BioReason Chat Export

Exported on March 22, 2026 at 02:17 AM

Organism: Escherichia coli

Sequence:

MRIVTAAVMASTLAVSSLSHAAEVGSGDNWHPGEELTQRSTQSHMFDGISLTEHQRQQMRDLMQQARHEQPPVNVSELETMHRLVTAENFDENAVRAQAEKMANEQIARQVEMAKVRNQMYRLLTPEQQAVLNEKHQQRMEQLRDVTQWQKSSSLKLLSSSNSRSQ

Thinking Trace

The architecture begins with IPR052211 (Cpx two-component system auxiliary protein family) spanning residues 1–155 and is overlapped internally by IPR012899 (LTXXQ motif family protein) from residues 6–144. The full-length coverage of the auxiliary Cpx-SpvX family signature at the N-terminus and across the core of the protein establishes a dedicated adaptor/scaffold rather than an enzyme. The embedded LTXXQ motif family signature points to a conserved structural module often used to stabilize oligomeric assemblