IPI
PMID:11448767 Light-dependent interaction between Drosophila CRY and the c... |
MARK AS OVER ANNOTATED |
Summary: CRY interacts with PER in a light-dependent manner, but the generic binding term is over-annotated.
Reason: The evidence supports a specific CRY-PER interaction rather than nonspecific protein binding.
Supporting Evidence:
PMID:11448767
revealed a dimerization between PER and CRY.
|
|
GO:0009881
photoreceptor activity
|
IMP
PMID:10417378 Light-dependent sequestration of TIMELESS by CRYPTOCHROME. |
ACCEPT |
Summary: CRY is described as a circadian photoreceptor.
Reason: The study explicitly characterizes CRY as a circadian photoreceptor acting via core clock components.
Supporting Evidence:
PMID:10417378
Thus, CRY acts as a circadian photoreceptor by directly interacting with core components of the circadian clock.
|
|
GO:0009881
photoreceptor activity
|
IMP
PMID:18597555 Human and Drosophila cryptochromes are light activated by fl... |
ACCEPT |
Summary: Cryptochromes function as blue-light signaling receptors.
Reason: The study describes cryptochromes as flavoprotein blue-light signaling receptors.
Supporting Evidence:
PMID:18597555
Cryptochromes are a class of flavoprotein blue-light signaling receptors found
in plants, animals, and humans
|
|
GO:0009882
blue light photoreceptor activity
|
IMP
PMID:10063806 A putative blue-light receptor from Drosophila melanogaster. |
ACCEPT |
Summary: CRY is a blue-light photoreceptor. The falcon deep research confirms this as the core
molecular function: DmCRY is a Drosophila-type/type I cryptochrome that functions
primarily as a blue-light photoreceptor for circadian clock entrainment, mechanistically
distinct from the light-independent mammalian-type (type II) cryptochromes.
Reason: Recombinant CRY lacks photolyase activity and is characterized as a blue-light photoreceptor; this is the core molecular function.
Supporting Evidence:
PMID:10063806
suggesting that the protein is not a DNA repair enzyme but a blue-light photoreceptor.
file:DROME/CRY/CRY-deep-research-falcon.md
functions primarily as a **blue-light photoreceptor** for circadian clock entrainment
|
|
GO:0009882
blue light photoreceptor activity
|
IMP
PMID:10233998 An extraretinally expressed insect cryptochrome with similar... |
ACCEPT |
Summary: DCry is identified as a candidate blue-light photoreceptor in Drosophila.
Reason: The study identifies DCry as a blue-light photoreceptor linked to circadian entrainment.
Supporting Evidence:
PMID:10233998
We now have identified and characterized a candidate blue light photoreceptor gene in Drosophila (DCry)
|
|
GO:0009882
blue light photoreceptor activity
|
IMP
PMID:17298948 A novel photoreaction mechanism for the circadian blue light... |
ACCEPT |
Summary: dCRY functions as a blue-light photoreceptor.
Reason: The study describes dCRY as a blue light photoreceptor involved in clock synchronization.
Supporting Evidence:
PMID:17298948
Drosophila cryptochrome (dCRY) is a blue light photoreceptor that is involved in the synchronization of the circadian clock with the environmental light-dark cycle
|
|
GO:0009882
blue light photoreceptor activity
|
IMP
PMID:9845369 CRY, a Drosophila clock and light-regulated cryptochrome, is... |
ACCEPT |
Summary: CRY contributes to photosensitivity in the circadian system.
Reason: The study links CRY to circadian photosensitivity and light-dependent resetting.
Supporting Evidence:
PMID:9845369
CRY, a Drosophila clock and light-regulated cryptochrome, is a major contributor to circadian rhythm resetting and photosensitivity.
|
|
GO:0042752
regulation of circadian rhythm
|
IMP
PMID:10233998 An extraretinally expressed insect cryptochrome with similar... |
ACCEPT |
Summary: DCry dosage affects blue-light resetting of circadian locomotor rhythms.
Reason: Changes in DCry gene dosage alter blue-light resetting responses.
Supporting Evidence:
PMID:10233998
changes in DCry gene dosage are associated predictably with alterations of the blue light resetting response for the circadian rhythm of adult locomotor activity.
|
|
GO:0042752
regulation of circadian rhythm
|
IMP
PMID:17298948 A novel photoreaction mechanism for the circadian blue light... |
ACCEPT |
Summary: dCRY participates in synchronization of the circadian clock to light-dark cycles.
Reason: The study links dCRY photoreceptor function to circadian clock synchronization.
Supporting Evidence:
PMID:17298948
Drosophila cryptochrome (dCRY) is a blue light photoreceptor that is involved in the synchronization of the circadian clock with the environmental light-dark cycle
|
|
GO:0042752
regulation of circadian rhythm
|
IMP
PMID:9845369 CRY, a Drosophila clock and light-regulated cryptochrome, is... |
ACCEPT |
Summary: CRY contributes to circadian rhythm resetting.
Reason: The study identifies CRY as a major contributor to circadian rhythm resetting and photosensitivity.
Supporting Evidence:
PMID:9845369
CRY, a Drosophila clock and light-regulated cryptochrome, is a major contributor to circadian rhythm resetting and photosensitivity.
|
|
GO:0042752
regulation of circadian rhythm
|
IMP
PMID:9845370 The cryb mutation identifies cryptochrome as a circadian pho... |
ACCEPT |
Summary: cryb mutants show impaired synchronization to light-dark cycles.
Reason: Genetic loss of CRY affects circadian light synchronization, supporting regulation of circadian rhythm.
Supporting Evidence:
PMID:9845370
Behaviorally, cryb exhibits poor synchronization to light-dark cycles in genetic backgrounds that cause external blindness
|
|
GO:0045892
negative regulation of DNA-templated transcription
|
IMP
PMID:16527739 Drosophila CRYPTOCHROME is a circadian transcriptional repre... |
KEEP AS NON CORE |
Summary: Collins et al. directly demonstrate that Drosophila CRY can repress CLK/CYC-driven
transcription, but the effect is "confined to peripheral clocks" and does not
significantly affect pacemaker-neuron molecular or behavioral rhythms. This is a
genuine but secondary role; the falcon deep research frames the primary/best-established
DmCRY function as the blue-light photoreceptor that triggers light-dependent TIM
degradation, mechanistically distinct from the mammalian type II repressor role.
Reason: Direct experimental evidence (IMP) for repressor activity is solid, but it is a
peripheral-clock-specific, non-core function in Drosophila. The canonical core function
is light input via TIM degradation, not transcriptional repression.
Supporting Evidence:
PMID:16527739
Drosophila CRY also functions as a transcriptional repressor.
file:DROME/CRY/CRY-deep-research-falcon.md
A 2020 expert review by Foley & Emery frames Drosophila CRY as a multi-functional photoreceptor whose **best-established** role is circadian entrainment via **light-dependent TIM degradation**
|
|
GO:0050660
flavin adenine dinucleotide binding
|
IDA
PMID:10063806 A putative blue-light receptor from Drosophila melanogaster. |
ACCEPT |
Summary: Recombinant CRY binds a flavin adenine dinucleotide chromophore.
Reason: The study reports FAD as a chromophore in purified CRY.
Supporting Evidence:
PMID:10063806
Purified recombinant protein contained a flavin adenine dinucleotide chromophore.
|
|
GO:0050660
flavin adenine dinucleotide binding
|
IDA
PMID:17298948 A novel photoreaction mechanism for the circadian blue light... |
ACCEPT |
Summary: dCRY contains FAD as a bound cofactor.
Reason: Biochemical analysis shows FAD(ox) in purified dCRY.
Supporting Evidence:
PMID:17298948
insect cell-purified dCRY contains flavin adenine dinucleotide in its oxidized state (FAD(ox)) and residual amounts of methenyltetrahydrofolate
|
|
GO:0050660
flavin adenine dinucleotide binding
|
IMP
PMID:18597555 Human and Drosophila cryptochromes are light activated by fl... |
ACCEPT |
Summary: Light induces redox changes in flavin bound to CRY.
Reason: Photoreduction of bound flavin implies FAD binding.
Supporting Evidence:
PMID:18597555
Cryptochromes are a class of flavoprotein blue-light signaling receptors found
in plants, animals, and humans
|
|
GO:0050980
detection of light stimulus involved in magnetoreception
|
IMP
PMID:18641630 Cryptochrome mediates light-dependent magnetosensitivity in ... |
KEEP AS NON CORE |
Summary: Light-dependent magnetosensitivity requires CRY, indicating light detection linked to
magnetoreception. Per falcon, this is a non-canonical CRY function relative to the core
circadian photoreceptor role.
Reason: CRY is necessary for light-dependent magnetic responses, but this magnetosensory
detection is secondary to the core circadian photoreceptor / TIM-degradation function.
Supporting Evidence:
PMID:18641630
the ultraviolet-A/blue-light photoreceptor cryptochrome (Cry) is necessary for light-dependent magnetosensitive responses in Drosophila melanogaster.
file:DROME/CRY/CRY-deep-research-falcon.md
CRY-dependent magnetosensitivity is frequently discussed in Drosophila, with reviews summarizing that cry mutants lose magnetic-field-dependent behaviors
|
|
GO:0042752
regulation of circadian rhythm
|
IDA
PMID:16510731 Functional analysis of circadian pacemaker neurons in Drosop... |
ACCEPT |
Summary: CRY contributes to regulation of circadian rhythm, and this study highlights light-responsive pacemaker neuron behavior.
Reason: Pacemaker neuron light responses are consistent with CRY-dependent circadian regulation supported by additional literature.
Supporting Evidence:
PMID:16510731
respond differently to light and can be completely desynchronized from one another by constant light
PMID:9845369
CRY, a Drosophila clock and light-regulated cryptochrome, is a major contributor to circadian rhythm resetting and photosensitivity.
|
|
GO:0007602
phototransduction
|
IMP
PMID:18056988 Animal type 1 cryptochromes. Analysis of the redox state of ... |
MODIFY |
Summary: The study supports CRY as a circadian photoreceptor, but phototransduction is broader than demonstrated.
Reason: Evidence supports photoreceptor activity, not a complete phototransduction cascade annotation.
Proposed replacements:
photoreceptor activity
Supporting Evidence:
PMID:18056988
Type 1 CRYs, the prototype of which is the Drosophila CRY, that is known to be a circadian photoreceptor.
|
|
GO:0009881
photoreceptor activity
|
IMP
PMID:18056988 Animal type 1 cryptochromes. Analysis of the redox state of ... |
ACCEPT |
Summary: Drosophila CRY is a circadian photoreceptor.
Reason: The paper explicitly describes Drosophila CRY as a circadian photoreceptor.
Supporting Evidence:
PMID:18056988
Type 1 CRYs, the prototype of which is the Drosophila CRY, that is known to be a circadian photoreceptor.
|
|
GO:0050660
flavin adenine dinucleotide binding
|
IDA
PMID:18056988 Animal type 1 cryptochromes. Analysis of the redox state of ... |
ACCEPT |
Summary: Type 1 CRYs contain FAD when purified.
Reason: The study reports FAD in purified insect CRYs including Drosophila.
Supporting Evidence:
PMID:18056988
Cryptochromes from all four sources contain FAD(ox) when purified, and the flavin is readily reduced to FAD(*-) by light
|
|
GO:0043153
entrainment of circadian clock by photoperiod
|
IMP
PMID:14960620 Novel features of cryptochrome-mediated photoreception in th... |
ACCEPT |
Summary: CRY mediates photic input to the circadian clock.
Reason: The study identifies cryptochrome as a photopigment in brain clock neurons affecting light responses.
Supporting Evidence:
PMID:14960620
The other involves a presumptive photopigment, cryptochrome (cry), expressed in lateral brain neurons that control behavioral rhythms
|
|
GO:0045475
locomotor rhythm
|
IMP
PMID:17068124 Veela defines a molecular link between Cryptochrome and Time... |
KEEP AS NON CORE |
Summary: CRY-dependent light input affects behavioral rhythmicity.
Reason: The study reports maintenance of behavioral rhythmicity under constant light in CRY pathway variants, consistent with locomotor rhythm modulation.
Supporting Evidence:
PMID:17068124
these genetically altered flies maintain behavioral and molecular rhythmicity under constant-light conditions that usually stop the clock
|
|
GO:0009649
entrainment of circadian clock
|
IMP
PMID:15996552 Serotonin modulates circadian entrainment in Drosophila. |
ACCEPT |
Summary: Light entrainment involves light-induced TIM degradation in a CRY-dependent pathway.
Reason: The study links light entrainment to TIM degradation and notes interaction with CRY pathway components.
Supporting Evidence:
PMID:15996552
Entrainment of the Drosophila circadian clock to light involves the light-induced degradation of the clock protein timeless (TIM).
|
|
GO:0005634
nucleus
|
IDA
PMID:10417378 Light-dependent sequestration of TIMELESS by CRYPTOCHROME. |
ACCEPT |
Summary: CRY-containing complexes reside primarily in the nucleus after light perception.
Reason: The study describes nuclear localization of CRY/PER/TIM complexes after light.
Supporting Evidence:
PMID:10417378
PER/TIM and CRY influence the subcellular distribution of these protein complexes, which reside primarily in the nucleus after the perception of a light signal.
|
|
GO:0009416
response to light stimulus
|
IMP
PMID:15258584 A constitutively active cryptochrome in Drosophila melanogas... |
ACCEPT |
Summary: Light-activated CRY regulates circadian photoresponses.
Reason: The study directly links CRY activation by light to circadian photoresponses.
Supporting Evidence:
PMID:15258584
Light-activated cryptochrome (CRY) regulates circadian photoresponses in Drosophila melanogaster.
|
|
GO:0009588
UV-A, blue light phototransduction
|
ISS
PMID:10233998 An extraretinally expressed insect cryptochrome with similar... |
ACCEPT |
Summary: DCry is an extraretinal blue-light photoreceptor implicated in circadian photoresponses.
Reason: The study identifies DCry as a blue-light photoreceptor in brain clock neurons.
Supporting Evidence:
PMID:10233998
We now have identified and characterized a candidate blue light photoreceptor gene in Drosophila (DCry)
|
|
GO:0009649
entrainment of circadian clock
|
IMP
PMID:12417651 The extraretinal eyelet of Drosophila: development, ultrastr... |
ACCEPT |
Summary: Light entrainment involves the eyelet and cryptochrome pathways.
Reason: The study reports that eyelet together with cryptochrome mediates phase delays in entrainment.
Supporting Evidence:
PMID:12417651
eyelet together with cryptochrome mainly mediates phase delays.
|
|
GO:0042332
gravitaxis
|
IMP
PMID:12042820 Identification of genes involved in Drosophila melanogaster ... |
KEEP AS NON CORE |
Summary: cry mutants show altered geotaxis scores, supporting a role in gravitaxis. This is a
pleiotropic behavioral effect rather than the core circadian photoreceptor function;
the falcon deep research does not feature gravitaxis among CRY's well-established roles.
Reason: The full text reports that homozygous cry mutants significantly increase geotaxis
scores, but this is a downstream/pleiotropic behavioral phenotype, not a core function.
Supporting Evidence:
PMID:12042820
genes that contribute to the complex, polygenic behavior of geotaxis
|
|
GO:0043153
entrainment of circadian clock by photoperiod
|
IMP
PMID:15258584 A constitutively active cryptochrome in Drosophila melanogas... |
ACCEPT |
Summary: CRY activation by light affects circadian photoresponses and entrainment.
Reason: Light-activated CRY regulates photoresponses consistent with photoperiod entrainment.
Supporting Evidence:
PMID:15258584
Light-activated cryptochrome (CRY) regulates circadian photoresponses in Drosophila melanogaster.
|
|
GO:0043153
entrainment of circadian clock by photoperiod
|
IMP
PMID:16361445 Disruption of Cryptochrome partially restores circadian rhyt... |
ACCEPT |
Summary: Light entraining signals require CRY-dependent pathways.
Reason: The study states that cryptochrome-mediated pathways provide entraining light signals to the clock.
Supporting Evidence:
PMID:16361445
cryptochrome are also critical in providing the circadian clock with entraining light signals from the environment
|
The target protein is Drosophila melanogaster Cryptochrome-1 (UniProt: O77059), encoded by the cry gene (FlyBase: FBgn0025680, also designated CG3772). This protein is also referred to as DmCRY1, dcry, or blue light photoreceptor. The protein belongs to the DNA photolyase class-1 family and contains characteristic cryptochrome/photolyase domains including the FAD-binding domain (IPR005101), the photolyase N-terminal domain (IPR006050), and the broader cryptochrome/DNA photolyase superfamily domains (IPR002081, IPR036134, IPR036155). This review confirms that the literature surveyed consistently describes this same protein, as evidenced by matching gene symbols, organism, domain architecture, and functional characteristics across all sources examined.
Cryptochrome (CRY) is a blue light-sensitive flavoprotein that serves as the primary dedicated circadian photoreceptor in Drosophila melanogaster. The protein was first identified through forward genetic screens in 1998 when Stanewsky, Emery, and colleagues isolated the cryb mutation, which eliminated light-driven cycling of clock gene expression and severely impaired circadian photoentrainment[stanewsky-1998-cryb-abstract]. Simultaneously, Emery and colleagues characterized the cry gene and demonstrated that it encodes a blue light photoreceptor whose expression is itself clock-regulated, establishing CRY as a dedicated circadian photoreceptor molecule[emery-1998-cry-major-photoreceptor-abstract].
Drosophila CRY represents a Type 1 cryptochrome, distinguished from mammalian Type 2 cryptochromes by its primary function as a light-sensitive photoreceptor rather than a light-independent transcriptional repressor[foley-2020-variations-blue-abstract]. This functional distinction is critical for understanding the molecular circadian clock, as Drosophila CRY directly senses light and transduces this signal to reset the clock, whereas mammalian cryptochromes function as core clock components independent of their photosensitivity. Remarkably, despite these functional differences, all cryptochromes share evolutionary origins with DNA repair photolyases and retain the characteristic flavin adenine dinucleotide (FAD) cofactor binding architecture.
The 2.3 angstrom crystal structure of full-length Drosophila CRY, determined by Zoltowski and colleagues in 2011, revealed the structural basis for its dual identity as both a photolyase homolog and a dedicated signaling protein[zoltowski-2011-structure-full-length-abstract]. The protein comprises two principal domains: an N-terminal photolyase homology region (PHR) of approximately 500 residues and a C-terminal extension including a characteristic C-terminal tail (CTT) helix. The PHR domain adopts the conserved alpha/beta fold shared across the cryptochrome/photolyase superfamily and harbors the FAD cofactor binding site within a deep pocket.
A distinguishing structural feature of Drosophila CRY is the positioning of its C-terminal tail. The CTT helix docks into a groove on the PHR domain surface that corresponds to the DNA-binding groove utilized by photolyases for recognizing damaged DNA substrates[zoltowski-2011-structure-full-length-abstract]. Within this docked position, a conserved tryptophan residue (Trp536) occupies a location analogous to where photolyases recognize DNA photolesions. This structural arrangement immediately suggested that light-induced displacement of the CTT from this groove would constitute the primary conformational change underlying CRY activation.
Unlike functional photolyases, Drosophila CRY lacks the antenna chromophore (methenyltetrahydrofolate or 8-hydroxy-7,8-didemethyl-5-deazariboflavin) that photolyases use to harvest light energy for DNA repair. This absence is consistent with CRY's evolution toward signaling rather than enzymatic DNA repair. The FAD cofactor in purified Drosophila CRY exists predominantly in the oxidized (FADox) state but is readily photoreduced to the anionic semiquinone (FADβ’β) upon blue light exposure, a reaction mediated by the conserved tryptophan triad[zoltowski-2011-structure-full-length-abstract].
The molecular mechanism by which Drosophila CRY transduces blue light into a biological signal involves photoreduction of the FAD cofactor through a conserved tryptophan chain, followed by conformational changes that expose interaction surfaces for downstream signaling partners. When purified Drosophila CRY absorbs blue light, charge transfer occurs along a highly conserved chain of tryptophan residues connecting the FAD cofactor to the protein surface. In classical photolyases and cryptochromes, this chain comprises three tryptophans (the "Trp triad": W420, W397, and W342 in Drosophila CRY), but biochemical and mutagenesis studies have revealed that a fourth surface tryptophan (W394) also participates, expanding the functional electron transfer chain to a "tryptophan tetrad"[vaidya-2013-photoreduction-abstract].
The photochemistry proceeds through ultrafast electron transfer: blue light excitation of the FAD initiates electron hopping along the tryptophan chain, with the terminal tryptophan radical being neutralized by reduction from solvent. This results in net photoreduction of FAD to the anionic semiquinone state (FADβ’β). Importantly, mutagenesis studies demonstrated that all phenylalanine replacements within the canonical Trp triad (W420F, W397F, W342F) retained partial light sensitivity, whereas substitution of the surface tryptophan (W394F) nearly abolished sustained flavin photoreduction, indicating that the fourth tryptophan serves as the terminal electron donor essential for stable photoreduction[vaidya-2013-photoreduction-abstract].
Ozturk and colleagues demonstrated that blue light exposure induces a conformational change in CRY that resembles the constitutively active state observed in CRY mutants lacking the C-terminal tail (CRYΞ)[ozturk-2011-reaction-mechanism-abstract]. This light-activated signaling state exhibits a half-life of approximately 15 minutes in the dark at 25Β°C in vitro and 27 minutes at 0Β°C in vivo, indicating that the conformational change persists well beyond the initial photochemical event. The persistence of this activated state, even after the flavin could potentially reoxidize, suggests that the signaling mechanism is "gated" by the initial photochemistry but maintained by subsequent protein conformational changes.
The structural basis for this conformational switch involves two conserved histidine residues (His377 and His378) adjacent to the FAD binding pocket[vaidya-2013-photoreduction-abstract]. Upon FAD photoreduction to the anionic semiquinone, these histidines become protonated, which destabilizes the interaction between the CTT helix and the FAD pocket. This protonation-dependent mechanism provides the molecular link between flavin redox chemistry and the "opening" of the C-terminal tail that exposes binding sites for TIMELESS and the JETLAG E3 ligase.
The primary biological function of Drosophila CRY is to entrain the molecular circadian clock to environmental light-dark cycles. This entrainment is accomplished through CRY-mediated, light-dependent degradation of the clock protein TIMELESS (TIM). Within the core Drosophila circadian clockwork, the transcription factors CLOCK (CLK) and CYCLE (CYC) activate expression of period (per) and timeless (tim) genes. The resulting PER and TIM proteins accumulate in the cytoplasm, eventually forming heterodimers that translocate to the nucleus where they inhibit CLK/CYC activity, thereby repressing their own transcription and completing a negative feedback loop with an approximately 24-hour period.
Light resets this oscillator by triggering rapid degradation of TIM protein. When Drosophila CRY absorbs blue light and undergoes the conformational change described above, it acquires the ability to bind directly to TIM. The 2023 cryo-electron microscopy structure of the CRY-TIM complex, determined at 3.3 angstrom resolution by Lin and colleagues, revealed that CRY engages a continuous core of N-terminal TIM armadillo (ARM) repeats in a manner structurally reminiscent of how photolyases recognize damaged DNA[lin-2023-cry-tim-structure-abstract]. Strikingly, the TIM N-terminus inserts directly into the CRY flavin binding pocket, physically displacing the CTT helix that normally occupies this space in the dark-adapted state.
The light-activated CRY-TIM complex is then recognized by JETLAG (JET), an F-box protein component of an SCF (Skp1-Cullin-F-box) E3 ubiquitin ligase complex. Koh, Zheng, and Sehgal identified JETLAG through a genetic screen for mutations causing reduced circadian light sensitivity[koh-2006-jetlag-abstract]. Flies carrying jetlag mutations exhibited rhythmic behavior in constant light (whereas wild-type flies become arrhythmic), showed reduced phase shifts in response to light pulses, and displayed reduced light-dependent TIM degradation. Critically, co-expression of JET and CRY in cultured S2R cells was sufficient to reconstitute light-dependent TIM degradation, demonstrating that these three proteins constitute the minimal machinery required for photic signal transduction to the clock.
The mechanism proceeds as follows: light-activated CRY binds TIM and recruits the JET-containing E3 ligase complex, which ubiquitinates TIM and targets it for proteasomal degradation. The rapid elimination of TIM destabilizes PER (which requires TIM for nuclear entry and stability), thereby resetting the phase of the molecular oscillator. When light is presented during the early subjective night, TIM degradation causes a phase delay because TIM accumulation is interrupted. When light is presented during the late subjective night, TIM degradation causes a phase advance because TIM is eliminated earlier than would occur through the normal clock-controlled degradation pathway.
CRY itself is also degraded in response to light, although on a slower timescale than TIM. The E3 ligase BRWD3 (also called Ramshackle) has been implicated in light-dependent CRY degradation, while JET primarily targets TIM[foley-2020-variations-blue-abstract]. This coordinated degradation of both CRY and its target TIM ensures that the photoreceptor system resets itself after light exposure, preparing it for subsequent light inputs.
Drosophila CRY is expressed in a subset of circadian clock neurons in the central nervous system. Detailed immunohistochemical analysis by Yoshii and colleagues revealed that CRY is present in the small ventral lateral neurons (s-LNvs), large ventral lateral neurons (l-LNvs), a subset of dorsal lateral neurons (LNds), and some dorsal neurons type 1 (DN1s)[helfrich-forster-2008-cry-expression-abstract]. Notably, CRY protein is absent from DN2 and DN3 neurons, even though cry mRNA is detectable in DN2s and DN3s, indicating that post-transcriptional regulation restricts CRY expression to specific neuronal populations. This finding implies that certain oscillator neurons in the Drosophila brain must entrain to light indirectly, receiving photic information from CRY-expressing neurons through intercellular communication.
Within individual neurons, CRY is distributed in both the nucleus and cytoplasm. Unlike its target protein TIM, which shuttles between cytoplasm and nucleus over the circadian cycle, CRY's subcellular localization remains relatively constant throughout the day and night[helfrich-forster-2008-cry-expression-abstract]. This stable distribution is consistent with CRY's role as a constitutive light sensor that must be positioned to detect light at any time rather than cycling in abundance or localization with the clock.
Beyond its well-characterized role as a circadian photoreceptor, Drosophila CRY also functions as a transcriptional repressor in peripheral tissues. Collins, Stanewsky, and Blau demonstrated that cryb mutant eyes exhibit derepressed expression of genes normally activated by CLK/CYC, indicating that CRY participates in negative feedback regulation of the molecular clock[collins-2006-transcriptional-repressor-abstract]. Importantly, this transcriptional repressor function requires both CRY and PER: overexpression of either CRY or PER alone did not repress CLK/CYC activity, but their co-expression produced robust repression. Drosophila CRY also repressed CLK/CYC-dependent transcription in cell culture assays, confirming a direct biochemical role.
Crucially, this repressor function appears confined to peripheral oscillators. Neither cryb mutations nor PER/CRY co-overexpression significantly affected molecular or behavioral rhythms when manipulated specifically in pacemaker neurons, suggesting that central brain clock neurons use different mechanisms (primarily TIM-mediated) for transcriptional feedback[collins-2006-transcriptional-repressor-abstract]. This tissue-specific duality reveals that a single CRY protein can perform fundamentally different functions depending on cellular context: serving as a light-dependent TIM destabilizer in central clock neurons while functioning as a light-independent transcriptional co-repressor in peripheral tissues such as the eye, antenna, and Malpighian tubules.
The peripheral oscillator defects in cryb flies are striking: rhythms in per and tim expression are severely disrupted in antennae, and rhythmic PER and TIM accumulation is abolished in compound eyes and Malpighian tubules. These findings indicate that CRY is essential for autonomous oscillator function in peripheral tissues, not merely for their photoentrainment.
Drosophila CRY has been implicated in magnetoreception, the ability of organisms to detect and respond to Earth's magnetic field. The proposed mechanism involves the radical pair hypothesis, wherein blue light-induced formation of radical pairs within CRY (specifically between the FAD and tryptophan residues) produces a quantum-coherent spin state that is sensitive to external magnetic fields. Theoretical and experimental studies have demonstrated that Drosophila CRY is indeed sensitive to magnetic fields in the millitesla range, with the protein's photochemical properties distinguishing it from related photolyases[foley-2020-variations-blue-abstract].
Gene knockout experiments have shown that Drosophila rely on CRY to mediate certain magnetosensitive behaviors, and the radical pair mechanism has gained support from biophysical studies demonstrating magnetic field effects on CRY photochemistry. However, the physiological relevance of magnetoreception in Drosophila remains less well characterized than in migratory birds, where cryptochrome-based compass sensing has been more extensively studied.
Drosophila CRY exemplifies the evolutionary diversification of the cryptochrome/photolyase superfamily. Phylogenetic analyses indicate that animal cryptochromes originated from (6-4) photolyases, while plant cryptochromes evolved independently from CPD photolyases, representing a remarkable case of convergent evolution toward light signaling functions from distinct DNA repair ancestors. Within animals, Type 1 cryptochromes (like Drosophila CRY) retained light-sensitive photoreceptor function, while Type 2 cryptochromes (found in mammals and some insects) lost photosensitivity and instead became core transcriptional repressors within the clock mechanism[foley-2020-variations-blue-abstract].
The structural homology between CRY and photolyases, particularly the conservation of the flavin-binding pocket and the tryptophan electron transfer chain, reflects their shared ancestry. However, CRY has evolved distinct features: loss of antenna chromophores, acquisition of the C-terminal tail regulatory mechanism, and the gain of protein-protein interaction surfaces that enable recognition of clock proteins like TIM rather than damaged DNA substrates.
Several important questions about Drosophila CRY function remain unresolved:
Tissue-specific functional switching: The mechanism by which the same CRY protein functions as a photoreceptor in central neurons but as a transcriptional co-repressor in peripheral tissues is not fully understood. Post-translational modifications, tissue-specific interaction partners, or differences in stoichiometry with PER may contribute to this functional dichotomy.
Light-independent signaling: While CRY's light-dependent functions are well characterized, the extent to which CRY may have light-independent signaling roles in central clock neurons (beyond peripheral tissue transcriptional repression) merits further investigation.
Magnetoreception physiological relevance: Although biophysical studies support the radical pair mechanism for magnetic field sensitivity, the behavioral and ecological significance of magnetoreception in Drosophila melanogaster requires further characterization.
CTT regulatory dynamics: The precise kinetics and structural intermediates involved in CTT undocking and re-docking during and after light exposure, and how these dynamics interface with TIM binding and JET recruitment, warrant additional investigation.
Natural variation: Natural polymorphisms in cry and their effects on circadian photosensitivity across different Drosophila populations adapted to varying light environments represent an area for continued study.
[stanewsky-1998-cryb-abstract] Stanewsky R, Kaneko M, Emery P, Beretta B, Wager-Smith K, Kay SA, Rosbash M, Hall JC. The cryb mutation identifies cryptochrome as a circadian photoreceptor in Drosophila. Cell. 1998 Nov 25;95(5):681-92. DOI: 10.1016/s0092-8674(00)81638-4. PMID: 9845370.
[emery-1998-cry-major-photoreceptor-abstract] Emery P, So WV, Kaneko M, Hall JC, Rosbash M. CRY, a Drosophila clock and light-regulated cryptochrome, is a major contributor to circadian rhythm resetting and photosensitivity. Cell. 1998 Nov 25;95(5):669-79. DOI: 10.1016/s0092-8674(00)81637-2. PMID: 9845369.
[emery-2000-deep-brain-abstract] Emery P, Stanewsky R, Helfrich-Forster C, Emery-Le M, Hall JC, Rosbash M. Drosophila CRY is a deep brain circadian photoreceptor. Neuron. 2000 May;26(2):493-504. DOI: 10.1016/S0896-6273(00)81181-2. PMID: 10839367.
[koh-2006-jetlag-abstract] Koh K, Zheng X, Sehgal A. JETLAG resets the Drosophila circadian clock by promoting light-induced degradation of TIMELESS. Science. 2006 Jun 23;312(5781):1809-12. DOI: 10.1126/science.1124951. PMID: 16794082.
[collins-2006-transcriptional-repressor-abstract] Collins B, Mazzoni EO, Stanewsky R, Blau J. Drosophila CRYPTOCHROME is a circadian transcriptional repressor. Curr Biol. 2006 Mar 7;16(5):441-9. DOI: 10.1016/j.cub.2006.01.034. PMID: 16527739.
[ozturk-2011-reaction-mechanism-abstract] Ozturk N, Selby CP, Annayev Y, Zhong D, Sancar A. Reaction mechanism of Drosophila cryptochrome. Proc Natl Acad Sci U S A. 2011 Jan 11;108(2):516-21. DOI: 10.1073/pnas.1017093108. PMID: 21187431. PMCID: PMC3021015.
[zoltowski-2011-structure-full-length-abstract] Zoltowski BD, Vaidya AT, Top D, Widom J, Young MW, Bhamboo CR. Structure of full-length Drosophila cryptochrome. Nature. 2011 Dec 7;480(7377):396-9. DOI: 10.1038/nature10618. PMID: 22080955. PMCID: PMC3240699.
[vaidya-2013-photoreduction-abstract] Vaidya AT, Top D, Manahan CC, Tokuda JM, Zhang S, Pollack L, Young MW, Bhamboo CR. Flavin reduction activates Drosophila cryptochrome. Proc Natl Acad Sci U S A. 2013 Dec 10;110(50):20455-60. DOI: 10.1073/pnas.1313336110. PMID: 24297896. PMCID: PMC3864355.
[helfrich-forster-2008-cry-expression-abstract] Yoshii T, Todo T, Wulbeck C, Stanewsky R, Helfrich-Forster C. The blue light photoreceptor CRYPTOCHROME is expressed in a subset of circadian oscillator neurons in the Drosophila CNS. J Comp Neurol. 2008 Aug 20;509(6):650-65. DOI: 10.1002/cne.21773. PMID: 18663237. PMCID: PMC2536721.
[lin-2023-cry-tim-structure-abstract] Lin C, Feng S, DeOliveira CC, Crane BR. Cryptochrome-Timeless structure reveals circadian clock timing mechanisms. Nature. 2023 May;617(7959):194-199. DOI: 10.1038/s41586-023-06009-4. PMID: 37100907. PMCID: PMC11034853.
[foley-2020-variations-blue-abstract] Foley LE, Emery P. Drosophila Cryptochrome: Variations in Blue. J Biol Rhythms. 2020 Feb;35(1):16-27. DOI: 10.1177/0748730419878290. PMID: 31595798. PMCID: PMC7328257.
[busza-2004-novel-photoreception-abstract] Busza A, Emery-Le M, Rosbash M, Emery P. Novel features of cryptochrome-mediated photoreception in the brain circadian clock of Drosophila. J Neurosci. 2004 Feb 11;24(6):1468-77. DOI: 10.1523/JNEUROSCI.3661-03.2004. PMID: 14960621. PMCID: PMC6730330.
The research report should be a detailed narrative explaining the function, biological processes, and localization of the gene product. Citations should be given for all claims.
You should prioritize authoritative reviews and primary scientific literature when conducting research. You can supplement
this with annotations you find in gene/protein databases, but these can be outdated or inaccurate.
We are specifically interested in the primary function of the gene - for enzymes, what reaction is catalyzed, and what is the substrate specificity? For transporters, what is the substrate? For structural proteins or adapters, what is the broader structural role? For signaling molecules, what is the role in the pathway.
We are interested in where in or outside the cell the gene product carries out its function.
We are also interested in the signaling or biochemical pathways in which the gene functions. We are less interested in broad pleiotropic effects, except where these elucidate the precise role.
Include evidence where possible. We are interested in both experimental evidence as well as inference from structure, evolution, or bioinformatic analysis. Precise studies should be prioritized over high-throughput, where available.
The UniProt accession O77059 corresponds to Drosophila melanogaster Cryptochrome-1 (DmCRY; gene symbol cry; ORF CG3772), a Drosophila-type/type I cryptochrome within the DNA photolyase/cryptochrome family that binds FAD and functions primarily as a blue-light photoreceptor for circadian clock entrainment. In the canonical pathway, light-activated CRY binds Timeless (TIM) and triggers TIM degradation via recruitment of the E3 ubiquitin ligase Jetlag (JET), thereby resetting the circadian oscillator. This Drosophila light-sensing role is mechanistically distinct from vertebrate/mammalian-type (type II) cryptochromes, which are described primarily as light-independent transcriptional repressors in the core clock feedback loop. (foley2020drosophilacryptochromevariations pages 1-2, deoliveira2024dualfacetsof pages 1-9, deoliveira2024dualfacetsof pages 35-40)
Cryptochromes are structurally related to UV/blue-sensitive DNA photolyases but generally lack DNA repair activity and instead serve as sensory/signaling proteins. In Drosophila, CRY is best understood as a cell-autonomous circadian photoreceptor. (foley2020drosophilacryptochromevariations pages 1-2)
At the structural level, cryptochromes have a conserved photolyase homology region (PHR) that binds FAD as the principal blue-light chromophore, and a more variable C-terminal region/extension that tunes signaling. A structural review emphasizes a conserved PHR architecture (Rossmann-like Ξ±/Ξ² domain plus Ξ±-helical domain) that positions FAD and provides pockets/surfaces for partner interactions; in Drosophila CRY, the C-terminal segment forms a short C-terminal tail (CTT) that docks into a cavity adjacent to the flavin site. (deoliveira2025astructuraldecryption pages 4-5)
A widely supported mechanistic framework is that blue light drives photoreduction of FAD in DmCRY via a Trp triad/tetrad electron-transfer chain, yielding a reduced flavin state (frequently discussed as an anionic semiquinone, ASQ) and promoting structural rearrangements that propagate signaling. (deoliveira2024dualfacetsof pages 35-40, deoliveira2025astructuraldecryption pages 10-11)
The canonical output of CRY photoreception is light-dependent TIM degradation, which resets the clockβs PER/TIM negative arm and entrains behavioral rhythms to light/dark cycles. Mechanistically, light promotes a CRY conformational change that exposes binding surfaces for TIM and for ubiquitin ligase components. (foley2020drosophilacryptochromevariations pages 2-4, lin2022mechanisticinsightinto pages 1-3)
A core mechanistic model supported by reviews, biophysics, and structural work is:
A quantitative binding study supports the CTT-gating model: WT CRY binds TIM more strongly in light than dark (KD,dark β 32 Β΅M vs KD,light β 9 Β΅M), while CTT deletion yields constitutive high-affinity binding (KD β 1.7 Β΅M). (lin2022mechanisticinsightinto pages 3-6)
A 2023 cryo-EM structure of CRY bound to TIM provides an atomic framework for entrainment signaling. The structure indicates:
For the peer-reviewed Nature cryo-EM dataset (Apr 2023), the reported reconstruction statistics include 3.3 Γ map resolution (2.4β5.5 Γ range) and deposition PDB 8DD7 / EMDB-27335, supporting confidence in residue-level interface interpretation. (lin2023cryptochromeβtimelessstructurereveals pages 9-13)
A 2023 Nature Communications study used single-molecule optical tweezers to resolve a multi-intermediate folding pathway for DmCRY and quantified FAD-dependent steps. FAD binds very rapidly to early folding intermediates with large association rates (e.g., k3 β 2.8Γ10^9 Mβ1Β·sβ1 and k4 β 1.0Γ10^10 Mβ1Β·sβ1) and sub-nanomolar dissociation constants (~0.25β0.29 nM), consistent with diffusion-limited-like binding. At 10 nM FAD, the average folding time was ~30 s, corresponding to an estimated 0.73 probability of folding by 40 s (and an observed ~0.66 folded fraction). (foroutannejad2023thecofactordependentfolding pages 6-7, foroutannejad2023thecofactordependentfolding pages 12-13)
These data support a functional-annotation view in which FAD binding is not only photochemical but also a structural requirement to reach a signaling-competent native fold. (foroutannejad2023thecofactordependentfolding pages 6-7, foroutannejad2023thecofactordependentfolding pages 1-2)
In the canonical fly clock, CRY mediates light input by binding TIM in response to light and promoting TIM degradation via JET/proteasome pathways, thereby resetting the molecular oscillator and entraining behavior. (foley2020drosophilacryptochromevariations pages 1-2, foley2020drosophilacryptochromevariations pages 2-4)
Eyes (photoreceptors): A key compartmental distinction is between CRY pools in photoreceptor rhabdomeres (light-detection compartment) versus cell bodies (soma). In the eye, CRY can localize to rhabdomeres, bind F-actin, and participate in phototransduction-complex organization (see below). (schlichting2018cryptochromeinteractswith pages 1-2, foley2020drosophilacryptochromevariations pages 6-7)
Quantitative imaging in a 2018 study reported that rhabdomeric CRY staining was stable after 2 h of 1000 lux light (not significantly reduced; p = 0.404) and stable between ZT23 and ZT11 (p = 1.0), while somatic/cytoplasmic CRY in photoreceptors was strongly reduced at ZT11 compared with ZT23 (p < 0.001). Approximate signal levels (mean pixel gray) were reported, with somatic CRY reaching ~40 after prolonged darkness and rhabdomeric CRY not exceeding ~25. (schlichting2018cryptochromeinteractswith pages 4-7, schlichting2018cryptochromeinteractswith pages 7-8, schlichting2018cryptochromeinteractswith media 14e384c2)
Clock neurons: CRY is discussed as showing both nuclear and cytoplasmic localization, with nuclear CRY implicated in morning TIM degradation; however, detailed quantification is often attributed to prior work rather than provided directly in the 2024 heterologous-CRY study excerpt. (chen2024functionalanalysesof pages 10-12)
A widely cited review emphasizes that, beyond entrainment, Drosophila CRY contributes to arousal/UV avoidance, visual photoreception, and magnetic field detection, and can influence circadian amplitude through light-independent mechanisms in a tissue-dependent fashion. (foley2020drosophilacryptochromevariations pages 1-2)
Non-canonical CRY signaling includes light/redox-dependent modulation of neuronal excitability, including CRY-dependent photoresponses in arousal-related neurons. Mechanistic models implicate CRY redox chemistry and the KvΞ²-like subunit Hyperkinetic (HK) and K+ channel complexes (EAG/ERG/Shaker-associated), operating independently of TIM in some contexts. (foley2020drosophilacryptochromevariations pages 6-7, foley2020drosophilacryptochromevariations pages 5-6, deoliveira2024dualfacetsof pages 91-97)
In compound eyes, CRY can act as a structural/assembling factor in rhabdomeres: it interacts with actin and is proposed to maintain the phototransduction βsignalplexβ near the membrane, enhancing light sensitivity and thereby contributing to eye-mediated clock light input. This rhabdomeric CRY pool is reported as not degraded by light, consistent with a stable scaffolding role. (schlichting2018cryptochromeinteractswith pages 1-2)
CRY-dependent magnetosensitivity is frequently discussed in Drosophila, with reviews summarizing that cry mutants lose magnetic-field-dependent behaviors and that photochemical mechanisms tied to flavin redox and radical intermediates have been proposed. (foley2020drosophilacryptochromevariations pages 6-7, foley2020drosophilacryptochromevariations pages 10-11)
A 2023 thesis documents experimental implementations expressing full-length DmCRY or its C-terminus in specific neurons (e.g., aCC motor neurons) to test blue-light and magnetic-field sensitivity, and argues that CRYβs C-terminus can be sufficient for magnetic-field effects in that context while also noting assay confounds (e.g., blue-light effects on luciferase reporters). (munro2023investigatingthesensitivity pages 1-5, munro2023investigatingthesensitivity pages 5-9)
A 2024 peer-reviewed study reports that loss of CRY (cry01) alters metabolic physiology, including triglyceride dynamics, starvation resistance, and lifespan. Quantitatively, cry01 flies had significantly higher TG during starvation at multiple time points (e.g., 12β24 h; P < 0.0001) and a substantially increased median survival time to 50% death (70.66 Β± 1.82 days in cry01 vs 40.03 Β± 1.44 days in w1118; P < 0.001). (gopalakrishnan2024arolefor pages 6-7)
The 2023 cryo-EM CRYβTIM structure provides mechanistic clarity for how light can convert CRY into a high-affinity TIM-binding state by CTT displacement and active-site/cofactor-pocket rearrangements, connecting photochemistry to ubiquitin-mediated proteolysis and timing. (lin2023mechanismsofcircadian pages 1-3, lin2023mechanismsofcircadian pages 3-6, lin2023cryptochromeβtimelessstructurereveals pages 9-13)
A 2024 structural review synthesizes evidence that DmCRY activation depends on FAD photoreduction (often via Trp triad/tetrad) and that CTT undocking is coupled to cofactor state and conformational switches, aligning cryo-EM findings with prior spectroscopy/biophysics. (deoliveira2025astructuraldecryption pages 10-11, deoliveira2025astructuraldecryption pages 9-10)
The 2024 G3 study extends functional annotation beyond classical entrainment by providing quantitative phenotypes linking cry to triglyceride utilization and survival under dietary and starvation challenges. (gopalakrishnan2024arolefor pages 6-7, gopalakrishnan2024arolefor pages 1-2)
Cryptochrome-based optogenetic tools widely used in cell and developmental biology typically leverage Arabidopsis CRY2 and its light-dependent binding partner CIB1, exploiting blue-light-induced heterodimerization and CRY2 oligomerization to control signaling and gene expression in engineered systems. A 2024 Scientific Reports paper (Jan 2024) summarizes this principle in the context of developing a blue-light-controlled differentiation tool (Opto-RANK), explicitly noting CRY2βCIB1 binding upon photoexcitation and CRY2 homo-oligomerization as designable behaviors. (takada2024developmentofan pages 1-2)
By contrast, Drosophila CRY is primarily implemented as a native photoreceptor/magnetosensor within circadian/neurobiology research, including behavioral entrainment assays and experimental manipulations of CRY-dependent light responses and proposed magnetic-field effects. The 2023 thesis provides examples of DmCRY implementation in neuronal contexts and discusses limitations relevant to optical readouts and CRY-independent blue-light effects. (munro2023investigatingthesensitivity pages 1-5, munro2023investigatingthesensitivity pages 5-9)
A 2020 expert review by Foley & Emery frames Drosophila CRY as a multi-functional photoreceptor whose best-established role is circadian entrainment via light-dependent TIM degradation, while also emphasizing robust evidence for additional roles in neuronal and sensory physiology (arousal/UV avoidance, visual photoreception, magnetic field detection) and tissue-specific regulation. (foley2020drosophilacryptochromevariations pages 1-2, foley2020drosophilacryptochromevariations pages 6-7)
A 2024 structural review argues that cryptochrome function can be most coherently understood through its conserved PHR/FAD architecture plus divergent C-terminal elements that tune partner recognition and signaling outputs, providing a structural rationale for why type I (fly) and type II (mammalian) CRYs differ strongly in light responsiveness and interaction logic. (deoliveira2025astructuraldecryption pages 4-5, deoliveira2025astructuraldecryption pages 9-10)
cry (CG3772; UniProt O77059) encodes an FAD-binding blue-light photoreceptor (DmCRY) that entrains the Drosophila circadian clock by undergoing light-driven conformational switching (CTT undocking) that enables TIM binding and JET-dependent ubiquitination/proteasomal degradation of TIM; DmCRY also participates in tissue-specific, non-canonical functions including modulation of neuronal excitability/arousal via ion-channel-associated pathways, structural organization of phototransduction complexes in eye rhabdomeres, proposed magnetic-field-dependent behaviors, and metabolic regulation affecting triglyceride utilization and lifespan. (foley2020drosophilacryptochromevariations pages 2-4, lin2023mechanismsofcircadian pages 1-3, schlichting2018cryptochromeinteractswith pages 4-7, foley2020drosophilacryptochromevariations pages 6-7, gopalakrishnan2024arolefor pages 6-7)
| Biological role/process | Mechanism (molecular events) | Key partners/effectors | Subcellular/tissue localization | Key evidence (with brief quantitative detail where available) | Key citations |
|---|---|---|---|---|---|
| Canonical circadian photoreception and clock entrainment | Blue light is absorbed by FAD in DmCRY, driving photoreduction via the Trp tetrad/triad and release of the autoinhibitory C-terminal tail (CTT). Light-state CRY then binds TIM; JET/CUL1 promotes TIM ubiquitination/proteasomal degradation, while BRWD3/Ramshackle-CUL4 contributes to CRY ubiquitination/self-degradation. | FAD, TIM, JET, CUL1, BRWD3/Ramshackle, proteasome | Clock neurons; nuclear and cytoplasmic pools reported, with nuclear CRY implicated in TIM degradation | CRY:TIM cryo-EM map reached 3.3 Γ ; primary interface buries ~1862 Γ Β² on TIM and ~1807 Γ Β² on CRY; TIM ARM1 helix replaces the CRY CTT in the flavin pocket; WT CRY binds TIM more strongly in light than dark (KD ~9 Β΅M light vs ~32 Β΅M dark), whereas CTT-deleted CRY binds constitutively (KD ~1.7 Β΅M) (lin2023mechanismsofcircadian pages 1-3, lin2023mechanismsofcircadian pages 3-6, lin2022mechanisticinsightinto pages 3-6, foley2020drosophilacryptochromevariations pages 2-4) | (foley2020drosophilacryptochromevariations pages 1-2, foley2020drosophilacryptochromevariations pages 2-4, deoliveira2025astructuraldecryption pages 9-10, lin2022mechanisticinsightinto pages 3-6, lin2022mechanisticinsightinto pages 1-3, lin2023mechanismsofcircadian pages 1-3, lin2023mechanismsofcircadian pages 3-6) |
| Structural basis of light-gated TIM recognition | TIM inserts an N-terminal helix into the CRY flavin pocket; CRY phosphate-binding loop (PBL), protrusion motif, C-terminal lid, and Arg residues rearrange around FAD to stabilize the signaling state. Histidines H377/H378 help couple FAD redox chemistry to TIM binding. | TIM ARM repeats, TIM N-terminus, FAD, H377, H378, Arg237/Arg258, PBL | CRY photolyase homology region/flavin pocket | TIM-bound CRY shows FAD adenine shift ~1.5 Γ ; Arg258 replaces a coordinating Mg2+ at the diphosphate region; local density supported TIM insertion at up to ~2.4 Γ local resolution; H377L stabilizes TIM-binding conformation and increases TIM binding in pulldown/SWFTI assays (deoliveira2025astructuraldecryption pages 9-10, lin2023mechanismsofcircadian pages 21-23, lin2023mechanismsofcircadian pages 23-30) | (lin2023mechanismsofcircadian pages 6-8, deoliveira2025astructuraldecryption pages 9-10, deoliveira2024dualfacetsof pages 35-40, deoliveira2025astructuraldecryption pages 10-11, lin2023mechanismsofcircadian pages 21-23, lin2023mechanismsofcircadian pages 23-30) |
| Cofactor-dependent folding/biogenesis | dCRY folds through multiple intermediates; early folding steps are FAD-independent, but later steps require FAD binding to largely unfolded intermediates to reach the native signaling-competent state. | FAD, folding intermediates I1/I2/I3, PHR/CTT regions | Intracellular newly synthesized dCRY protein | Single-molecule analysis resolved five states; FAD association rates were extremely fast, k3 β 2.8Γ10^9 M^-1 s^-1 and k4 β 1.0Γ10^10 M^-1 s^-1, with sub-nanomolar dissociation constants (~0.25β0.29 nM); at 10 nM FAD the average folding time was ~30 s and folding probability by 40 s was ~0.73 (foroutannejad2023thecofactordependentfolding pages 6-7, foroutannejad2023thecofactordependentfolding pages 12-13) | (foroutannejad2023thecofactordependentfolding pages 6-7, foroutannejad2023thecofactordependentfolding pages 1-2, foroutannejad2023thecofactordependentfolding pages 2-3, foroutannejad2023thecofactordependentfolding pages 12-13, foroutannejad2023thecofactordependentfolding pages 5-6) |
| Non-canonical neuronal photoreception: arousal and rapid membrane depolarization | Light-activated/redox-switched CRY modulates KvΞ²-associated potassium-channel signaling, promoting membrane depolarization and firing in light-responsive arousal neurons independently of the canonical TIM-degradation mechanism. | Hyperkinetic (HK/KvΞ²), EAG/ERG/Shaker-family K+ channel complexes, flavin redox chemistry | Large ventrolateral neurons (l-LNvs) and other CRY-positive central brain neurons | Reviews and recent analyses place CRY in light-activated arousal neurons; l-LNv photoresponses require potassium-channel modulation and flavin redox chemistry; cry mutants show defective blue/UV-light arousal and UV avoidance phenotypes (foley2020drosophilacryptochromevariations pages 6-7, foley2020drosophilacryptochromevariations pages 5-6, deoliveira2024dualfacetsof pages 91-97) | (foley2020drosophilacryptochromevariations pages 6-7, foley2020drosophilacryptochromevariations pages 5-6, deoliveira2024dualfacetsof pages 91-97) |
| Eye structural/signaling role: actin/signalplex organization and enhanced circadian photosensitivity | In rhabdomeres, CRY acts as a structural/assembling factor rather than a degradable clock photoreceptor pool; it binds F-actin and light-dependently interacts with the scaffold INAD to help maintain the phototransduction signalplex near the membrane, thereby enhancing eye-mediated clock light input. | F-actin, INAD, NINAC/myosin III, TRP channels, phototransduction signalplex | Compound-eye photoreceptor rhabdomeres and photoreceptor cell bodies | Rhabdomeric CRY staining was unchanged after 2 h of 1000 lux light (p = 0.404) and unchanged between ZT23 and ZT11 (p = 1.0), whereas somatic CRY was lower at ZT11 than ZT23 (p < 0.001); rhabdomeric signal never exceeded mean pixel gray ~25, while somatic signal reached ~40 after prolonged darkness (schlichting2018cryptochromeinteractswith pages 4-7, schlichting2018cryptochromeinteractswith pages 7-8, schlichting2018cryptochromeinteractswith media 14e384c2) | (schlichting2018cryptochromeinteractswith pages 1-2, schlichting2018cryptochromeinteractswith pages 4-7, schlichting2018cryptochromeinteractswith pages 7-8, foley2020drosophilacryptochromevariations pages 6-7, schlichting2018cryptochromeinteractswith media 14e384c2) |
| Magnetosensitivity / magnetic-field-dependent behavior | CRY photochemistry has been proposed to generate radical-pair states after light activation, linking blue/UV light sensing to magnetic-field effects on neuronal signaling and behavior. | FAD radical states, Trp electron-transfer chain, possible superoxide/radical-pair intermediates | CRY-expressing neurons; behavioral output circuits | Reviews summarize that cry mutants lose magnetic-field-dependent learning/behavioral effects and that human CRY2 can rescue some fly magnetic phenotypes; magnetic effects also alter geotaxis/locomotion and seizure-like responses under blue/UV light (foley2020drosophilacryptochromevariations pages 6-7, foley2020drosophilacryptochromevariations pages 9-10, foley2020drosophilacryptochromevariations pages 10-11) | (foley2020drosophilacryptochromevariations pages 6-7, foley2020drosophilacryptochromevariations pages 9-10, foley2020drosophilacryptochromevariations pages 10-11) |
| Metabolic regulation: triglyceride storage, starvation resistance, feeding, lifespan | Beyond light resetting, CRY influences metabolic state and diet-responsive triglyceride utilization, likely through circadian/metabolic coupling rather than a simple acute phototransduction effect. | Circadian clock network, triglyceride/glycogen metabolism pathways, diet-response pathways | Metabolically active tissues including gut and fat body; also peripheral clocks | In cry01 mutants, starvation resistance and TG levels increased under LD and LL; TG remained significantly higher than controls at 12, 15, 18, and 24 h post-starvation (P < 0.0001); median time to 50% death increased to 70.66 Β± 1.82 d in cry01 vs 40.03 Β± 1.44 d in w1118 (P < 0.001) (gopalakrishnan2024arolefor pages 6-7, gopalakrishnan2024arolefor pages 1-2) | (gopalakrishnan2024arolefor pages 1-2, gopalakrishnan2024arolefor pages 6-7) |
| Light-independent modulation of clock amplitude/peripheral clocks | CRY can support molecular rhythm amplitude and peripheral-clock function even outside acute TIM degradation, and can contribute to repression mechanisms in some tissues/contexts. | PER, CLK/CYC, peripheral-clock components | Malpighian tubules, eye, antennae, other peripheral tissues | Reviews summarize tissue-specific light sensitivity and light-independent CRY roles in maintaining oscillation amplitude/peripheral rhythms; effects are context dependent rather than universal across all tissues (foley2020drosophilacryptochromevariations pages 5-6, foley2020drosophilacryptochromevariations pages 1-2, gopalakrishnan2024arolefor pages 1-2) | (foley2020drosophilacryptochromevariations pages 5-6, foley2020drosophilacryptochromevariations pages 1-2, gopalakrishnan2024arolefor pages 1-2) |
Table: This table summarizes the best-supported functional annotation for Drosophila melanogaster Cryptochrome-1 (cry; UniProt O77059), covering canonical circadian entrainment and major non-canonical roles. It highlights mechanisms, partners, localization, and quantitative findings useful for narrative gene-function annotation.
References
(foley2020drosophilacryptochromevariations pages 1-2): Lauren E. Foley and Patrick Emery. Drosophila cryptochrome: variations in blue. Journal of Biological Rhythms, 35:16-27, Feb 2020. URL: https://doi.org/10.1177/0748730419878290, doi:10.1177/0748730419878290. This article has 34 citations and is from a peer-reviewed journal.
(deoliveira2024dualfacetsof pages 1-9): C DeOliveira. Dual facets of drosophila melanogaster cryptochrome: unveiling interactions with jetlag for timeless degradation and β¦. Unknown journal, 2024.
(deoliveira2024dualfacetsof pages 35-40): C DeOliveira. Dual facets of drosophila melanogaster cryptochrome: unveiling interactions with jetlag for timeless degradation and β¦. Unknown journal, 2024.
(deoliveira2025astructuraldecryption pages 4-5): Cristina C. DeOliveira and Brian R. Crane. A structural decryption of cryptochromes. Frontiers in Chemistry, Aug 2024. URL: https://doi.org/10.3389/fchem.2024.1436322, doi:10.3389/fchem.2024.1436322. This article has 18 citations.
(deoliveira2025astructuraldecryption pages 10-11): Cristina C. DeOliveira and Brian R. Crane. A structural decryption of cryptochromes. Frontiers in Chemistry, Aug 2024. URL: https://doi.org/10.3389/fchem.2024.1436322, doi:10.3389/fchem.2024.1436322. This article has 18 citations.
(foley2020drosophilacryptochromevariations pages 2-4): Lauren E. Foley and Patrick Emery. Drosophila cryptochrome: variations in blue. Journal of Biological Rhythms, 35:16-27, Feb 2020. URL: https://doi.org/10.1177/0748730419878290, doi:10.1177/0748730419878290. This article has 34 citations and is from a peer-reviewed journal.
(lin2022mechanisticinsightinto pages 1-3): Changfan Lin, Connor M. Schneps, Siddarth Chandrasekaran, Abir Ganguly, and Brian R. Crane. Mechanistic insight into light-dependent recognition of timeless by drosophila cryptochrome. bioRxiv, Sep 2022. URL: https://doi.org/10.1101/2021.09.10.459772, doi:10.1101/2021.09.10.459772. This article has 29 citations.
(lin2023mechanismsofcircadian pages 1-3): Changfan Lin, Shi Feng, Cristina C. DeOliveira, and Brian R. Crane. Mechanisms of circadian clock timing and entrainment revealed by the structure of cryptochrome bound to timeless. Jan 2023. URL: https://doi.org/10.6084/m9.figshare.22009703, doi:10.6084/m9.figshare.22009703. This article has 1 citations.
(lin2022mechanisticinsightinto pages 3-6): Changfan Lin, Connor M. Schneps, Siddarth Chandrasekaran, Abir Ganguly, and Brian R. Crane. Mechanistic insight into light-dependent recognition of timeless by drosophila cryptochrome. bioRxiv, Sep 2022. URL: https://doi.org/10.1101/2021.09.10.459772, doi:10.1101/2021.09.10.459772. This article has 29 citations.
(lin2023mechanismsofcircadian pages 3-6): Changfan Lin, Shi Feng, Cristina C. DeOliveira, and Brian R. Crane. Mechanisms of circadian clock timing and entrainment revealed by the structure of cryptochrome bound to timeless. Jan 2023. URL: https://doi.org/10.6084/m9.figshare.22009703, doi:10.6084/m9.figshare.22009703. This article has 1 citations.
(lin2023mechanismsofcircadian pages 23-30): Changfan Lin, Shi Feng, Cristina C. DeOliveira, and Brian R. Crane. Mechanisms of circadian clock timing and entrainment revealed by the structure of cryptochrome bound to timeless. Jan 2023. URL: https://doi.org/10.6084/m9.figshare.22009703, doi:10.6084/m9.figshare.22009703. This article has 1 citations.
(lin2023cryptochromeβtimelessstructurereveals pages 9-13): Changfan Lin, Shi Feng, Cristina C. DeOliveira, and Brian R. Crane. Cryptochromeβtimeless structure reveals circadian clock timing mechanisms. Nature, 617:194-199, Apr 2023. URL: https://doi.org/10.1038/s41586-023-06009-4, doi:10.1038/s41586-023-06009-4. This article has 55 citations and is from a highest quality peer-reviewed journal.
(foroutannejad2023thecofactordependentfolding pages 6-7): Sahar Foroutannejad, Lydia L. Good, Changfan Lin, Zachariah I. Carter, Mahlet G. Tadesse, Aaron L. Lucius, Brian R. Crane, and Rodrigo A. Maillard. The cofactor-dependent folding mechanism of drosophila cryptochrome revealed by single-molecule pulling experiments. Nature Communications, Feb 2023. URL: https://doi.org/10.1038/s41467-023-36701-y, doi:10.1038/s41467-023-36701-y. This article has 10 citations and is from a highest quality peer-reviewed journal.
(foroutannejad2023thecofactordependentfolding pages 12-13): Sahar Foroutannejad, Lydia L. Good, Changfan Lin, Zachariah I. Carter, Mahlet G. Tadesse, Aaron L. Lucius, Brian R. Crane, and Rodrigo A. Maillard. The cofactor-dependent folding mechanism of drosophila cryptochrome revealed by single-molecule pulling experiments. Nature Communications, Feb 2023. URL: https://doi.org/10.1038/s41467-023-36701-y, doi:10.1038/s41467-023-36701-y. This article has 10 citations and is from a highest quality peer-reviewed journal.
(foroutannejad2023thecofactordependentfolding pages 1-2): Sahar Foroutannejad, Lydia L. Good, Changfan Lin, Zachariah I. Carter, Mahlet G. Tadesse, Aaron L. Lucius, Brian R. Crane, and Rodrigo A. Maillard. The cofactor-dependent folding mechanism of drosophila cryptochrome revealed by single-molecule pulling experiments. Nature Communications, Feb 2023. URL: https://doi.org/10.1038/s41467-023-36701-y, doi:10.1038/s41467-023-36701-y. This article has 10 citations and is from a highest quality peer-reviewed journal.
(schlichting2018cryptochromeinteractswith pages 1-2): Matthias Schlichting, Dirk Rieger, Paola Cusumano, Rudi Grebler, Rodolfo Costa, Gabriella M. Mazzotta, and Charlotte Helfrich-FΓΆrster. Cryptochrome interacts with actin and enhances eye-mediated light sensitivity of the circadian clock in drosophila melanogaster. Frontiers in Molecular Neuroscience, Jul 2018. URL: https://doi.org/10.3389/fnmol.2018.00238, doi:10.3389/fnmol.2018.00238. This article has 24 citations.
(foley2020drosophilacryptochromevariations pages 6-7): Lauren E. Foley and Patrick Emery. Drosophila cryptochrome: variations in blue. Journal of Biological Rhythms, 35:16-27, Feb 2020. URL: https://doi.org/10.1177/0748730419878290, doi:10.1177/0748730419878290. This article has 34 citations and is from a peer-reviewed journal.
(schlichting2018cryptochromeinteractswith pages 4-7): Matthias Schlichting, Dirk Rieger, Paola Cusumano, Rudi Grebler, Rodolfo Costa, Gabriella M. Mazzotta, and Charlotte Helfrich-FΓΆrster. Cryptochrome interacts with actin and enhances eye-mediated light sensitivity of the circadian clock in drosophila melanogaster. Frontiers in Molecular Neuroscience, Jul 2018. URL: https://doi.org/10.3389/fnmol.2018.00238, doi:10.3389/fnmol.2018.00238. This article has 24 citations.
(schlichting2018cryptochromeinteractswith pages 7-8): Matthias Schlichting, Dirk Rieger, Paola Cusumano, Rudi Grebler, Rodolfo Costa, Gabriella M. Mazzotta, and Charlotte Helfrich-FΓΆrster. Cryptochrome interacts with actin and enhances eye-mediated light sensitivity of the circadian clock in drosophila melanogaster. Frontiers in Molecular Neuroscience, Jul 2018. URL: https://doi.org/10.3389/fnmol.2018.00238, doi:10.3389/fnmol.2018.00238. This article has 24 citations.
(schlichting2018cryptochromeinteractswith media 14e384c2): Matthias Schlichting, Dirk Rieger, Paola Cusumano, Rudi Grebler, Rodolfo Costa, Gabriella M. Mazzotta, and Charlotte Helfrich-FΓΆrster. Cryptochrome interacts with actin and enhances eye-mediated light sensitivity of the circadian clock in drosophila melanogaster. Frontiers in Molecular Neuroscience, Jul 2018. URL: https://doi.org/10.3389/fnmol.2018.00238, doi:10.3389/fnmol.2018.00238. This article has 24 citations.
(chen2024functionalanalysesof pages 10-12): Chenghao Chen, T. Katherine Tamai, Min Xu, Libero Petrone, Paola Oliveri, David Whitmore, and Ralf Stanewsky. Functional analyses of four cryptochromes from aquatic organisms after heterologous expression in drosophila melanogaster circadian clock cells. Journal of Biological Rhythms, 39:365-378, Mar 2024. URL: https://doi.org/10.1177/07487304241228617, doi:10.1177/07487304241228617. This article has 3 citations and is from a peer-reviewed journal.
(foley2020drosophilacryptochromevariations pages 5-6): Lauren E. Foley and Patrick Emery. Drosophila cryptochrome: variations in blue. Journal of Biological Rhythms, 35:16-27, Feb 2020. URL: https://doi.org/10.1177/0748730419878290, doi:10.1177/0748730419878290. This article has 34 citations and is from a peer-reviewed journal.
(deoliveira2024dualfacetsof pages 91-97): C DeOliveira. Dual facets of drosophila melanogaster cryptochrome: unveiling interactions with jetlag for timeless degradation and β¦. Unknown journal, 2024.
(foley2020drosophilacryptochromevariations pages 10-11): Lauren E. Foley and Patrick Emery. Drosophila cryptochrome: variations in blue. Journal of Biological Rhythms, 35:16-27, Feb 2020. URL: https://doi.org/10.1177/0748730419878290, doi:10.1177/0748730419878290. This article has 34 citations and is from a peer-reviewed journal.
(munro2023investigatingthesensitivity pages 1-5): A Munro. Investigating the sensitivity of drosophila cryptochrome to blue light and magnetic fields. Unknown journal, 2023.
(munro2023investigatingthesensitivity pages 5-9): A Munro. Investigating the sensitivity of drosophila cryptochrome to blue light and magnetic fields. Unknown journal, 2023.
(gopalakrishnan2024arolefor pages 6-7): Swetha Gopalakrishnan, Sanjay Ramnarayan Yadav, and Nisha N. Kannan. A role for the circadian photoreceptor cryptochrome in regulating triglyceride metabolism in drosophila. G3: Genes | Genomes | Genetics, Sep 2024. URL: https://doi.org/10.1093/g3journal/jkae220, doi:10.1093/g3journal/jkae220. This article has 5 citations.
(deoliveira2025astructuraldecryption pages 9-10): Cristina C. DeOliveira and Brian R. Crane. A structural decryption of cryptochromes. Frontiers in Chemistry, Aug 2024. URL: https://doi.org/10.3389/fchem.2024.1436322, doi:10.3389/fchem.2024.1436322. This article has 18 citations.
(gopalakrishnan2024arolefor pages 1-2): Swetha Gopalakrishnan, Sanjay Ramnarayan Yadav, and Nisha N. Kannan. A role for the circadian photoreceptor cryptochrome in regulating triglyceride metabolism in drosophila. G3: Genes | Genomes | Genetics, Sep 2024. URL: https://doi.org/10.1093/g3journal/jkae220, doi:10.1093/g3journal/jkae220. This article has 5 citations.
(takada2024developmentofan pages 1-2): Aiko Takada, Toshifumi Asano, Ken-ichi Nakahama, Takashi Ono, Takao Nakata, and Tomohiro Ishii. Development of an optogenetics tool, opto-rank, for control of osteoclast differentiation using blue light. Scientific Reports, Jan 2024. URL: https://doi.org/10.1038/s41598-024-52056-w, doi:10.1038/s41598-024-52056-w. This article has 6 citations and is from a peer-reviewed journal.
(lin2023mechanismsofcircadian pages 21-23): Changfan Lin, Shi Feng, Cristina C. DeOliveira, and Brian R. Crane. Mechanisms of circadian clock timing and entrainment revealed by the structure of cryptochrome bound to timeless. Jan 2023. URL: https://doi.org/10.6084/m9.figshare.22009703, doi:10.6084/m9.figshare.22009703. This article has 1 citations.
(lin2023mechanismsofcircadian pages 6-8): Changfan Lin, Shi Feng, Cristina C. DeOliveira, and Brian R. Crane. Mechanisms of circadian clock timing and entrainment revealed by the structure of cryptochrome bound to timeless. Jan 2023. URL: https://doi.org/10.6084/m9.figshare.22009703, doi:10.6084/m9.figshare.22009703. This article has 1 citations.
(foroutannejad2023thecofactordependentfolding pages 2-3): Sahar Foroutannejad, Lydia L. Good, Changfan Lin, Zachariah I. Carter, Mahlet G. Tadesse, Aaron L. Lucius, Brian R. Crane, and Rodrigo A. Maillard. The cofactor-dependent folding mechanism of drosophila cryptochrome revealed by single-molecule pulling experiments. Nature Communications, Feb 2023. URL: https://doi.org/10.1038/s41467-023-36701-y, doi:10.1038/s41467-023-36701-y. This article has 10 citations and is from a highest quality peer-reviewed journal.
(foroutannejad2023thecofactordependentfolding pages 5-6): Sahar Foroutannejad, Lydia L. Good, Changfan Lin, Zachariah I. Carter, Mahlet G. Tadesse, Aaron L. Lucius, Brian R. Crane, and Rodrigo A. Maillard. The cofactor-dependent folding mechanism of drosophila cryptochrome revealed by single-molecule pulling experiments. Nature Communications, Feb 2023. URL: https://doi.org/10.1038/s41467-023-36701-y, doi:10.1038/s41467-023-36701-y. This article has 10 citations and is from a highest quality peer-reviewed journal.
(foley2020drosophilacryptochromevariations pages 9-10): Lauren E. Foley and Patrick Emery. Drosophila cryptochrome: variations in blue. Journal of Biological Rhythms, 35:16-27, Feb 2020. URL: https://doi.org/10.1177/0748730419878290, doi:10.1177/0748730419878290. This article has 34 citations and is from a peer-reviewed journal.
Cryptochrome (CRY), encoded by the cry gene (FlyBase: FBgn0025680) in Drosophila melanogaster, serves as the primary blue light-sensitive circadian photoreceptor, functioning as a critical regulator of circadian rhythm entrainment and resetting through light-dependent protein-protein interactions and ubiquitin-mediated proteolysis. The discovery of cryptochrome fundamentally changed the understanding of how organisms perceive light for temporal regulation, revealing that a single specialized photoreceptor protein, rather than the visual system, mediates light input to the circadian clock in the fruit fly. This protein acts as a flavoprotein photoreceptor that undergoes conformational changes upon light absorption, triggering a cascade of molecular events that degrade the core clock protein Timeless and ultimately reset the phase of the circadian oscillator. Beyond its canonical role in circadian photoreception, cryptochrome has emerged as a multifunctional protein with roles in magnetoreception, neuronal physiology, and metabolic regulation, making it one of the most versatile signaling proteins in the Drosophila proteome. The structural architecture of cryptochrome, featuring a photolyase homology region that binds a flavin adenine dinucleotide cofactor and a variable C-terminal extension, enables both light-dependent signaling and protein-protein interactions essential for circadian clock function. Understanding cryptochrome biology has provided molecular insights into how organisms synchronize internal biological rhythms with external light-dark cycles and has revealed broader principles of how conformational changes in flavoproteins can propagate biological signals.
The identification of cryptochrome as the primary circadian photoreceptor in Drosophila resolved a long-standing paradox in circadian biology.[3] Classical studies had demonstrated that blind flies, including eyeless mutants such as norpA and glass that lack functional visual photoreceptors, maintained the ability to entrain their behavioral rhythms to light-dark cycles.[9] This observation suggested the existence of a photoreceptor independent from the visual system. The breakthrough came through genetic analysis of circadian behavioral mutants, where researchers identified a mutant with reduced light sensitivity of the circadian clock. This mutation mapped to a previously uncharacterized locus named cryptochrome (cry), derived from its cryptic, non-visual function in light perception.[9] The corresponding gene product, when cloned and characterized, revealed homology to photolyase, the light-dependent DNA repair enzyme, suggesting that cryptochrome was an evolutionarily related but functionally distinct flavoprotein capable of light sensing.[9] Initial studies demonstrated that cry mutant flies, particularly the crybaby (cry^b^) strain with a defect in the flavin adenine dinucleotide binding site, exhibited severely attenuated light-dependent reductions in Timeless protein levels and showed reduced ability to reset their circadian phase in response to light pulses.[3][6] The seminal finding that cry transcription is itself under circadian control, regulated by the core clock genes period, timeless, Clock, and cycle, provided evidence that cryptochrome is an integral component of the circadian timing system rather than simply an external input channel.[54]
The genetic evidence was complemented by studies showing that overexpression of cryptochrome increased circadian photosensitivity, directly linking the abundance of this protein to the light-resetting capacity of the clock.[54] Expression analysis revealed that cryptochrome protein levels are dramatically affected by light exposure, with the protein being rapidly degraded upon light activation.[3][7] These observations established that cryptochrome functions not merely as a static photoreceptor but as a dynamic, light-regulated component of the circadian system that transduces light signals into molecular changes that reset circadian phase. The discovery of cryptochrome in Drosophila proved generalizable, as cryptochrome homologs were subsequently identified in plants, where they function as blue light receptors regulating phototropism and flowering, and in vertebrates, where cryptochrome proteins play distinct roles in circadian clock regulation as transcriptional repressors independent of light sensing.[9][47]
The structural organization of Drosophila cryptochrome reflects its evolutionary relationship to DNA photolyases while exhibiting specialized modifications that enable its function as a circadian photoreceptor.[31][34] The protein comprises approximately 538 amino acids organized into two primary structural domains. The N-terminal photolyase homology region (PHR) domain consists of an Ξ±/Ξ² subdomain and an Ξ±-helical subdomain that together form the core of the protein and serve as the binding pocket for the essential flavin adenine dinucleotide (FAD) cofactor.[31][34] The Ξ±/Ξ² subdomain adopts a Rossmann fold characteristic of nucleotide-binding proteins, while the Ξ±-helical domain, comprising approximately 14 Ξ±-helices and two 3ββ-helices, provides much of the structural scaffold around which FAD is positioned.[34] Within the Ξ±-helical domain sits a critical 4-helix bundle (Ξ±13-Ξ±16, residues 360-423) that directly binds the isoalloxazine ring of FAD at its center.[34] The C-terminal tail (CTT), a 20-amino-acid Ξ±-helical extension unique among animal cryptochromes, plays a crucial autoinhibitory role by occupying the FAD binding pocket in the dark, resting state.[34][36]
The FAD cofactor, bound non-covalently to cryptochrome in the dark state as an oxidized form (FAD_ox), serves as the light-harvesting chromophore that initiates the photochemical cascade leading to signal transduction.[6][30][33] Upon light absorption, particularly in the ultraviolet-A (365 nm) and blue (450 nm) spectral regions that correspond to the action spectrum of cryptochrome,[1][6] the excited FAD undergoes photoreduction to form an anionic semiquinone radical state (FADβ’β) through intraprotein electron transfer.[6][14][30] This photoreduction process involves an electron transfer chain composed of four conserved tryptophan residues arranged sequentially through the protein structure, termed the Trp-tetrad or "Trp molecular wire."[17][37] The three classical tryptophans comprising the Trp-triad (W342, W397, and W420, ranked from farthest to closest to the FAD binding site) were initially characterized as mediating electron transfer, with a fourth tryptophan subsequently identified as part of the complete electron transfer chain.[17] The W420 tryptophan residue located closest to the FAD-dCRY interaction site appears particularly critical for light-evoked electrophysiological responses, while the more distal W342 residue plays a specific role in circadian photoentrainment of locomotor activity rhythm.[17] During this electron transfer, balanced deprotonation of solvent-exposed tryptophans down the chain occurs, maintaining charge neutrality throughout the process.[6][17][37]
The phosphate-binding loop (PBL, residues 249-263) and the protrusion motif (PM, residues 288-306), two structurally divergent elements among cryptochrome homologs, sit adjacent to the primary FAD binding pocket and undergo substantial conformational rearrangement upon light activation.[34] In the dark state, these elements are relatively structured and maintain the positioning of the oxidized FAD cofactor. Upon light-induced conformational changes, the PBL undergoes dramatic rearrangement that alters hydrogen bonding interactions with the cofactor and facilitates the displacement of the CTT from the pocket.[12][34][55] This structural plasticity of the PBL represents a key mechanistic step in light-dependent signal transduction, as the repositioned PBL overlaps with the CTT in the light state, effectively forcing the CTT to disengage from the pocket and allowing access for downstream partner proteins.[12][55] The ser-rich extended C-terminal lid (residues 420-446) contributes to forming the cavity adjacent to the flavin where the CTT normally resides in darkness.[34]
The surface topology of cryptochrome, particularly the presence of a large FAD-access cavity compared to homologous photolyases, reflects functional specialization for protein-protein interactions rather than DNA substrate recognition.[31] In contrast to photolyases, which possess a positively charged groove on their surface to accommodate phosphate groups of DNA, cryptochrome lacks this feature and instead possesses a negatively charged surface, explaining its inability to bind and repair DNA lesions.[31] The unique cavity architecture, rendered deeper by the substitution of smaller amino acid side chains compared to photolyase, creates a chemical environment suited for protein recognition and binding rather than DNA substrate accommodation.[31]
The primary function of cryptochrome resides in its role as a light-input transducer for the Drosophila circadian oscillator, a function that operates through a precisely orchestrated molecular pathway centered on the light-dependent degradation of the core clock protein Timeless (TIM).[20][46] The Drosophila circadian system operates on the basis of a transcriptional-translational feedback loop (TTFL) composed of positive regulators (CLOCK and CYCLE, CLK/CYC) and negative regulators (Period and Timeless, PER/TIM).[11][46] The CLK/CYC heterodimer binds to E-box sequences in the promoters of period and timeless genes, driving their transcription during the late day.[46] As PER and TIM proteins accumulate in the cytoplasm during the early night, they form a heterodimer and translocate to the nucleus, where they bind to CLK/CYC, blocking its transcriptional activity and initiating the repressive phase of the oscillator.[46] This repressive phase persists until PER and TIM are degraded during the early day, allowing CLK/CYC to recommence transcription and complete one circadian cycle.[46]
Light input into this system is mediated through cryptochrome's ability to sense blue light and trigger the rapid degradation of TIM, thereby advancing the phase of the clock relative to the light-dark cycle.[8] Upon light exposure, cryptochrome undergoes the conformational change described above, with displacement of its CTT from the FAD binding pocket.[12][36] This conformational change dramatically increases the affinity of cryptochrome for its heterodimeric partner protein, Timeless, allowing the formation of a CRY:TIM complex.[8][12] The interaction between CRY and TIM is extensive, involving more than 2300 Ε² of buried surface area, with the principal contact point being the 16-residue N-terminal helix of the first armadillo repeat of TIM, which accounts for approximately 970 Ε² of the interface.[12][55] Remarkably, the TIM N-terminal helix replaces the CTT within the CRY FAD binding pocket in the light-activated complex, essentially inserting itself into the same cavity that autoinhibits CRY in the dark state.[12][55] This competitive mechanism suggests that light-induced displacement of the CTT creates a binding site for TIM recognition.
The interaction between CRY and TIM has been demonstrated to be light-dependent in multiple experimental systems, with fluorescent peptide binding assays and double electron electron resonance spectroscopy revealing that even an isolated peptide composed of the TIM N-terminal sequence exhibits enhanced binding to CRY when the photoreceptor is photoactivated.[12][55] The specificity of this interaction is further highlighted by the finding that TIM isoform variants affect light sensitivity. Drosophila produce a long isoform of TIM (L-TIM) that contains 23 additional N-terminal residues in response to varied light conditions at different latitudes, and this L-TIM interacts more weakly with CRY than short TIM (S-TIM), resulting in reduced photosensitivity of the clock.[12][45] This adaptive variant may represent a molecular mechanism by which populations at higher latitudes, exposed to more extreme light cycles, have evolved reduced light sensitivity to maintain stable circadian periods.[12][45]
Following CRY:TIM complex formation, the E3 ubiquitin ligase Jetlag (JET), an F-box protein with leucine-rich repeats, recognizes this complex and catalyzes the ubiquitination of both CRY and TIM.[20][23] The conformational change in CRY triggered by light exposure increases its affinity for JET, and in cell culture systems reconstituting this pathway, expression of both JET and CRY is necessary and sufficient to confer light-dependent degradation of TIM.[20] Mutation of the jetlag gene results in flies with severely reduced light sensitivity of the circadian clock, characterized by prolonged re-entrainment times to shifted light-dark cycles and reduced light-dependent degradation of TIM, demonstrating that JET is essential for light-mediated phase shifts.[20] JET functions in a highly specific manner, promoting ubiquitination and degradation of TIM and CRY while leaving other core clock proteins such as PER unaffected, suggesting that the CRY:TIM complex presentation to JET creates a selective recognition surface.[20] Additionally, another E3 ligase complex, the CRL4 complex containing BRWD3 (also known as Ramshackle), mediates a separate ubiquitination event targeting CRY itself for proteasomal degradation in a light-dependent manner.[38][41] This dual targeting of both TIM and CRY to ubiquitin-dependent degradation represents an elegant regulatory strategy, where TIM degradation causes the immediate phase shift of the clock, while the slower degradation of CRY desensitizes the photoreception system to prevent excessive light responses.
The temporal dynamics of this light-dependent signaling are critical for its physiological function. Upon even a millisecond pulse of light, cryptochrome undergoes conformational changes that persist for approximately 15-30 minutes in the dark at physiological temperatures, creating an extended signaling window during which the protein can interact with downstream partners.[8][14][30] This prolonged signaling state, rather than a rapidly extinguished photochemical response, provides a mechanistic basis for the robust light-dependent phase shifts observed in fly behavior even with brief light pulses, and helps explain the ability of the system to integrate light information over short time windows. The redox state of the FAD cofactor appears to be uncoupled from the stability of the signaling conformation, as both oxidized and reduced forms of cryptochrome can mediate photosignaling, suggesting that the critical event is not the sustained reduction of the flavin but rather the conformational changes it initiates.[8][30]
The mechanism by which light absorption by the FAD chromophore leads to the coordinated conformational changes observable at the whole-protein level has been elucidated through complementary biophysical, biochemical, and computational approaches.[36][37] Molecular dynamics simulations combined with experimental biophysical characterization have revealed that light-induced photoreduction of the FAD cofactor disrupts a conserved salt bridge between Arg381 and Asp410, located in close proximity to the flavin binding site.[36] The disruption of this salt bridge initiates a network of global protein fluctuations that propagates conformational changes from the local environment of the flavin cofactor throughout the protein structure, ultimately leading to the disengagement of the CTT from its binding site and the helix-to-coil structural transition of the CTT from an ordered helical state to a disordered conformation.[36] These conformational transitions occur on multiple timescales, with initial disruption of hydrophobic contacts between the CTT and the PHR binding pocket occurring on a microsecond timescale, followed by the slower order-to-disorder transition of the CTT itself on a millisecond timescale.[36]
The signaling state of cryptochrome induced by light activation is characterized by increased flexibility of the protein, evidenced by increased root mean square fluctuations throughout the structure, particularly in the C-terminal domain.[36] In contrast, the dark-resting state shows modest fluctuations primarily in the C-terminal domain consistent with the bound CTT remaining stable.[36] The light-activated signaling state exhibits an increased radius of gyration along with reduction in Ξ²-sheet content and the aforementioned disordered CTT conformation, all of which align with spectroscopic and X-ray scattering experimental evidence.[36]
The complete mechanism reconciles two competing models that have been proposed in the literature. In one model, the ground-state cryptochrome contains oxidized FAD (FAD_ox), and light absorption and subsequent photoreduction to FADβ’β coupled with a conformational change in CRY generates the signaling state (CRYβ‘).[30] In an alternative model, cryptochrome contains FADβ’β in the resting dark state, and excitation of this pre-reduced flavin to (FADβ’β)* by light causes the conformational change responsible for signaling.[30] Experimental evidence from proteolytic sensitivity assays and from observations that chemically reduced CRY (with FADβ’β) shows enhanced conformational flexibility comparable to light-activated CRY demonstrates that both oxidized and reduced forms of cryptochrome are capable of photosignaling, with the critical event appearing to be the excitation of the flavin chromophore rather than its absolute redox state.[8][30] The decay of the signaling state conformation back to the ground state is not mechanistically coupled with a change in the oxidation state of the FAD, allowing the protein to return to a dark state with either oxidized or reduced FAD depending on the cellular redox environment and the availability of reductants in the protein microenvironment.[30]
An intriguing finding from recent electrophysiological studies is that light-activated dCRY in neurons may express a FADHβ’ neutral semiquinone state flavin capable of absorbing red light (630 nm) and signaling electrophysiological responses, despite red light being outside the traditional action spectrum of cryptochrome measured through biochemical assays in vitro.[37][49] This suggests that the neuronal context and potential interactions with binding partners may stabilize radical pair species or alternative flavin redox states not observed in purified protein preparations, representing an important caveat regarding the extrapolation from in vitro to in vivo photochemical mechanisms.[37][49]
While the light-dependent interaction with Timeless represents the canonical and best-characterized function of cryptochrome in circadian clock regulation, the protein participates in additional protein-protein interactions that reveal broader roles in circadian system organization and function.[15] Using proximity-dependent biotinylation techniques combining engineered biotin ligases (TurboID and APEX2) with mass spectrometry, researchers have identified an extensive cryptochrome interactome in Drosophila S2 cells, uncovering several novel protein-protein interactions beyond those with the core clock components.[15] These novel interactions suggest the potential of cryptochrome to reveal additional circadian clock-dependent or magnetic field-dependent protein interactions, indicating that the full functional scope of cryptochrome extends beyond the light-triggered degradation of Timeless.[15]
In addition to its role in the central oscillator, cryptochrome functions as a core component of peripheral oscillators within metabolically active tissues. Recent studies have demonstrated that cryptochrome maintains oscillator function in peripheral clocks independently of light input, acting cell-autonomously to sustain circadian transcriptional regulation within tissues such as the fat body.[11][21] The expression of cryptochrome in multiple tissues beyond the brain clock neurons, including the gut, fat body, and photoreceptor cells, positions it as a broadly expressed temporal regulator capable of entraining local tissue rhythms to both light and possibly other circadian signals emanating from the central clock.[18][57]
The circadian expression pattern of cryptochrome itself displays an interesting regulatory architecture. Cryptochrome messenger RNA cycles with a peak at approximately circadian time 5 (ZT5), similar to the phase of Clock (Clk) mRNA cycling in Drosophila.[57] Analysis of the regulatory elements controlling this rhythmic expression has revealed that the first intron of the cry gene contains elements sufficient for high-amplitude mRNA cycling in peripheral tissues such as eyes and antennae, while upstream sequences of the cry gene contain distinct regulatory elements sufficient for expression in brain oscillator neurons.[57] This dissociation of spatial and circadian regulatory elements suggests that cryptochrome expression is regulated by distinct transcriptional mechanisms in different tissues and cell types, allowing for tissue-specific modulation of circadian photosensitivity.[57] The cycling of cryptochrome transcription itself, regulated by the same core clock genes that control per and tim transcription, creates a feedback loop where the photoreceptor abundance oscillates in synchrony with other core clock components, potentially allowing the system to modulate its light sensitivity over the circadian cycle.
Understanding where cryptochrome localizes within cells and tissues provides crucial insight into how light signals are detected and transduced within the circadian system.[7][57] In clock neurons of the Drosophila brain, cryptochrome shows circadian variation in its subcellular localization. Under light-dark entrained conditions, cryptochrome shows both nuclear and cytoplasmic accumulation within clock neurons, with the pattern of distribution varying across the circadian cycle.[7] Specifically, in the small and large ventral lateral neuron clock neurons (s-LNvs and l-LNvs), cryptochrome exhibits an 8-fold amplitude cycling pattern in protein levels, with low levels during the day and a peak at circadian time 23 (ZT23).[7] Remarkably, cryptochrome mRNA levels show the inverse patternβhigh during the dayβindicating that post-translational regulation plays a major role in controlling cryptochrome protein abundance.[7] Constant darkness causes cryptochrome protein levels to increase continuously, suggesting that light actively drives cryptochrome degradation, consistent with the light-dependent proteolytic degradation of cryptochrome through the CRL4/BRWD3 ubiquitin ligase pathway.[7][38]
In the Drosophila photoreceptor cells, particularly in response to prolonged darkness, cryptochrome accumulates extensively along the axons of photoreceptors R7 and R8 within the medulla of the visual system.[7] This unusual subcellular localization in peripheral photoreceptor cells, distinct from its distribution in central clock neurons, suggests that cryptochrome may have specialized functions related to light adaptation in the visual system beyond its well-characterized circadian roles.[7] The expression in putative glial cells of the brain during constant darkness further suggests roles for cryptochrome in non-neuronal cell types, possibly in support of circadian oscillator function at the level of the neural-glial interface.[7]
Electron microscopic and immunohistochemical studies have localized cryptochrome most strongly to lateral regions of the central nervous system near the ventral group of clock neurons, which corresponds to the position of the small and large ventral lateral neuron pacemakers.[7] The dorsal lateral neurons (LNds), a subset of which express cryptochrome, show more extensive innervation patterns within the dorsal and ventral brain compared to the PDF-positive ventral neurons, creating a complex neural circuit architecture for circadian timing.[24][27][28]
While the canonical role of cryptochrome is light-induced resetting of the circadian oscillator through Timeless degradation, electrophysiological studies have revealed that cryptochrome mediates additional cellular responses operating through distinct molecular mechanisms and occurring on different timescales.[6][17][37][40] Light exposure triggers rapid depolarization of neuronal membranes and increased action potential firing frequency in lateral ventral neurons expressing cryptochrome, responses that occur within milliseconds to tens of milliseconds following blue or ultraviolet light exposure.[6][17][37] These electrophysiological responses are long-lasting, persisting for up to a minute following light stimulation, and occur even in the genetic absence of Timeless and in cryptochrome mutants lacking the C-terminus, indicating that these electrical effects are mechanistically distinct from the light-dependent conformational changes that trigger Timeless degradation and circadian phase shifting.[6][17][37]
The W420 tryptophan residue closest to the FAD-dCRY interaction site is critical for blue and ultraviolet-light-evoked electrophysiological responses, while mutations of the more distant W342 tryptophan mimic the cry-null behavioral light response to constant light exposure, demonstrating that light-evoked electrical depolarization and clock resetting are mediated by distinct mechanisms involving different components of the electron transfer chain.[6][17][37] This distinction suggests that the electron transfer chain in cryptochrome may couple to multiple downstream signaling pathways, with proximal electron transfer steps (W420) controlling neuronal membrane depolarization and more distal steps controlling conformational changes that lead to Timeless binding.[37]
The molecular mechanism coupling light-activated cryptochrome flavin photoreduction to neuronal depolarization remains incompletely understood but likely involves conformational changes that alter the interaction of cryptochrome with ion channels or other membrane proteins.[40] The long duration of these electrophysiological effects, persisting for periods extending beyond the light exposure, suggests that the conformational changes in cryptochrome are sufficiently stable to maintain downstream signaling for extended periods, distinguishing these responses from classical rapid photoreceptor responses mediated by visual opsins, which typically recover to baseline within milliseconds.[37]
The spatial distribution of cryptochrome expression across Drosophila tissues extends beyond its roles in the central circadian clock, positioning this protein as a widely distributed temporal signal. Cryptochrome is highly expressed in metabolically active tissues including the gut, fat body, and insulin-producing cells within the pars intercerebralis, tissues central to nutrient sensing and energy homeostasis.[11][18][21] The expression of cryptochrome in these peripheral metabolic tissues, coupled with evidence that cryptochrome maintains peripheral circadian oscillator function independently of light input in some contexts, suggests that this protein coordinates temporal regulation of metabolism with light-dependent and circadian signals.[11][18][21][43] Recent metabolic studies demonstrate that cry mutations result in significantly increased food intake and glycogen concentrations under light-dark cycles, along with effects on triglyceride levels in response to caloric restriction and high-fat diets, suggesting a direct role for the circadian photoreceptor cryptochrome in governing lipid and carbohydrate metabolism beyond its canonical clock-resetting function.[18][43]
The deep brain localization of cryptochrome, expressed in the ventral lateral neurons and dorsal lateral neurons of the circadian clock circuit, positions it as a key node integrating light information within the neural circuit that generates circadian behavioral rhythms.[24][27][28] The discovery that some lateral neurons express both cryptochrome and the neuropeptide receptors for pigment dispersing factor (PDF), the key output neuropeptide of the circadian pacemaker, creates opportunities for these neurons to both receive light input through cryptochrome and coordinate with other pacemaker neurons through neuropeptide signaling.[28][29]
The function of cryptochrome cannot be fully understood in isolation from the broader circadian neural circuit and the transcriptional-translational feedback loops in which it operates.[25][26] The circadian pacemaker network of Drosophila comprises approximately 150 clock neurons in the brain, organized into distinct groups including the small and large ventral lateral neurons (s-LNvs and l-LNvs), which express the neuropeptide PDF and serve as morning-phase oscillators, and the dorsal lateral neurons (LNds) and dorsal neurons (DNs), which contribute to evening-phase oscillator function and show more complex connectivity patterns.[24][25][26] The PDF neuropeptide, produced by approximately 10 percent of these 150 pacemaker cells, is essential for synchronizing the activity of different oscillator groups and generating robust behavioral rhythmicity.[25] Cryptochrome, expressed in a subset of these neurons particularly including some of the LNds, acts to reset the phase of individual clock neurons in response to light, thereby regulating the temporal phase relationships within this distributed oscillator network.
The recognition of cryptochrome receptor (PDFR) and cryptochrome signaling as converging in a subset of pacemaker neurons reveals an integration point where light input and neuropeptide synchronization signals interact.[28] This convergence allows the circadian system to modulate its response to light based on the phase state of other neurons in the network, enabling more sophisticated temporal regulation than would be possible if light sensing operated independently in each neuron.[28] Mutant analysis of flies lacking both PDF receptor and cryptochrome function reveals that the amplitude and phase of circadian behavioral rhythms are particularly affected, demonstrating that these two signaling systems interact to shape circadian behavior.[28]
Beyond its well-established role in light-dependent circadian clock regulation, cryptochrome mediates light-dependent magnetosensitivity in Drosophila, functioning as a possible magnetic field receptor.[52] In binary-choice behavioral assays, wild-type flies exhibit both naive and trained behavioral responses to magnetic fields under full-spectrum light but do not respond to magnetic stimuli when wavelengths in the UV-A and blue range that activate cryptochrome (less than 420 nm) are filtered from the light spectrum.[52] Behavioral responses to the magnetic field are partially restored when wavelengths between 400-420 nm are included, consistent with the action spectrum of cryptochrome, and these responses are completely abolished in cry-null mutant flies.[52] The wavelength-dependent effect on magnetic field sensitivity, coupled with the necessity of cryptochrome for magnetic responses, provides strong evidence that cryptochrome functions as a photoreceptor for light-dependent magnetic sensing.[52]
The mechanism underlying cryptochrome-mediated magnetoreception is proposed to involve radical pair chemistry within the tryptophan electron transfer chain.[19][48] According to this mechanism, the sequential electron transfer along the Trp-tetrad creates radical pairs at multiple positions, with the radical pair comprising the third and fourth tryptophans (RPC and RPD) showing magnetic field effects due to their inter-radical separations and the spin dynamics of their recombination reactions.[48] The third radical pair (RPC), involving the third tryptophan (Trp-C), occupies a separation distance of approximately 17.6 Γ ngstrΓΆms at which magnetic field effects on the quantum spin dynamics are optimized, allowing this system to achieve sensitivity to Earth-strength magnetic fields.[48] In contrast, the fourth radical pair (RPD) is more widely separated, leading to longer-lived radical pairs that experience slower spin-selective back electron transfer, compromising magnetic sensitivity through loss of spin coherence.[48]
The involvement of cryptochrome in magnetoreception extends beyond Drosophila, as mammalian-type cryptochrome 2 has been identified as essential for directional magnetic field responses in cockroaches, with this alternative cryptochrome showing localization in eye-adjacent tissues.[19] The broader occurrence of cryptochrome-dependent magnetoreception across diverse insect species suggests that this may represent an ancient and conserved function of the cryptochrome/photolyase superfamily, with implications for animal navigation and compass-mediated behaviors in migratory species.[19][48]
The evolutionary history of cryptochromes extends back to the Neoproterozoic Era (approximately 1000-541 million years ago), with both plant and animal cryptochromes evolving during this period of major climate and global light regime changes.[56] Phylogenetic analysis reveals that animal cryptochromes evolved from (6-4) photolyases, while plant cryptochromes evolved from cyclobutane pyrimidine dimer (CPD) photolyases, indicating independent evolutionary origins for these distinct functional classes.[56] The divergent evolutionary origins are reflected in differences in the structural features controlling light sensitivity and protein-protein interactions.
Different animal lineages have evolved distinct cryptochrome repertoires reflecting their ecological niches and behavioral needs.[44][56] Some insects including Drosophila possess only a type I cryptochrome (insect CRY1) that functions as a light-sensitive input to the circadian system, while honeybees possess only a type II cryptochrome (mammalian-like CRY) that lacks photosensitivity and functions as a core clock component, and still other insects including monarch butterflies possess both types, allowing for functional specialization.[44][56] Vertebrates evolved multiple cryptochrome paralogs through whole-genome duplication events, with some lineages such as zebrafish retaining up to seven cryptochrome genes showing distinct expression patterns and functional specialization.[59] Mammalian type II cryptochromes appear to have lost their light-sensing capability during evolution, retaining vestigial properties of flavin binding but functioning instead as core transcriptional repressors within the circadian feedback loop rather than as light input transducers.[47]
The evolutionary divergence between type I and type II animal cryptochromes has been mapped to specific residues in secondary pockets within the photolyase homology region.[44] Notably, a conserved glycine at position 106 in vertebrate type II CRYs is replaced by a conserved tryptophan in type I CRYs of insects, and this tryptophan protrudes into and fills much of the cavity of the secondary pocket in dCRY.[44] Experimental swapping of these residues demonstrates that single amino acid substitutions can confer or abolish core circadian repressor function, indicating that the structural features controlling light dependence versus transcriptional repression represent relatively recent evolutionary divergences that can be switched by small sequence changes.[44]
The abundance and activity of cryptochrome are subject to multiple layers of post-translational regulation that allow for precise temporal and light-dependent control of circadian photoreception. Phosphorylation events regulate both the stability and localization of cryptochrome, with phosphorylation by casein kinase 2 (CK2) and other kinases modulating the half-life and subcellular distribution of the protein.[46][58] The light-dependent ubiquitination and proteasomal degradation of cryptochrome through the CRL4/BRWD3 E3 ubiquitin ligase complex represents a critical negative feedback mechanism that allows the system to desensitize to continued light exposure by degrading the photoreceptor itself.[38][41] Knockdown of brwd3 (also known as ramshackle) markedly attenuates light-induced degradation of cryptochrome, while in vitro experiments demonstrate that cryptochrome binds to BRWD3 in a light-dependent manner and undergoes ubiquitination by the purified BRWD3/DDB1/CUL4/ROC1 E3 ligase complex.[38][41]
In addition to ubiquitin-dependent degradation pathways, cryptochrome is subject to acetylation and other post-translational modifications whose functional significance is emerging from ongoing research. The extensive interactome of cryptochrome identified through proximity-dependent biotinylation approaches likely represents novel interaction partners that mediate light-dependent signaling to metabolic and neuronal pathways beyond the canonical circadian clock regulation.[15]
The discovery that cryptochrome is highly expressed in metabolically active tissues including the fat body and insulin-producing cells has prompted investigation into whether this photoreceptor plays roles in regulating metabolism independently of its effects on the core circadian clock.[18][21][43] Flies carrying mutations in cry display altered feeding behavior, with cry mutant flies showing increased food intake during the early day and altered feeding rhythm patterns under light-dark cycles.[18][43] Furthermore, cry mutations result in significantly increased glycogen concentrations, suggesting enhanced carbohydrate storage, and affect triglyceride levels in response to caloric restriction and high-fat diets.[18][43] These metabolic phenotypes suggest that cryptochrome plays a direct role in regulating energy homeostasis and nutrient sensing beyond its well-characterized function in resetting circadian phase.
The central circadian clock in Drosophila regulates feeding rhythms and energy homeostasis through signaling to peripheral tissues, particularly through the insulin-producing cells in the pars intercerebralis region of the brain that secrete Drosophila insulin-like peptides (DILPs).[18] These insulin-like peptides drive rhythmic expression of metabolic genes in the fat body and are required to generate the feeding rhythm and appropriate energy mobilization patterns.[18] The expression of cryptochrome in these insulin-producing cells, coupled with evidence from recent research that cryptochrome affects triglyceride metabolism and feeding behavior, suggests that the circadian photoreceptor may coordinate metabolic output signals from the central clock to peripheral tissues.[18][43]
Cryptochrome in Drosophila melanogaster represents a paradigmatic example of how a single protein can integrate multiple regulatory functions to achieve precise temporal control of complex biological processes. The protein functions simultaneously as a blue light photoreceptor that senses environmental light-dark cycles, as a signal transduction molecule that couples light perception to circadian clock resetting through light-dependent protein-protein interactions, and as a regulator of peripheral circadian oscillators and metabolic homeostasis. The structural organization of cryptochrome, featuring a conserved photolyase homology region binding a FAD chromophore coupled with a variable C-terminal extension, enables both light-dependent conformational changes and protein-protein interactions essential for circadian function. The light-dependent formation of the CRY:TIM complex, mediated through displacement of the autoinhibitory C-terminal tail, triggers recognition by the JET E3 ubiquitin ligase and the proteasomal degradation of Timeless, thereby resetting the circadian oscillator to reset light cues. Beyond circadian clock regulation, cryptochrome mediates light-dependent magnetoreception through radical pair chemistry within its tryptophan electron transfer chain, functions as a neuronal depolarization sensor coupling light to neuronal excitability, and regulates metabolic functions including feeding behavior and triglyceride metabolism. The remarkable multifunctionality of cryptochrome, with distinct molecular mechanisms underlying different biological responses, illustrates how evolutionary conservation of a basic protein scaffold can be elaborated to serve diverse signaling roles. The study of cryptochrome biology has fundamentally advanced understanding of how organisms perceive and respond to light for temporal regulation, and continues to reveal new insights into the molecular basis of circadian photoreception and the integration of temporal and metabolic regulation.
Exported on March 22, 2026 at 02:10 AM
Organism: Drosophila melanogaster
Sequence:
MATRGANVIWFRHGLRLHDNPALLAALADKDQGIALIPVFIFDGESAGTKNVGYNRMRFLLDSLQDIDDQLQAATDGRGRLLVFEGEPAYIFRRLHEQVRLHRICIEQDCEPIWNERDESIRSLCRELNIDFVEKVSHTLWDPQLVIETNGGIPPLTYQMFLHTVQIIGLPPRPTADARLEDATFVELDPEFCRSLKLFEQLPTPEHFNVYGDNMGFLAKINWRGGETQALLLLDERLKVEQHAFERGFYLPNQALPNIHDSPKSMSAHLRFGCLSVRRFYWSVHDLFKNVQLRACVRGVQMTGGAHITGQLIWREYFYTMSVNNPNYDRMEGNDICLSIPWAKPNENLLQSWRLGQTGFPLIDGAMRQLLAEGWLHHTLRNTVATFLTRGGLWQSWEHGLQHFLKYLLDADWSVCAGNWMWVSSSAFERLLDSSLVTCPVALAKRLDPDGTYIKQYVPELMNVPKEFVHEPWRMSAEQQEQYECLIGVHYPERIIDLSMAVKRNMLAMKSLRNSLITPPPHCRPSNEEEVRQFFWLADVVV
The architecture begins with IPR002081 (Cryptochrome/DNA photolyase class 1 family, residues 4β515), establishing membership in the class I photolyase/cryptochrome lineage that uses flavin photoreceptor chemistry. The N-terminus is defined by IPR006050 (DNA photolyase, N-terminal domain, residues 5β171), reinforced by IPR036155 (Cryptochrome/photolyase, N-terminal domain superfamily, residues 6β182) and the broader IPR014729 (Rossmann-like alpha/beta/alpha sandwich fold, residues 8β225). This N-terminal module in class I photolyases organizes substrate-binding and electron-transfer geometry rather than catalyzing DNA repair directly in cryptochromes. The C-terminal half is specified by IPR036134 (Cryptochrome/DNA photolyase, FAD-binding domain-like superfamily, residues 213β514) and the core IPR005101 (Cryptochrome/DNA photolyase, FAD-binding domain, residues 310β510), which together form the flavin adenine dinucleotide (FAD) binding pocket and photochemically competent scaffold. The ordered layoutβan N-terminal photolyase-like sensor/transducer coupled to a C-terminal FAD-binding redox coreβcauses blue-light absorption and flavin photoreduction, the hallmark of soluble flavoprotein photoreceptors.
From this domain logic, the molecular function resolves to light perception mediated by a flavin cofactor. The N-terminal photolyase-like domain and the C-terminal FAD-binding core cooperate to stabilize a signaling-competent dark state and a messenger-excited state upon blue-light excitation; this fulfills the role formalized as GO:0009881 photoreceptor activity. The absence of transmembrane segments and the soluble photolyase/cryptochrome scaffold indicate a cytosolic photoreceptor rather than a membrane-tethered one.
Light-driven changes in flavin redox state propagate into circadian timing circuits. The photoreceptor chemistry provides a biochemical clock input that entrains and stabilizes daily rhythms, thereby driving the broader process captured by GO:0007623 circadian rhythm. In Drosophila, such entrainment aligns behavioral and physiological outputs with environmental light cycles.
Cellular localization follows from the soluble, two-lobed photolyase/cryptochrome fold and lack of secretion or membrane anchors: this architecture dictates a cytoplasmic residency consistent with a freely diffusible signaling photoreceptor. Thus the cellular component is the cytoplasm, corresponding to GO:0005737 cytoplasm.
Mechanistically, blue-light excitation of the FAD-bound core triggers electron transfer initiated by the N-terminal photolyase-like domain, producing transient radical and charge-transfer states that modulate partner-binding surfaces. This redox-controlled exposure creates docking interfaces for circadian regulators. I therefore hypothesize interactions with the Drosophila clockwork apparatus: association with a TimelessβFimplate scaffold would couple light input to stabilization of DNA-binding complexes; transient engagement with Clock and Cycle would tune their activity; and contacts with cytoplasmic clock components and potential ubiquitin ligases could adjust protein turnover to maintain rhythmicity. Together, these hypothesized partnerships provide a pathway from light-activated flavin chemistry to cytoplasmic timing hubs.
A soluble blue-lightβactivated flavoprotein in fruit fly that resides in the cytoplasm and converts photon absorption into redox-driven signals that entrain daily timing pathways. Its photolyase-like scaffold binds a flavin cofactor and uses light-triggered electron transfer to alter interaction surfaces, thereby modulating cytoplasmic circadian regulators and aligning physiological outputs with environmental light cycles.
Photoreceptor protein involved in the regulation of biological circadian rhythms by acting as blue-light photoreceptor.
IPR002081, family) β residues 4-515IPR006050, domain) β residues 5-171IPR036155, homologous_superfamily) β residues 6-182IPR014729, homologous_superfamily) β residues 8-225IPR036134, homologous_superfamily) β residues 213-514IPR005101, domain) β residues 310-510Molecular Function: molecular_function (GO:0003674), binding (GO:0005488), molecular transducer activity (GO:0060089), small molecule binding (GO:0036094), heterocyclic compound binding (GO:1901363), protein binding (GO:0005515), signaling receptor activity (GO:0038023), ion binding (GO:0043167), organic cyclic compound binding (GO:0097159), photoreceptor activity (GO:0009881), nucleoside phosphate binding (GO:1901265), anion binding (GO:0043168), nucleotide binding (GO:0000166), flavin adenine dinucleotide binding (GO:0050660), FAD binding (GO:0071949)
Biological Process: biological_process (GO:0008150), locomotion (GO:0040011), regulation of biological process (GO:0050789), signaling (GO:0023052), multicellular organismal process (GO:0032501), biological regulation (GO:0065007), rhythmic process (GO:0048511), response to stimulus (GO:0050896), cellular process (GO:0009987), negative regulation of biological process (GO:0048519), response to external stimulus (GO:0009605), response to abiotic stimulus (GO:0009628), regulation of circadian rhythm (GO:0042752), taxis (GO:0042330), regulation of metabolic process (GO:0019222), circadian rhythm (GO:0007623), regulation of multicellular organismal process (GO:0051239), system process (GO:0003008), negative regulation of metabolic process (GO:0009892), regulation of cellular process (GO:0050794), cellular response to stimulus (GO:0051716), detection of stimulus (GO:0051606), negative regulation of cellular process (GO:0048523), cell communication (GO:0007154), signal transduction (GO:0007165), behavior (GO:0007610), detection of external stimulus (GO:0009581), negative regulation of nitrogen compound metabolic process (GO:0051172), response to radiation (GO:0009314), circadian behavior (GO:0048512), regulation of macromolecule metabolic process (GO:0060255), detection of abiotic stimulus (GO:0009582), intracellular receptor signaling pathway (GO:0030522), gravitaxis (GO:0042332), regulation of circadian sleep/wake cycle (GO:0042749), negative regulation of cellular metabolic process (GO:0031324), detection of stimulus involved in sensory perception (GO:0050906), locomotory behavior (GO:0007626), cellular response to environmental stimulus (GO:0104004), negative regulation of macromolecule metabolic process (GO:0010605), cellular response to abiotic stimulus (GO:0071214), regulation of biosynthetic process (GO:0009889), response to gravity (GO:0009629), regulation of nitrogen compound metabolic process (GO:0051171), entrainment of circadian clock (GO:0009649), regulation of cellular metabolic process (GO:0031323), negative regulation of biosynthetic process (GO:0009890), nervous system process (GO:0050877), regulation of primary metabolic process (GO:0080090), regulation of behavior (GO:0050795), phototransduction (GO:0007602), circadian regulation of gene expression (GO:0032922), rhythmic behavior (GO:0007622), cellular response to radiation (GO:0071478), response to light stimulus (GO:0009416), regulation of macromolecule biosynthetic process (GO:0010556), locomotor rhythm (GO:0045475), blue light signaling pathway (GO:0009785), detection of light stimulus involved in sensory perception (GO:0050962), sensory perception (GO:0007600), regulation of gene expression (GO:0010468), entrainment of circadian clock by photoperiod (GO:0043153), regulation of circadian sleep/wake cycle, sleep (GO:0045187), regulation of cellular biosynthetic process (GO:0031326), regulation of nucleobase-containing compound metabolic process (GO:0019219), negative regulation of macromolecule biosynthetic process (GO:0010558), negative regulation of cellular biosynthetic process (GO:0031327), regulation of RNA metabolic process (GO:0051252), negative regulation of RNA metabolic process (GO:0051253), negative regulation of nucleobase-containing compound metabolic process (GO:0045934), detection of light stimulus (GO:0009583), photoperiodism (GO:0009648), sensory perception of light stimulus (GO:0050953), response to blue light (GO:0009637), regulation of RNA biosynthetic process (GO:2001141), regulation of DNA-templated transcription (GO:0006355), cellular response to light stimulus (GO:0071482), negative regulation of RNA biosynthetic process (GO:1902679), negative regulation of DNA-templated transcription (GO:0045892), negative regulation of nucleic acid-templated transcription (GO:1903507), cellular response to blue light (GO:0071483), regulation of nucleic acid-templated transcription (GO:1903506)
Cellular Component: cellular_component (GO:0005575), cellular anatomical entity (GO:0110165), intracellular anatomical structure (GO:0005622), organelle (GO:0043226), cytosol (GO:0005829), cytoplasm (GO:0005737), membrane-enclosed lumen (GO:0031974), nucleoplasm (GO:0005654), organelle lumen (GO:0043233), intracellular organelle (GO:0043229), membrane-bounded organelle (GO:0043227), intracellular membrane-bounded organelle (GO:0043231), intracellular organelle lumen (GO:0070013), nuclear lumen (GO:0031981), nucleus (GO:0005634)
Generated by BioReason
Source: CRY-bioreason-rl-predictions.md
The BioReason summary states:
A soluble blue-light-activated flavoprotein in fruit fly that resides in the cytoplasm and converts photon absorption into redox-driven signals that entrain daily timing pathways. Its photolyase-like scaffold binds a flavin cofactor and uses light-triggered electron transfer to alter interaction surfaces, thereby modulating cytoplasmic circadian regulators and aligning physiological outputs with environmental light cycles.
This is largely correct and well-articulated. The curated review confirms CRY is a "FAD-binding blue-light photoreceptor that provides light input to the Drosophila circadian clock" with core functions of blue light photoreceptor activity (GO:0009882) and FAD binding (GO:0071949).
The description of the FAD cofactor and photolyase-like scaffold is accurate. The connection to circadian entrainment is correct.
Key issues:
Cytoplasm-only localization: The summary states CRY "resides in the cytoplasm." The curated review documents that CRY localizes to both cytoplasm (GO:0005737) and nucleus (GO:0005634), with light-driven nuclear translocation being functionally important. CRY's transcriptional repressor activity (GO:0045892) operates in the nucleus.
Missing transcriptional repressor function: The curated review establishes that CRY "functions as a transcriptional repressor for clock-controlled genes" -- "Genes directly activated by the transcription factors Clock (Clk) and cycle (cyc) are repressed by cry" (PMID:16527739). This is a core function that the BioReason summary completely omits in favor of vague "modulating cytoplasmic circadian regulators."
No mention of TIM interaction: CRY's light-dependent interaction with TIMELESS (TIM), promoting TIM degradation, is a key mechanism of clock resetting not captured in the summary.
DNA binding correctly absent: The curated review explicitly removes the IBA annotation for DNA binding (GO:0003677), noting CRY "is not a DNA repair enzyme but a blue-light photoreceptor" (PMID:10063806). BioReason correctly avoids claiming DNA binding or photolyase activity.
Comparison with interpro2go:
The ai-review.yaml does not contain GO_REF:0000002 annotations for CRY. BioReason's reasoning from the cryptochrome/photolyase domain architecture correctly identifies photoreceptor activity and circadian rhythm involvement, which matches the IBA and experimental annotations in the curated review. BioReason adds reasonable mechanistic detail about flavin redox chemistry beyond what domain-level mappings provide.
The domain architecture analysis is accurate, correctly distinguishing the N-terminal photolyase-like domain from the C-terminal FAD-binding domain. The mechanistic hypothesis about light-driven conformational changes exposing interaction surfaces is reasonable. The mention of "Timeless-Fimplate scaffold" in the trace shows awareness of the clock machinery, but this does not make it into the functional summary.
---
id: O77059
gene_symbol: CRY
product_type: PROTEIN
status: INITIALIZED
taxon:
id: NCBITaxon:7227
label: Drosophila melanogaster
description: |-
Cryptochrome (CRY/DmCRY, type I/Drosophila-type) is a FAD-binding blue-light photoreceptor
that provides light input to the Drosophila circadian clock. Its core, best-established function
is light-dependent entrainment: blue light absorbed by FAD drives photoreduction (via a Trp
triad/tetrad) and a conformational switch (C-terminal tail undocking) that enables CRY to bind
TIMELESS (TIM) and trigger TIM ubiquitination/proteasomal degradation via the E3 ligase JETLAG
(JET)/CUL1, resetting the PER/TIM oscillator. This is mechanistically DISTINCT from mammalian
CRY1/2 (type II), which are light-independent transcriptional repressors. In Drosophila, CRY can
also act as a transcriptional repressor of CLK/CYC targets, but this is a secondary role confined
to peripheral clocks. CRY additionally has non-canonical, tissue-dependent roles including
light-dependent magnetosensitivity, modulation of neuronal excitability/arousal, a structural
(actin/signalplex) role in eye rhabdomeres, and metabolic regulation.
existing_annotations:
- term:
id: GO:0005634
label: nucleus
evidence_type: IBA
original_reference_id: GO_REF:0000033
review:
summary: UniProt-curated localization includes nuclear CRY, consistent with
light-driven nuclear translocation.
action: ACCEPT
reason: Subcellular location evidence indicates CRY accumulates in the nucleus
after light perception, supporting nuclear localization.
supported_by:
- reference_id: UniProtKB:O77059
supporting_text: 'SUBCELLULAR LOCATION: Cytoplasm ... Nucleus.'
- term:
id: GO:0005737
label: cytoplasm
evidence_type: IBA
original_reference_id: GO_REF:0000033
review:
summary: UniProt-curated localization includes cytoplasmic CRY.
action: ACCEPT
reason: CRY is reported in cytoplasm and perinuclear region prior to nuclear
translocation, supporting cytoplasmic localization.
supported_by:
- reference_id: UniProtKB:O77059
supporting_text: 'SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:10417378,'
- term:
id: GO:0045892
label: negative regulation of DNA-templated transcription
evidence_type: IBA
original_reference_id: GO_REF:0000033
review:
summary: |-
CRY can act as a transcriptional repressor of CLK/CYC-activated clock genes
(Collins et al. 2006), but this is a Drosophila-specific secondary role confined
to peripheral clocks, NOT the canonical mammalian-type light-independent repression.
Drosophila CRY (type I) is mechanistically distinct from mammalian CRY1/2 (type II):
the falcon deep research establishes that the best-established / primary function of
DmCRY is as a blue-light photoreceptor that triggers light-dependent TIM degradation,
whereas light-independent transcriptional repression is the defining role of the
type II (mammalian) cryptochromes. The IBA inference (from the phylogenetic family)
therefore over-weights a repressor role that, in flies, is non-core and peripheral.
action: KEEP_AS_NON_CORE
reason: |-
Genuine but secondary/non-core in Drosophila. Collins et al. (PMID:16527739) show
repression of CLK/CYC targets is "confined to peripheral clocks" and does not
significantly affect pacemaker-neuron or behavioral rhythms; the core DmCRY function
is light input via TIM degradation, not transcriptional repression. Distinct from the
mammalian type II cryptochrome repressor role that drives this phylogenetic inference.
additional_reference_ids: ["file:DROME/CRY/CRY-deep-research-falcon.md"]
supported_by:
- reference_id: UniProtKB:O77059
supporting_text: Genes directly activated by the transcription factors Clock
(Clk) and cycle (cyc) are repressed by cry.
- reference_id: PMID:16527739
supporting_text: Here we demonstrate that Drosophila CRY also functions
as a transcriptional repressor.
- reference_id: file:DROME/CRY/CRY-deep-research-falcon.md
supporting_text: |-
This Drosophila light-sensing role is mechanistically distinct from **vertebrate/mammalian-type (type II) cryptochromes**, which are described primarily as **light-independent transcriptional repressors** in the core clock feedback loop.
- term:
id: GO:0003677
label: DNA binding
evidence_type: IBA
original_reference_id: GO_REF:0000033
review:
summary: CRY lacks photolyase activity and functions as a photoreceptor rather
than a DNA-binding repair enzyme.
action: REMOVE
reason: Evidence indicates CRY is a blue-light photoreceptor without photolyase
activity; DNA binding is not supported.
supported_by:
- reference_id: PMID:10063806
supporting_text: the protein is not a DNA repair enzyme but a blue-light
photoreceptor.
- term:
id: GO:0032922
label: circadian regulation of gene expression
evidence_type: IBA
original_reference_id: GO_REF:0000033
review:
summary: CRY regulates expression of CLK/CYC target genes, consistent with circadian
regulation of gene expression.
action: ACCEPT
reason: Repression of clock-controlled transcription by CRY supports circadian
regulation of gene expression.
supported_by:
- reference_id: UniProtKB:O77059
supporting_text: Genes directly activated by the transcription factors Clock
(Clk) and cycle (cyc) are repressed by cry.
- term:
id: GO:0043153
label: entrainment of circadian clock by photoperiod
evidence_type: IBA
original_reference_id: GO_REF:0000033
review:
summary: |-
Loss of CRY disrupts synchronization to light-dark cycles, indicating a role in
photoperiod entrainment. The falcon deep research details the canonical mechanism:
light-activated CRY binds TIM and triggers TIM degradation via recruitment of the
E3 ubiquitin ligase Jetlag (JET)/CUL1, leading to TIM ubiquitination and proteasomal
degradation, thereby resetting the PER/TIM negative arm and entraining behavioral
rhythms. This is the core, best-established DmCRY function.
action: ACCEPT
reason: Core biological process. CRY is the primary photoreceptor for entrainment of the
fly circadian clock and acts by light-dependent TIM degradation.
additional_reference_ids: ["file:DROME/CRY/CRY-deep-research-falcon.md"]
supported_by:
- reference_id: UniProtKB:O77059
supporting_text: Flies exhibit poor synchronization to light-dark cycles
and show no response to brief light pulses.
- reference_id: PMID:37100907
supporting_text: the photoreceptor Cryptochrome (Cry) entrains the clock
by triggering Tim degradation in light
- reference_id: PMID:16794082
supporting_text: Expression of JET along with the circadian photoreceptor
cryptochrome (CRY) in cultured S2R cells confers light-dependent degradation
onto TIM,
- reference_id: PMID:22080955
supporting_text: is the primary photoreceptor for entrainment of the fly
circadian clock
- reference_id: file:DROME/CRY/CRY-deep-research-falcon.md
supporting_text: |-
In the canonical pathway, light-activated CRY **binds Timeless (TIM)** and triggers **TIM degradation** via recruitment of the **E3 ubiquitin ligase Jetlag (JET)**, thereby resetting the circadian oscillator.
- reference_id: file:DROME/CRY/CRY-deep-research-falcon.md
supporting_text: |-
The canonical output of CRY photoreception is **light-dependent TIM degradation**
- term:
id: GO:0071949
label: FAD binding
evidence_type: IBA
original_reference_id: GO_REF:0000033
review:
summary: |-
CRY binds FAD as the principal blue-light chromophore/cofactor in the photolyase
homology region (PHR). The falcon deep research notes that FAD binding is both
photochemical (it is the chromophore that absorbs blue light) and a structural
requirement for CRY to reach a signaling-competent native fold.
action: ACCEPT
reason: Core molecular function. UniProt-curated cofactor annotations specify one FAD
per subunit, and FAD binding is essential for both photoreception and folding.
additional_reference_ids: ["file:DROME/CRY/CRY-deep-research-falcon.md"]
supported_by:
- reference_id: UniProtKB:O77059
supporting_text: Binds 1 FAD per subunit.
- reference_id: PMID:24297896
supporting_text: contains a C-terminal tail (CTT) helix that binds beside
a FAD cofactor
- reference_id: PDB:8DD7
supporting_text: FAD (Subject of Investigation/LOI)
- reference_id: file:DROME/CRY/CRY-deep-research-falcon.md
supporting_text: |-
cryptochromes have a conserved **photolyase homology region (PHR)** that binds **FAD** as the principal blue-light chromophore
- reference_id: file:DROME/CRY/CRY-deep-research-falcon.md
supporting_text: |-
FAD binding is not only photochemical but also a structural requirement** to reach a signaling-competent native fold.
- term:
id: GO:0000166
label: nucleotide binding
evidence_type: IEA
original_reference_id: GO_REF:0000043
review:
summary: CRY binds a flavin adenine dinucleotide cofactor, supporting nucleotide
binding.
action: KEEP_AS_NON_CORE
reason: FAD is a nucleotide cofactor; the term is generic but consistent with
known cofactor binding.
supported_by:
- reference_id: UniProtKB:O77059
supporting_text: Binds 1 FAD per subunit.
- term:
id: GO:0005634
label: nucleus
evidence_type: IEA
original_reference_id: GO_REF:0000044
review:
summary: UniProt-curated localization includes nuclear CRY.
action: ACCEPT
reason: Subcellular location annotations indicate nuclear accumulation after
light perception.
supported_by:
- reference_id: UniProtKB:O77059
supporting_text: 'SUBCELLULAR LOCATION: Cytoplasm ... Nucleus.'
- reference_id: PMID:18663237
supporting_text: CRY is present in both the nucleus and the cytoplasm of
these neurons,
- term:
id: GO:0005737
label: cytoplasm
evidence_type: IEA
original_reference_id: GO_REF:0000044
review:
summary: UniProt-curated localization includes cytoplasmic CRY.
action: ACCEPT
reason: CRY localizes to cytoplasm and perinuclear region prior to nuclear translocation.
supported_by:
- reference_id: UniProtKB:O77059
supporting_text: 'SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:10417378,'
- reference_id: PMID:18663237
supporting_text: CRY is present in both the nucleus and the cytoplasm of
these neurons,
- term:
id: GO:0009416
label: response to light stimulus
evidence_type: IEA
original_reference_id: GO_REF:0000117
review:
summary: CRY expression and function are light regulated, supporting a response
to light stimulus.
action: ACCEPT
reason: Light-regulated expression and photoreceptor function indicate response
to light stimulus.
supported_by:
- reference_id: UniProtKB:O77059
supporting_text: Regulation of expression by light suggests a role in photoreception
for locomotor activity rhythms.
- term:
id: GO:0009881
label: photoreceptor activity
evidence_type: IEA
original_reference_id: GO_REF:0000043
review:
summary: |-
CRY is a blue-light-dependent photoreceptor in the circadian system. The falcon deep
research establishes that this is the best-established/core function of DmCRY: blue
light absorbed by FAD drives photoreduction via a Trp triad/tetrad, producing a
conformational change (CTT undocking) that enables light-dependent TIM binding and
JET-dependent TIM degradation, resetting the circadian oscillator.
action: ACCEPT
reason: UniProt function description explicitly identifies CRY as a blue-light-dependent
regulator in the circadian loop; falcon synthesis confirms photoreceptor activity as
the core molecular function.
additional_reference_ids: ["file:DROME/CRY/CRY-deep-research-falcon.md"]
supported_by:
- reference_id: UniProtKB:O77059
supporting_text: Blue light-dependent regulator that is the input of the
circadian feedback loop.
- reference_id: PMID:21187431
supporting_text: Cryptochrome (CRY) is a blue-light sensitive flavoprotein
that functions as the primary circadian photoreceptor in Drosophila melanogaster.
- reference_id: PMID:10839367
supporting_text: encodes a critical circadian photoreceptor in Drosophila.
- reference_id: file:genes/DROME/CRY/CRY-deep-research-cyberian.md
supporting_text: Cryptochrome (CRY) is a blue light-sensitive flavoprotein
that serves as the primary dedicated circadian photoreceptor in
- reference_id: file:DROME/CRY/CRY-deep-research-falcon.md
supporting_text: |-
blue-light absorption by **FAD** drives photoreduction via a **Trp triad/tetrad**
- term:
id: GO:0048471
label: perinuclear region of cytoplasm
evidence_type: IEA
original_reference_id: GO_REF:0000044
review:
summary: CRY accumulates in the perinuclear region before nuclear translocation.
action: ACCEPT
reason: The perinuclear accumulation is documented as part of CRY light-dependent
trafficking.
supported_by:
- reference_id: UniProtKB:O77059
supporting_text: Accumulates in the perinuclear region about one hour before
translocation into the nucleus.
- term:
id: GO:0048511
label: rhythmic process
evidence_type: IEA
original_reference_id: GO_REF:0000043
review:
summary: CRY functions within the circadian feedback loop, supporting a rhythmic
process annotation.
action: ACCEPT
reason: CRY is a blue-light-dependent regulator in the circadian feedback loop.
supported_by:
- reference_id: UniProtKB:O77059
supporting_text: Blue light-dependent regulator that is the input of the
circadian feedback loop.
- term:
id: GO:0005515
label: protein binding
evidence_type: IPI
original_reference_id: PMID:17418796
review:
summary: The cited study is focused on circadian network/photoperiod effects
and does not present direct CRY binding assays; light-dependent CRY-TIM interaction
is documented elsewhere.
action: MARK_AS_OVER_ANNOTATED
reason: Protein binding is overly generic and the PMID cited does not provide
direct binding evidence for CRY. Specific interactions (e.g., CRYβTIM) are
better captured with partner-specific evidence when available.
additional_reference_ids: ["PMID:10417378"]
supported_by:
- reference_id: PMID:17418796
supporting_text: Previous work in Drosophila has defined two populations
of circadian brain neurons, morning cells (M-cells) and evening cells
(E-cells),
- reference_id: PMID:10417378
supporting_text: CRY and TIM are part of the same complex and directly interact
in yeast in a light-dependent fashion.
- term:
id: GO:0005829
label: cytosol
evidence_type: IDA
original_reference_id: PMID:10417378
review:
summary: CRY can be detected in cytoplasm as well as nucleus.
action: ACCEPT
reason: Cytoplasmic accumulation is documented in studies of CRY localization;
nuclear localization does not exclude cytosolic presence.
additional_reference_ids: ["PMID:14960620"]
supported_by:
- reference_id: PMID:10417378
supporting_text: PER/TIM and CRY influence the subcellular distribution
of these protein complexes, which reside primarily in the nucleus after
the perception of a light signal.
- reference_id: PMID:14960620
supporting_text: it accumulated in both the nucleus and the cytoplasm, including
some neuritic projections.
- term:
id: GO:0007623
label: circadian rhythm
evidence_type: IPI
original_reference_id: PMID:10417378
review:
summary: CRY acts as a circadian photoreceptor interacting with core clock components,
supporting a role in circadian rhythm.
action: ACCEPT
reason: The paper explicitly describes CRY as a circadian photoreceptor acting
via core clock components, consistent with circadian rhythm involvement.
supported_by:
- reference_id: PMID:10417378
supporting_text: Thus, CRY acts as a circadian photoreceptor by directly
interacting with core components of the circadian clock.
- term:
id: GO:0007623
label: circadian rhythm
evidence_type: IMP
original_reference_id: PMID:11357134
review:
summary: CRY mediates light input to circadian oscillators in brain and peripheral
tissues, supporting circadian rhythm function.
action: ACCEPT
reason: The abstract states CRY acts as a photoreceptor mediating light input
to circadian oscillators, indicating a role in circadian rhythms.
supported_by:
- reference_id: PMID:11357134
supporting_text: In Drosophila, cryptochrome (CRY) acts as a photoreceptor
that mediates light input to circadian oscillators in both brain and peripheral
tissue.
- term:
id: GO:0007623
label: circadian rhythm
evidence_type: IGI
original_reference_id: PMID:9845370
review:
summary: The cryb mutation identifies cryptochrome as a circadian photoreceptor,
consistent with circadian rhythm involvement.
action: ACCEPT
reason: Genetic evidence from cryb mutants establishes cryptochrome as a circadian
photoreceptor in Drosophila.
supported_by:
- reference_id: PMID:9845370
supporting_text: The cryb mutation identifies cryptochrome as a circadian
photoreceptor in Drosophila.
- term:
id: GO:0009881
label: photoreceptor activity
evidence_type: IDA
original_reference_id: PMID:10417378
review:
summary: CRY is described as a circadian photoreceptor acting via light-dependent
interactions with core clock components.
action: ACCEPT
reason: The cited study explicitly characterizes CRY as a circadian photoreceptor,
supporting photoreceptor activity.
supported_by:
- reference_id: PMID:10417378
supporting_text: Thus, CRY acts as a circadian photoreceptor by directly
interacting with core components of the circadian clock.
- term:
id: GO:0007623
label: circadian rhythm
evidence_type: IMP
original_reference_id: PMID:9845369
review:
summary: CRY is a major contributor to circadian rhythm resetting and photosensitivity,
supporting circadian rhythm involvement.
action: ACCEPT
reason: The abstract directly links CRY to circadian rhythm resetting, which
is central to circadian rhythm processes.
supported_by:
- reference_id: PMID:9845369
supporting_text: CRY, a Drosophila clock and light-regulated cryptochrome,
is a major contributor to circadian rhythm resetting and photosensitivity.
- term:
id: GO:0009637
label: response to blue light
evidence_type: IMP
original_reference_id: PMID:9845369
review:
summary: CRY mediates blue-light-evoked neuronal responses in pacemaker neurons,
supporting a response to blue light.
action: ACCEPT
reason: Blue-light responsiveness is explicitly reported for CRY in pacemaker
neurons; the original study supports CRY as a photosensitive cryptochrome.
supported_by:
- reference_id: PMID:28489826
supporting_text: "Loss of either cry or \nrh7 caused minor defects in photoentrainment,\
\ whereas loss of both caused \nprofound impairment"
- reference_id: PMID:9845369
supporting_text: All characterized family members are directly photosensitive
and include plant blue light photoreceptors.
- term:
id: GO:0043153
label: entrainment of circadian clock by photoperiod
evidence_type: IGI
original_reference_id: PMID:28840790
review:
summary: Genetic interaction data support CRY contributions to photoentrainment
and synchronization to light-dark cycles.
action: ACCEPT
reason: The cited study reports altered synchronization in blue light and stronger
effects when cryptochrome-based light input is absent; additional evidence
shows cry loss affects photoentrainment.
supported_by:
- reference_id: PMID:28840790
supporting_text: However, in blue light (470 nm), Rh70 mutants needed significantly
longer to synchronize than wild-type controls,
- reference_id: PMID:28489826
supporting_text: "Loss of either cry or \nrh7 caused minor defects in photoentrainment,\
\ whereas loss of both caused \nprofound impairment"
- term:
id: GO:0032922
label: circadian regulation of gene expression
evidence_type: IMP
original_reference_id: PMID:28489826
review:
summary: CRY contributes to circadian clock regulation and acts as a transcriptional
repressor of clock-controlled genes.
action: ACCEPT
reason: Photoentrainment phenotypes in cry mutants support circadian regulation,
and CRY represses CLK/CYC-driven transcription.
additional_reference_ids: ["PMID:16527739"]
supported_by:
- reference_id: PMID:28489826
supporting_text: "Loss of either cry or \nrh7 caused minor defects in photoentrainment,\
\ whereas loss of both caused \nprofound impairment"
- reference_id: PMID:16527739
supporting_text: Drosophila CRY also functions as a transcriptional repressor.
- term:
id: GO:0032922
label: circadian regulation of gene expression
evidence_type: IGI
original_reference_id: PMID:28489826
review:
summary: Genetic interaction data link CRY to circadian regulation and transcriptional
repression.
action: ACCEPT
reason: cry-dependent photoentrainment plus CRY transcriptional repression supports
circadian regulation of gene expression.
additional_reference_ids: ["PMID:16527739"]
supported_by:
- reference_id: PMID:28489826
supporting_text: "Loss of either cry or \nrh7 caused minor defects in photoentrainment,\
\ whereas loss of both caused \nprofound impairment"
- reference_id: PMID:16527739
supporting_text: Drosophila CRY also functions as a transcriptional repressor.
- term:
id: GO:0043153
label: entrainment of circadian clock by photoperiod
evidence_type: IMP
original_reference_id: PMID:28489826
review:
summary: CRY contributes to photoentrainment of the circadian clock.
action: ACCEPT
reason: Loss of cry impairs photoentrainment, especially when combined with
loss of rh7.
supported_by:
- reference_id: PMID:28489826
supporting_text: "Loss of either cry or \nrh7 caused minor defects in photoentrainment,\
\ whereas loss of both caused \nprofound impairment"
- term:
id: GO:0043153
label: entrainment of circadian clock by photoperiod
evidence_type: IGI
original_reference_id: PMID:28489826
review:
summary: Genetic interaction evidence supports CRY-dependent photoentrainment.
action: ACCEPT
reason: Combined loss of cry and rh7 causes strong defects in photoentrainment.
supported_by:
- reference_id: PMID:28489826
supporting_text: "Loss of either cry or \nrh7 caused minor defects in photoentrainment,\
\ whereas loss of both caused \nprofound impairment"
- term:
id: GO:0048512
label: circadian behavior
evidence_type: IMP
original_reference_id: PMID:28489826
review:
summary: CRY affects circadian behavioral outputs via photoentrainment pathways.
action: ACCEPT
reason: cry loss disrupts photoentrainment and alters behavioral responses to
light cycles.
supported_by:
- reference_id: PMID:28489826
supporting_text: "Loss of either cry or \nrh7 caused minor defects in photoentrainment,\
\ whereas loss of both caused \nprofound impairment"
- term:
id: GO:0048512
label: circadian behavior
evidence_type: IGI
original_reference_id: PMID:28489826
review:
summary: Genetic interaction between cry and rh7 affects circadian behavioral
entrainment.
action: ACCEPT
reason: Combined mutations show profound behavioral photoentrainment defects.
supported_by:
- reference_id: PMID:28489826
supporting_text: "Loss of either cry or \nrh7 caused minor defects in photoentrainment,\
\ whereas loss of both caused \nprofound impairment"
- term:
id: GO:0071482
label: cellular response to light stimulus
evidence_type: IMP
original_reference_id: PMID:28489826
review:
summary: CRY mediates cellular light responses in pacemaker neurons.
action: ACCEPT
reason: Light-evoked neuronal responses depend on CRY, supporting cellular response
to light stimulus.
supported_by:
- reference_id: PMID:28489826
supporting_text: "Loss of either cry or \nrh7 caused minor defects in photoentrainment,\
\ whereas loss of both caused \nprofound impairment"
- term:
id: GO:0005654
label: nucleoplasm
evidence_type: TAS
original_reference_id: Reactome:R-DME-432371
review:
summary: Reactome places CRY in nucleoplasm during circadian signaling.
action: ACCEPT
reason: UniProt subcellular location evidence includes nuclear CRY.
supported_by:
- reference_id: UniProtKB:O77059
supporting_text: 'SUBCELLULAR LOCATION: Cytoplasm ... Nucleus.'
- term:
id: GO:0005654
label: nucleoplasm
evidence_type: TAS
original_reference_id: Reactome:R-DME-432378
review:
summary: Reactome places CRY in nucleoplasm during clock-regulatory steps.
action: ACCEPT
reason: Nuclear localization of CRY is documented in curated UniProt annotations.
supported_by:
- reference_id: UniProtKB:O77059
supporting_text: 'SUBCELLULAR LOCATION: Cytoplasm ... Nucleus.'
- term:
id: GO:0005654
label: nucleoplasm
evidence_type: TAS
original_reference_id: Reactome:R-DME-432424
review:
summary: Reactome annotates CRY in nucleoplasm for TIM-related steps.
action: ACCEPT
reason: CRY translocates to the nucleus after light perception.
supported_by:
- reference_id: UniProtKB:O77059
supporting_text: 'SUBCELLULAR LOCATION: Cytoplasm ... Nucleus.'
- term:
id: GO:0005654
label: nucleoplasm
evidence_type: TAS
original_reference_id: Reactome:R-DME-432652
review:
summary: Reactome assigns CRY to nucleoplasm, consistent with light-induced
nuclear localization.
action: ACCEPT
reason: Curated localization places CRY in the nucleus.
supported_by:
- reference_id: UniProtKB:O77059
supporting_text: 'SUBCELLULAR LOCATION: Cytoplasm ... Nucleus.'
- term:
id: GO:0005829
label: cytosol
evidence_type: TAS
original_reference_id: Reactome:R-DME-432401
review:
summary: Reactome assigns CRY to cytosol in light-input pathway steps.
action: ACCEPT
reason: Cytosolic localization of CRY is supported by UniProt curated evidence.
supported_by:
- reference_id: UniProtKB:O77059
supporting_text: 'SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:10417378,'
- term:
id: GO:0005829
label: cytosol
evidence_type: TAS
original_reference_id: Reactome:R-DME-432426
review:
summary: Reactome assigns CRY to cytosol during TIM-related interactions.
action: ACCEPT
reason: Cytoplasmic localization is curated for CRY.
supported_by:
- reference_id: UniProtKB:O77059
supporting_text: 'SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:10417378,'
- term:
id: GO:0005829
label: cytosol
evidence_type: TAS
original_reference_id: Reactome:R-DME-432428
review:
summary: Reactome assigns CRY to cytosol during degradation steps.
action: ACCEPT
reason: CRY is documented in cytosolic compartments before nuclear translocation.
supported_by:
- reference_id: UniProtKB:O77059
supporting_text: 'SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:10417378,'
- term:
id: GO:0005829
label: cytosol
evidence_type: TAS
original_reference_id: Reactome:R-DME-432593
review:
summary: Reactome assigns CRY to cytosol in ubiquitination steps.
action: ACCEPT
reason: Cytosolic localization of CRY is supported by curated UniProt evidence.
supported_by:
- reference_id: UniProtKB:O77059
supporting_text: 'SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:10417378,'
- term:
id: GO:0005829
label: cytosol
evidence_type: TAS
original_reference_id: Reactome:R-DME-881988
review:
summary: Reactome assigns CRY to cytosol for phosphorylation steps.
action: ACCEPT
reason: CRY is documented in cytosol/perinuclear regions prior to nuclear translocation.
supported_by:
- reference_id: UniProtKB:O77059
supporting_text: 'SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:10417378,'
- term:
id: GO:0045187
label: regulation of circadian sleep/wake cycle, sleep
evidence_type: IMP
original_reference_id: PMID:25148297
review:
summary: Disruption of CRY rhythms by nocturnal light affects sleep regulation.
action: ACCEPT
reason: Light interruption dampens CRY rhythms and impacts sleep, indicating
CRY involvement in circadian sleep/wake regulation.
supported_by:
- reference_id: PMID:25148297
supporting_text: "the discontinuous light \nstimulation damped the daily\
\ rhythm of a circadian light-sensitive protein \ncryptochrome both at\
\ the mRNA and protein levels,"
- term:
id: GO:0005515
label: protein binding
evidence_type: IPI
original_reference_id: PMID:24297896
review:
summary: TIM binds dCRY in light, but the generic protein-binding term is uninformative.
action: MARK_AS_OVER_ANNOTATED
reason: The paper supports specific CRY-TIM interaction; use of a generic binding
term is over-annotated.
supported_by:
- reference_id: PMID:24297896
supporting_text: the corresponding peptide binds dCRY in light and protects
the flavin from oxidation
- term:
id: GO:0043153
label: entrainment of circadian clock by photoperiod
evidence_type: IMP
original_reference_id: PMID:22306971
review:
summary: CRY contributes to light synchronization of the circadian clock.
action: ACCEPT
reason: The study notes that cryptochrome in brain clock neurons contributes
to clock synchronization.
supported_by:
- reference_id: PMID:22306971
supporting_text: the blue-light photoreceptor Cryptochrome expressed within
the brain clock neurons contribute to this clock synchronization.
- term:
id: GO:0043153
label: entrainment of circadian clock by photoperiod
evidence_type: IGI
original_reference_id: PMID:22306971
review:
summary: Genetic data in the context of light synchronization support CRY-dependent
photoentrainment.
action: ACCEPT
reason: Cryptochrome contributes to clock synchronization alongside visual photoreceptors.
supported_by:
- reference_id: PMID:22306971
supporting_text: the blue-light photoreceptor Cryptochrome expressed within
the brain clock neurons contribute to this clock synchronization.
- term:
id: GO:0071949
label: FAD binding
evidence_type: IDA
original_reference_id: PMID:23746849
review:
summary: dCRY is a FAD-dependent photoreceptor.
action: ACCEPT
reason: Structural analysis identifies dCRY as FAD-dependent, supporting FAD
binding.
supported_by:
- reference_id: PMID:23746849
supporting_text: Drosophila cryptochrome (dCRY) is a FAD-dependent circadian
photoreceptor,
- term:
id: GO:0050958
label: magnetoreception
evidence_type: IMP
original_reference_id: PMID:20098414
review:
summary: |-
CRY mediates light-dependent magnetoreception. The falcon deep research frames this
as a non-canonical, tissue-dependent CRY function: cry mutants lose magnetic-field-
dependent behaviors, with proposed radical-pair photochemistry tied to flavin redox.
action: KEEP_AS_NON_CORE
reason: |-
Genuine but non-core. Magnetosensitivity is a proposed/secondary CRY function relative
to the canonical circadian photoreceptor / TIM-degradation role, and the underlying
radical-pair mechanism remains a hypothesis.
additional_reference_ids: ["file:DROME/CRY/CRY-deep-research-falcon.md"]
supported_by:
- reference_id: PMID:20098414
supporting_text: the light-dependent magnetic sense of Drosophila melanogaster
is mediated by the ultraviolet (UV)-A/blue light photoreceptor cryptochrome
(Cry)
- reference_id: file:DROME/CRY/CRY-deep-research-falcon.md
supporting_text: |-
CRY-dependent magnetosensitivity is frequently discussed in Drosophila, with reviews summarizing that cry mutants lose magnetic-field-dependent behaviors
- term:
id: GO:0071000
label: response to magnetism
evidence_type: IMP
original_reference_id: PMID:20098414
review:
summary: |-
CRY is required for light-dependent responses to magnetic fields. Per falcon, this is
a non-canonical CRY function relative to the core circadian photoreceptor role.
action: KEEP_AS_NON_CORE
reason: |-
CRY-dependent magnetosensory responses under UV-A/blue light are genuine but secondary
to the core circadian photoreceptor / TIM-degradation function.
additional_reference_ids: ["file:DROME/CRY/CRY-deep-research-falcon.md"]
supported_by:
- reference_id: PMID:20098414
supporting_text: the light-dependent magnetic sense of Drosophila melanogaster
is mediated by the ultraviolet (UV)-A/blue light photoreceptor cryptochrome
(Cry)
- reference_id: file:DROME/CRY/CRY-deep-research-falcon.md
supporting_text: |-
CRY-dependent magnetosensitivity is frequently discussed in Drosophila, with reviews summarizing that cry mutants lose magnetic-field-dependent behaviors
- term:
id: GO:0009785
label: blue light signaling pathway
evidence_type: IMP
original_reference_id: PMID:10063806
review:
summary: CRY is a blue-light photoreceptor that lacks photolyase activity.
action: ACCEPT
reason: The study characterizes CRY as a blue-light photoreceptor, supporting
a role in blue-light signaling.
supported_by:
- reference_id: PMID:10063806
supporting_text: the protein is not a DNA repair enzyme but a blue-light
photoreceptor.
- term:
id: GO:0009649
label: entrainment of circadian clock
evidence_type: IDA
original_reference_id: PMID:21135155
review:
summary: CRY is a key component for preferential entrainment to light.
action: ACCEPT
reason: The study shows CRY-positive neurons preferentially entrain to light
cycles.
supported_by:
- reference_id: PMID:21135155
supporting_text: CRY is a key component for the preferential entrainment
to light.
- term:
id: GO:0042752
label: regulation of circadian rhythm
evidence_type: IDA
original_reference_id: PMID:21135155
review:
summary: CRY participates in light synchronization of circadian rhythms.
action: ACCEPT
reason: CRY is required for light-driven entrainment of circadian rhythms in
clock neurons.
supported_by:
- reference_id: PMID:21135155
supporting_text: The blue-light photoreceptive protein Cryptochrome (CRY)
plays an important role in the light synchronization of the Drosophila
circadian clock.
- term:
id: GO:0005515
label: protein binding
evidence_type: IPI
original_reference_id: PMID:10417378
review:
summary: |-
CRY interacts with TIM in a light-dependent complex, but generic protein binding is
over-annotated. The falcon deep research provides the specific structural basis: a 2023
cryo-EM structure shows TIM inserts its N-terminus into the CRY flavin pocket, replacing
the autoinhibitory C-terminal tail (CTT) and forming the major interface.
action: MARK_AS_OVER_ANNOTATED
reason: The evidence supports specific light-dependent CRY-TIM interaction rather than
nonspecific protein binding.
additional_reference_ids: ["file:DROME/CRY/CRY-deep-research-falcon.md"]
supported_by:
- reference_id: PMID:10417378
supporting_text: CRY and TIM are part of the same complex and directly interact
in yeast in a light-dependent fashion.
- reference_id: file:DROME/CRY/CRY-deep-research-falcon.md
supporting_text: |-
TIM inserts its N-terminus into the CRY flavin pocket**, replacing the CRY CTT and forming a major interface.
- term:
id: GO:0071000
label: response to magnetism
evidence_type: IMP
original_reference_id: PMID:18641630
review:
summary: |-
CRY is necessary for light-dependent magnetosensitive responses. Per falcon, this is
a non-canonical CRY function relative to the core circadian photoreceptor role.
action: KEEP_AS_NON_CORE
reason: |-
Cry-deficient flies lack magnetic responses under light, but magnetosensitivity is a
secondary function relative to the core circadian photoreceptor / TIM-degradation role.
additional_reference_ids: ["file:DROME/CRY/CRY-deep-research-falcon.md"]
supported_by:
- reference_id: PMID:18641630
supporting_text: the ultraviolet-A/blue-light photoreceptor cryptochrome
(Cry) is necessary for light-dependent magnetosensitive responses in Drosophila
melanogaster.
- reference_id: file:DROME/CRY/CRY-deep-research-falcon.md
supporting_text: |-
CRY-dependent magnetosensitivity is frequently discussed in Drosophila, with reviews summarizing that cry mutants lose magnetic-field-dependent behaviors
- term:
id: GO:0009649
label: entrainment of circadian clock
evidence_type: IMP
original_reference_id: PMID:18044989
review:
summary: |-
CRY mediates light input that resets the circadian oscillator. The falcon deep
research adds mechanistic detail: TIM then associates with CRY and JET/CUL1, leading
to TIM ubiquitination and proteasomal degradation; a 2023 cryo-EM structure shows TIM
inserts its N-terminus into the CRY flavin pocket, replacing the autoinhibitory CTT.
action: ACCEPT
reason: Light-activated CRY binding to TIM promotes degradation and clock resetting,
supporting entrainment. Core biological process.
additional_reference_ids: ["file:DROME/CRY/CRY-deep-research-falcon.md"]
supported_by:
- reference_id: PMID:18044989
supporting_text: Light-activated CRY binds to the TIMELESS (TIM) protein
and induces its degradation, which is likely to reset the molecular oscillator
- reference_id: file:DROME/CRY/CRY-deep-research-falcon.md
supporting_text: |-
TIM then associates with CRY and **JET/CUL1**, leading to **TIM ubiquitination and proteasomal degradation**
- term:
id: GO:0050958
label: magnetoreception
evidence_type: IMP
original_reference_id: PMID:19355790
review:
summary: |-
CRY-dependent magnetic sensitivity of the circadian clock supports magnetoreception.
Per falcon, this is a non-canonical, tissue-dependent CRY function relative to the
core circadian photoreceptor / TIM-degradation role.
action: KEEP_AS_NON_CORE
reason: |-
Magnetic field effects on the clock are light- and CRY-dependent, but magnetosensitivity
is a secondary/proposed function, not the core circadian photoreceptor role.
additional_reference_ids: ["file:DROME/CRY/CRY-deep-research-falcon.md"]
supported_by:
- reference_id: PMID:19355790
supporting_text: "Drosophila's circadian clock is sensitive to magnetic\
\ \nfields and that this sensitivity depends on light activation of CRY\
\ and on the \napplied field strength"
- reference_id: file:DROME/CRY/CRY-deep-research-falcon.md
supporting_text: |-
CRY-dependent magnetosensitivity is frequently discussed in Drosophila, with reviews summarizing that cry mutants lose magnetic-field-dependent behaviors
- term:
id: GO:0005634
label: nucleus
evidence_type: IDA
original_reference_id: PMID:18399544
review:
summary: CRY localizes to the nucleus in light/dark conditions.
action: ACCEPT
reason: Independent evidence shows nuclear accumulation of CRY in brain neurons.
additional_reference_ids: ["PMID:14960620"]
supported_by:
- reference_id: PMID:14960620
supporting_text: it accumulated in both the nucleus and the cytoplasm, including
some neuritic projections.
- term:
id: GO:0005737
label: cytoplasm
evidence_type: IDA
original_reference_id: PMID:18399544
review:
summary: CRY localizes to cytoplasm in brain neurons.
action: ACCEPT
reason: Independent evidence shows cytoplasmic accumulation of CRY in light/dark
conditions.
additional_reference_ids: ["PMID:14960620"]
supported_by:
- reference_id: PMID:14960620
supporting_text: it accumulated in both the nucleus and the cytoplasm, including
some neuritic projections.
- term:
id: GO:0003913
label: DNA photolyase activity
evidence_type: IMP
original_reference_id: PMID:10063806
negated: true
review:
summary: CRY lacks DNA photolyase activity (negated).
action: ACCEPT
reason: Recombinant CRY does not show photolyase activity for CPD or 6-4 photoproducts.
supported_by:
- reference_id: PMID:10063806
supporting_text: The recombinant protein did not show photolyase activity
for either cyclobutane pyrimidine dimers or 6-4 photoproducts in vitro
- term:
id: GO:0005515
label: protein binding
evidence_type: IPI
original_reference_id: PMID:11448767
review:
summary: CRY interacts with PER in a light-dependent manner, but the generic
binding term is over-annotated.
action: MARK_AS_OVER_ANNOTATED
reason: The evidence supports a specific CRY-PER interaction rather than nonspecific
protein binding.
supported_by:
- reference_id: PMID:11448767
supporting_text: revealed a dimerization between PER and CRY.
- term:
id: GO:0009881
label: photoreceptor activity
evidence_type: IMP
original_reference_id: PMID:10417378
review:
summary: CRY is described as a circadian photoreceptor.
action: ACCEPT
reason: The study explicitly characterizes CRY as a circadian photoreceptor
acting via core clock components.
supported_by:
- reference_id: PMID:10417378
supporting_text: Thus, CRY acts as a circadian photoreceptor by directly
interacting with core components of the circadian clock.
- term:
id: GO:0009881
label: photoreceptor activity
evidence_type: IMP
original_reference_id: PMID:18597555
review:
summary: Cryptochromes function as blue-light signaling receptors.
action: ACCEPT
reason: The study describes cryptochromes as flavoprotein blue-light signaling
receptors.
supported_by:
- reference_id: PMID:18597555
supporting_text: "Cryptochromes are a class of flavoprotein blue-light signaling\
\ receptors found \nin plants, animals, and humans"
- term:
id: GO:0009882
label: blue light photoreceptor activity
evidence_type: IMP
original_reference_id: PMID:10063806
review:
summary: |-
CRY is a blue-light photoreceptor. The falcon deep research confirms this as the core
molecular function: DmCRY is a Drosophila-type/type I cryptochrome that functions
primarily as a blue-light photoreceptor for circadian clock entrainment, mechanistically
distinct from the light-independent mammalian-type (type II) cryptochromes.
action: ACCEPT
reason: Recombinant CRY lacks photolyase activity and is characterized as a blue-light
photoreceptor; this is the core molecular function.
additional_reference_ids: ["file:DROME/CRY/CRY-deep-research-falcon.md"]
supported_by:
- reference_id: PMID:10063806
supporting_text: suggesting that the protein is not a DNA repair enzyme
but a blue-light photoreceptor.
- reference_id: file:DROME/CRY/CRY-deep-research-falcon.md
supporting_text: |-
functions primarily as a **blue-light photoreceptor** for circadian clock entrainment
- term:
id: GO:0009882
label: blue light photoreceptor activity
evidence_type: IMP
original_reference_id: PMID:10233998
review:
summary: DCry is identified as a candidate blue-light photoreceptor in Drosophila.
action: ACCEPT
reason: The study identifies DCry as a blue-light photoreceptor linked to circadian
entrainment.
supported_by:
- reference_id: PMID:10233998
supporting_text: We now have identified and characterized a candidate blue
light photoreceptor gene in Drosophila (DCry)
- term:
id: GO:0009882
label: blue light photoreceptor activity
evidence_type: IMP
original_reference_id: PMID:17298948
review:
summary: dCRY functions as a blue-light photoreceptor.
action: ACCEPT
reason: The study describes dCRY as a blue light photoreceptor involved in clock
synchronization.
supported_by:
- reference_id: PMID:17298948
supporting_text: Drosophila cryptochrome (dCRY) is a blue light photoreceptor
that is involved in the synchronization of the circadian clock with the
environmental light-dark cycle
- term:
id: GO:0009882
label: blue light photoreceptor activity
evidence_type: IMP
original_reference_id: PMID:9845369
review:
summary: CRY contributes to photosensitivity in the circadian system.
action: ACCEPT
reason: The study links CRY to circadian photosensitivity and light-dependent
resetting.
supported_by:
- reference_id: PMID:9845369
supporting_text: CRY, a Drosophila clock and light-regulated cryptochrome,
is a major contributor to circadian rhythm resetting and photosensitivity.
- term:
id: GO:0042752
label: regulation of circadian rhythm
evidence_type: IMP
original_reference_id: PMID:10233998
review:
summary: DCry dosage affects blue-light resetting of circadian locomotor rhythms.
action: ACCEPT
reason: Changes in DCry gene dosage alter blue-light resetting responses.
supported_by:
- reference_id: PMID:10233998
supporting_text: changes in DCry gene dosage are associated predictably
with alterations of the blue light resetting response for the circadian
rhythm of adult locomotor activity.
- term:
id: GO:0042752
label: regulation of circadian rhythm
evidence_type: IMP
original_reference_id: PMID:17298948
review:
summary: dCRY participates in synchronization of the circadian clock to light-dark
cycles.
action: ACCEPT
reason: The study links dCRY photoreceptor function to circadian clock synchronization.
supported_by:
- reference_id: PMID:17298948
supporting_text: Drosophila cryptochrome (dCRY) is a blue light photoreceptor
that is involved in the synchronization of the circadian clock with the
environmental light-dark cycle
- term:
id: GO:0042752
label: regulation of circadian rhythm
evidence_type: IMP
original_reference_id: PMID:9845369
review:
summary: CRY contributes to circadian rhythm resetting.
action: ACCEPT
reason: The study identifies CRY as a major contributor to circadian rhythm
resetting and photosensitivity.
supported_by:
- reference_id: PMID:9845369
supporting_text: CRY, a Drosophila clock and light-regulated cryptochrome,
is a major contributor to circadian rhythm resetting and photosensitivity.
- term:
id: GO:0042752
label: regulation of circadian rhythm
evidence_type: IMP
original_reference_id: PMID:9845370
review:
summary: cryb mutants show impaired synchronization to light-dark cycles.
action: ACCEPT
reason: Genetic loss of CRY affects circadian light synchronization, supporting
regulation of circadian rhythm.
supported_by:
- reference_id: PMID:9845370
supporting_text: Behaviorally, cryb exhibits poor synchronization to light-dark
cycles in genetic backgrounds that cause external blindness
- term:
id: GO:0045892
label: negative regulation of DNA-templated transcription
evidence_type: IMP
original_reference_id: PMID:16527739
review:
summary: |-
Collins et al. directly demonstrate that Drosophila CRY can repress CLK/CYC-driven
transcription, but the effect is "confined to peripheral clocks" and does not
significantly affect pacemaker-neuron molecular or behavioral rhythms. This is a
genuine but secondary role; the falcon deep research frames the primary/best-established
DmCRY function as the blue-light photoreceptor that triggers light-dependent TIM
degradation, mechanistically distinct from the mammalian type II repressor role.
action: KEEP_AS_NON_CORE
reason: |-
Direct experimental evidence (IMP) for repressor activity is solid, but it is a
peripheral-clock-specific, non-core function in Drosophila. The canonical core function
is light input via TIM degradation, not transcriptional repression.
additional_reference_ids: ["file:DROME/CRY/CRY-deep-research-falcon.md"]
supported_by:
- reference_id: PMID:16527739
supporting_text: Drosophila CRY also functions as a transcriptional repressor.
- reference_id: file:DROME/CRY/CRY-deep-research-falcon.md
supporting_text: |-
A 2020 expert review by Foley & Emery frames Drosophila CRY as a multi-functional photoreceptor whose **best-established** role is circadian entrainment via **light-dependent TIM degradation**
- term:
id: GO:0050660
label: flavin adenine dinucleotide binding
evidence_type: IDA
original_reference_id: PMID:10063806
review:
summary: Recombinant CRY binds a flavin adenine dinucleotide chromophore.
action: ACCEPT
reason: The study reports FAD as a chromophore in purified CRY.
supported_by:
- reference_id: PMID:10063806
supporting_text: Purified recombinant protein contained a flavin adenine
dinucleotide chromophore.
- term:
id: GO:0050660
label: flavin adenine dinucleotide binding
evidence_type: IDA
original_reference_id: PMID:17298948
review:
summary: dCRY contains FAD as a bound cofactor.
action: ACCEPT
reason: Biochemical analysis shows FAD(ox) in purified dCRY.
supported_by:
- reference_id: PMID:17298948
supporting_text: insect cell-purified dCRY contains flavin adenine dinucleotide
in its oxidized state (FAD(ox)) and residual amounts of methenyltetrahydrofolate
- term:
id: GO:0050660
label: flavin adenine dinucleotide binding
evidence_type: IMP
original_reference_id: PMID:18597555
review:
summary: Light induces redox changes in flavin bound to CRY.
action: ACCEPT
reason: Photoreduction of bound flavin implies FAD binding.
supported_by:
- reference_id: PMID:18597555
supporting_text: "Cryptochromes are a class of flavoprotein blue-light signaling\
\ receptors found \nin plants, animals, and humans"
- term:
id: GO:0050980
label: detection of light stimulus involved in magnetoreception
evidence_type: IMP
original_reference_id: PMID:18641630
review:
summary: |-
Light-dependent magnetosensitivity requires CRY, indicating light detection linked to
magnetoreception. Per falcon, this is a non-canonical CRY function relative to the core
circadian photoreceptor role.
action: KEEP_AS_NON_CORE
reason: |-
CRY is necessary for light-dependent magnetic responses, but this magnetosensory
detection is secondary to the core circadian photoreceptor / TIM-degradation function.
additional_reference_ids: ["file:DROME/CRY/CRY-deep-research-falcon.md"]
supported_by:
- reference_id: PMID:18641630
supporting_text: the ultraviolet-A/blue-light photoreceptor cryptochrome
(Cry) is necessary for light-dependent magnetosensitive responses in Drosophila
melanogaster.
- reference_id: file:DROME/CRY/CRY-deep-research-falcon.md
supporting_text: |-
CRY-dependent magnetosensitivity is frequently discussed in Drosophila, with reviews summarizing that cry mutants lose magnetic-field-dependent behaviors
- term:
id: GO:0042752
label: regulation of circadian rhythm
evidence_type: IDA
original_reference_id: PMID:16510731
review:
summary: CRY contributes to regulation of circadian rhythm, and this study highlights
light-responsive pacemaker neuron behavior.
action: ACCEPT
reason: Pacemaker neuron light responses are consistent with CRY-dependent circadian
regulation supported by additional literature.
additional_reference_ids: ["PMID:9845369"]
supported_by:
- reference_id: PMID:16510731
supporting_text: respond differently to light and can be completely desynchronized
from one another by constant light
- reference_id: PMID:9845369
supporting_text: CRY, a Drosophila clock and light-regulated cryptochrome,
is a major contributor to circadian rhythm resetting and photosensitivity.
- term:
id: GO:0007602
label: phototransduction
evidence_type: IMP
original_reference_id: PMID:18056988
review:
summary: The study supports CRY as a circadian photoreceptor, but phototransduction
is broader than demonstrated.
action: MODIFY
reason: Evidence supports photoreceptor activity, not a complete phototransduction
cascade annotation.
proposed_replacement_terms:
- id: GO:0009881
label: photoreceptor activity
supported_by:
- reference_id: PMID:18056988
supporting_text: Type 1 CRYs, the prototype of which is the Drosophila CRY,
that is known to be a circadian photoreceptor.
- term:
id: GO:0009881
label: photoreceptor activity
evidence_type: IMP
original_reference_id: PMID:18056988
review:
summary: Drosophila CRY is a circadian photoreceptor.
action: ACCEPT
reason: The paper explicitly describes Drosophila CRY as a circadian photoreceptor.
supported_by:
- reference_id: PMID:18056988
supporting_text: Type 1 CRYs, the prototype of which is the Drosophila CRY,
that is known to be a circadian photoreceptor.
- term:
id: GO:0050660
label: flavin adenine dinucleotide binding
evidence_type: IDA
original_reference_id: PMID:18056988
review:
summary: Type 1 CRYs contain FAD when purified.
action: ACCEPT
reason: The study reports FAD in purified insect CRYs including Drosophila.
supported_by:
- reference_id: PMID:18056988
supporting_text: Cryptochromes from all four sources contain FAD(ox) when
purified, and the flavin is readily reduced to FAD(*-) by light
- term:
id: GO:0043153
label: entrainment of circadian clock by photoperiod
evidence_type: IMP
original_reference_id: PMID:14960620
review:
summary: CRY mediates photic input to the circadian clock.
action: ACCEPT
reason: The study identifies cryptochrome as a photopigment in brain clock neurons
affecting light responses.
supported_by:
- reference_id: PMID:14960620
supporting_text: The other involves a presumptive photopigment, cryptochrome
(cry), expressed in lateral brain neurons that control behavioral rhythms
- term:
id: GO:0045475
label: locomotor rhythm
evidence_type: IMP
original_reference_id: PMID:17068124
review:
summary: CRY-dependent light input affects behavioral rhythmicity.
action: KEEP_AS_NON_CORE
reason: The study reports maintenance of behavioral rhythmicity under constant
light in CRY pathway variants, consistent with locomotor rhythm modulation.
supported_by:
- reference_id: PMID:17068124
supporting_text: these genetically altered flies maintain behavioral and
molecular rhythmicity under constant-light conditions that usually stop
the clock
- term:
id: GO:0009649
label: entrainment of circadian clock
evidence_type: IMP
original_reference_id: PMID:15996552
review:
summary: Light entrainment involves light-induced TIM degradation in a CRY-dependent
pathway.
action: ACCEPT
reason: The study links light entrainment to TIM degradation and notes interaction
with CRY pathway components.
supported_by:
- reference_id: PMID:15996552
supporting_text: Entrainment of the Drosophila circadian clock to light
involves the light-induced degradation of the clock protein timeless (TIM).
- term:
id: GO:0005634
label: nucleus
evidence_type: IDA
original_reference_id: PMID:10417378
review:
summary: CRY-containing complexes reside primarily in the nucleus after light
perception.
action: ACCEPT
reason: The study describes nuclear localization of CRY/PER/TIM complexes after
light.
supported_by:
- reference_id: PMID:10417378
supporting_text: PER/TIM and CRY influence the subcellular distribution
of these protein complexes, which reside primarily in the nucleus after
the perception of a light signal.
- term:
id: GO:0009416
label: response to light stimulus
evidence_type: IMP
original_reference_id: PMID:15258584
review:
summary: Light-activated CRY regulates circadian photoresponses.
action: ACCEPT
reason: The study directly links CRY activation by light to circadian photoresponses.
supported_by:
- reference_id: PMID:15258584
supporting_text: Light-activated cryptochrome (CRY) regulates circadian
photoresponses in Drosophila melanogaster.
- term:
id: GO:0009588
label: UV-A, blue light phototransduction
evidence_type: ISS
original_reference_id: PMID:10233998
review:
summary: DCry is an extraretinal blue-light photoreceptor implicated in circadian
photoresponses.
action: ACCEPT
reason: The study identifies DCry as a blue-light photoreceptor in brain clock
neurons.
supported_by:
- reference_id: PMID:10233998
supporting_text: We now have identified and characterized a candidate blue
light photoreceptor gene in Drosophila (DCry)
- term:
id: GO:0009649
label: entrainment of circadian clock
evidence_type: IMP
original_reference_id: PMID:12417651
review:
summary: Light entrainment involves the eyelet and cryptochrome pathways.
action: ACCEPT
reason: The study reports that eyelet together with cryptochrome mediates phase
delays in entrainment.
supported_by:
- reference_id: PMID:12417651
supporting_text: eyelet together with cryptochrome mainly mediates phase
delays.
- term:
id: GO:0042332
label: gravitaxis
evidence_type: IMP
original_reference_id: PMID:12042820
review:
summary: |-
cry mutants show altered geotaxis scores, supporting a role in gravitaxis. This is a
pleiotropic behavioral effect rather than the core circadian photoreceptor function;
the falcon deep research does not feature gravitaxis among CRY's well-established roles.
action: KEEP_AS_NON_CORE
reason: |-
The full text reports that homozygous cry mutants significantly increase geotaxis
scores, but this is a downstream/pleiotropic behavioral phenotype, not a core function.
supported_by:
- reference_id: PMID:12042820
supporting_text: genes that contribute to the complex, polygenic behavior
of geotaxis
supporting_text_fulltext: Homozygous null mutants of Pdf and cry showed
a significant increase in geotaxis score,
- term:
id: GO:0043153
label: entrainment of circadian clock by photoperiod
evidence_type: IMP
original_reference_id: PMID:15258584
review:
summary: CRY activation by light affects circadian photoresponses and entrainment.
action: ACCEPT
reason: Light-activated CRY regulates photoresponses consistent with photoperiod
entrainment.
supported_by:
- reference_id: PMID:15258584
supporting_text: Light-activated cryptochrome (CRY) regulates circadian
photoresponses in Drosophila melanogaster.
- term:
id: GO:0043153
label: entrainment of circadian clock by photoperiod
evidence_type: IMP
original_reference_id: PMID:16361445
review:
summary: Light entraining signals require CRY-dependent pathways.
action: ACCEPT
reason: The study states that cryptochrome-mediated pathways provide entraining
light signals to the clock.
supported_by:
- reference_id: PMID:16361445
supporting_text: cryptochrome are also critical in providing the circadian
clock with entraining light signals from the environment
core_functions:
- description: Blue-light photoreceptor that provides light input to the circadian
clock via light-dependent interactions with core clock components.
molecular_function:
id: GO:0009882
label: blue light photoreceptor activity
supported_by:
- reference_id: PMID:10063806
supporting_text: suggesting that the protein is not a DNA repair enzyme but
a blue-light photoreceptor.
- reference_id: PMID:10417378
supporting_text: Thus, CRY acts as a circadian photoreceptor by directly interacting
with core components of the circadian clock.
locations:
- id: GO:0005737
label: cytoplasm
- id: GO:0005634
label: nucleus
- description: Binds flavin adenine dinucleotide (FAD) as the chromophore/cofactor
for light sensing.
molecular_function:
id: GO:0071949
label: FAD binding
supported_by:
- reference_id: PMID:10063806
supporting_text: Purified recombinant protein contained a flavin adenine dinucleotide
chromophore.
references:
- id: GO_REF:0000033
title: Annotation inferences using phylogenetic trees
findings: []
- id: GO_REF:0000043
title: Gene Ontology annotation based on UniProtKB/Swiss-Prot keyword mapping
findings: []
- id: GO_REF:0000044
title: Gene Ontology annotation based on UniProtKB/Swiss-Prot Subcellular Location
vocabulary mapping, accompanied by conservative changes to GO terms applied
by UniProt
findings: []
- id: GO_REF:0000117
title: Electronic Gene Ontology annotations created by ARBA machine learning models
findings: []
- id: PMID:10063806
title: A putative blue-light receptor from Drosophila melanogaster.
findings: []
- id: PMID:10233998
title: An extraretinally expressed insect cryptochrome with similarity to the
blue light photoreceptors of mammals and plants.
findings: []
- id: PMID:10417378
title: Light-dependent sequestration of TIMELESS by CRYPTOCHROME.
findings: []
- id: PMID:10839367
title: Drosophila CRY is a deep brain circadian photoreceptor.
findings: []
- id: PMID:11357134
title: A new role for cryptochrome in a Drosophila circadian oscillator.
findings: []
- id: PMID:11448767
title: Light-dependent interaction between Drosophila CRY and the clock protein
PER mediated by the carboxy terminus of CRY.
findings: []
- id: PMID:12042820
title: Identification of genes involved in Drosophila melanogaster geotaxis, a
complex behavioral trait.
findings: []
- id: PMID:12417651
title: 'The extraretinal eyelet of Drosophila: development, ultrastructure, and
putative circadian function.'
findings: []
- id: PMID:14960620
title: Novel features of cryptochrome-mediated photoreception in the brain circadian
clock of Drosophila.
findings: []
- id: PMID:15258584
title: A constitutively active cryptochrome in Drosophila melanogaster.
findings: []
- id: PMID:15996552
title: Serotonin modulates circadian entrainment in Drosophila.
findings: []
- id: PMID:16361445
title: Disruption of Cryptochrome partially restores circadian rhythmicity to
the arrhythmic period mutant of Drosophila.
findings: []
- id: PMID:16510731
title: Functional analysis of circadian pacemaker neurons in Drosophila melanogaster.
findings: []
- id: PMID:16527739
title: Drosophila CRYPTOCHROME is a circadian transcriptional repressor.
findings: []
- id: PMID:16794082
title: JETLAG resets the Drosophila circadian clock by promoting light-induced
degradation of TIMELESS.
findings: []
- id: PMID:17068124
title: Veela defines a molecular link between Cryptochrome and Timeless in the
light-input pathway to Drosophila's circadian clock.
findings: []
- id: PMID:17298948
title: A novel photoreaction mechanism for the circadian blue light photoreceptor
Drosophila cryptochrome.
findings: []
- id: PMID:17418796
title: The Drosophila circadian network is a seasonal timer.
findings: []
- id: PMID:18044989
title: Light activates output from evening neurons and inhibits output from morning
neurons in the Drosophila circadian clock.
findings: []
- id: PMID:18056988
title: Animal type 1 cryptochromes. Analysis of the redox state of the flavin
cofactor by site-directed mutagenesis.
findings: []
- id: PMID:18399544
title: Cryptochrome is present in the compound eyes and a subset of Drosophila's
clock neurons.
findings: []
- id: PMID:18597555
title: Human and Drosophila cryptochromes are light activated by flavin photoreduction
in living cells.
findings: []
- id: PMID:18663237
title: The blue-light photoreceptor CRYPTOCHROME is expressed in a subset of circadian
oscillator neurons in the Drosophila CNS.
findings: []
- id: PMID:18641630
title: Cryptochrome mediates light-dependent magnetosensitivity in Drosophila.
findings: []
- id: PMID:19355790
title: Cryptochrome mediates light-dependent magnetosensitivity of Drosophila's
circadian clock.
findings: []
- id: PMID:20098414
title: Animal cryptochromes mediate magnetoreception by an unconventional photochemical
mechanism.
findings: []
- id: PMID:21187431
title: Reaction mechanism of Drosophila cryptochrome.
findings: []
- id: PMID:22080955
title: Structure of full-length Drosophila cryptochrome.
findings: []
- id: PMID:21135155
title: Cryptochrome-positive and -negative clock neurons in Drosophila entrain
differentially to light and temperature.
findings: []
- id: PMID:22306971
title: Rhodopsin 5- and Rhodopsin 6-mediated clock synchronization in Drosophila
melanogaster is independent of retinal phospholipase C-Ξ² signaling.
findings: []
- id: PMID:23746849
title: Structures of Drosophila cryptochrome and mouse cryptochrome1 provide insight
into circadian function.
findings: []
- id: PMID:24297896
title: Flavin reduction activates Drosophila cryptochrome.
findings: []
- id: PMID:25148297
title: Effects of light interruption on sleep and viability of Drosophila melanogaster.
findings: []
- id: PMID:28489826
title: A rhodopsin in the brain functions in circadian photoentrainment in Drosophila.
findings: []
- id: PMID:28840790
title: A New Rhodopsin Influences Light-dependent Daily Activity Patterns of Fruit
Flies.
findings: []
- id: PMID:37100907
title: Cryptochrome-Timeless structure reveals circadian clock timing mechanisms.
findings: []
- id: PMID:9845369
title: CRY, a Drosophila clock and light-regulated cryptochrome, is a major contributor
to circadian rhythm resetting and photosensitivity.
findings: []
- id: PMID:9845370
title: The cryb mutation identifies cryptochrome as a circadian photoreceptor
in Drosophila.
findings: []
- id: Reactome:R-DME-432371
title: CRY is activated by light and binds to phosphorylated nuclear TIM
findings: []
- id: Reactome:R-DME-432378
title: Nuclear JET binds CRY, facilitating its ubiquitination
findings: []
- id: Reactome:R-DME-432401
title: JET binds cytosolic TIM, facilitating its ubiquitination
findings: []
- id: Reactome:R-DME-432424
title: JET binds phosphorylated nuclear TIM, facilitating its ubiquitination
findings: []
- id: Reactome:R-DME-432426
title: CRY is activated by light and binds to cytosolic TIM
findings: []
- id: Reactome:R-DME-432428
title: Cytosolic CRY is degraded by the 26S proteasome
findings: []
- id: Reactome:R-DME-432593
title: Cytosolic JET binds to CRY, facilitating its ubiquitination
findings: []
- id: Reactome:R-DME-432652
title: Nuclear CRY is degraded by the 26S proteasome
findings: []
- id: Reactome:R-DME-881988
title: CRY is phosphorylated by SGG
findings: []
- id: file:genes/DROME/CRY/CRY-deep-research-cyberian.md
title: Deep research on Drosophila cry via Cyberian
findings: []
- id: file:DROME/CRY/CRY-deep-research-falcon.md
title: Falcon deep research report on Drosophila melanogaster cry (CRY, O77059)
findings:
- statement: |
DmCRY (UniProt O77059, CG3772) is a Drosophila-type/type I cryptochrome in the DNA
photolyase/cryptochrome family that binds FAD and functions primarily as a blue-light
photoreceptor for circadian clock entrainment.
reference_section_type: OTHER
supporting_text: |-
The UniProt accession **O77059** corresponds to **Drosophila melanogaster Cryptochrome-1 (DmCRY; gene symbol cry; ORF CG3772)**, a **Drosophila-type/type I cryptochrome** within the **DNA photolyase/cryptochrome family** that **binds FAD** and functions primarily as a **blue-light photoreceptor** for circadian clock entrainment.
- statement: |
In the canonical pathway, light-activated CRY binds TIMELESS (TIM) and triggers TIM
degradation via recruitment of the E3 ubiquitin ligase Jetlag (JET), resetting the
circadian oscillator.
reference_section_type: OTHER
supporting_text: |-
In the canonical pathway, light-activated CRY **binds Timeless (TIM)** and triggers **TIM degradation** via recruitment of the **E3 ubiquitin ligase Jetlag (JET)**, thereby resetting the circadian oscillator.
- statement: |
The Drosophila CRY light-sensing role is mechanistically distinct from mammalian-type
(type II) cryptochromes, which are light-independent transcriptional repressors in the
core clock feedback loop.
reference_section_type: OTHER
supporting_text: |-
This Drosophila light-sensing role is mechanistically distinct from **vertebrate/mammalian-type (type II) cryptochromes**, which are described primarily as **light-independent transcriptional repressors** in the core clock feedback loop.
- statement: |
Cryptochromes are structurally related to DNA photolyases but generally lack DNA repair
activity and instead serve as sensory/signaling proteins; DmCRY is a cell-autonomous
circadian photoreceptor.
reference_section_type: OTHER
supporting_text: |-
Cryptochromes are structurally related to UV/blue-sensitive **DNA photolyases** but generally lack DNA repair activity and instead serve as **sensory/signaling proteins**.
- statement: |
A quantitative binding study supports CTT-gated TIM recognition: WT CRY binds TIM more
strongly in light than dark (KD,dark ~32 uM vs KD,light ~9 uM), while CTT deletion gives
constitutive high-affinity binding (KD ~1.7 uM).
reference_section_type: OTHER
supporting_text: |-
WT CRY binds TIM more strongly in light than dark (**KD,dark β 32 Β΅M** vs **KD,light β 9 Β΅M**), while CTT deletion yields **constitutive high-affinity binding** (**KD β 1.7 Β΅M**).
- statement: |
A 2023 cryo-EM CRY-TIM structure (3.3 A; PDB 8DD7 / EMDB-27335) shows TIM inserts its
N-terminus into the CRY flavin pocket, replacing the CRY CTT.
reference_section_type: OTHER
supporting_text: |-
For the peer-reviewed Nature cryo-EM dataset (Apr 2023), the reported reconstruction statistics include **3.3 Γ
map resolution (2.4β5.5 Γ
range)** and deposition **PDB 8DD7 / EMDB-27335**, supporting confidence in residue-level interface interpretation.
- statement: |
FAD binding is not only photochemical but also a structural requirement for CRY to reach
a signaling-competent native fold.
reference_section_type: OTHER
supporting_text: |-
These data support a functional-annotation view in which **FAD binding is not only photochemical but also a structural requirement** to reach a signaling-competent native fold.
- statement: |
In compound eyes, CRY can act as a structural/assembling factor in rhabdomeres,
interacting with actin; this rhabdomeric pool is not degraded by light, consistent with
a stable scaffolding role.
reference_section_type: OTHER
supporting_text: |-
In compound eyes, CRY can act as a **structural/assembling factor** in rhabdomeres: it interacts with **actin** and is proposed to maintain the phototransduction βsignalplexβ near the membrane, enhancing light sensitivity and thereby contributing to eye-mediated clock light input. This rhabdomeric CRY pool is reported as **not degraded by light**, consistent with a stable scaffolding role.
- statement: |
Beyond entrainment, Drosophila CRY contributes to non-canonical roles including
arousal/UV avoidance, visual photoreception, and magnetic field detection.
reference_section_type: OTHER
supporting_text: |-
Drosophila CRY contributes to **arousal/UV avoidance**, **visual photoreception**, and **magnetic field detection**, and can influence circadian amplitude through light-independent mechanisms in a tissue-dependent fashion.
- statement: |
Loss of CRY (cry01) alters metabolic physiology, including triglyceride dynamics,
starvation resistance, and lifespan.
reference_section_type: OTHER
supporting_text: |-
A 2024 peer-reviewed study reports that loss of CRY (cry01) alters metabolic physiology, including triglyceride dynamics, starvation resistance, and lifespan.
- id: file:interpro/panther/PTHR11455/PTHR11455-notes.md
title: PANTHER family PTHR11455 (CRYPTOCHROME) summary
findings: []
- id: PDB:4GU5
title: Structure of full-length Drosophila cryptochrome
findings: []
- id: PDB:8DD7
title: Cry-Timeless complex (Drosophila) by cryo-EM
findings: []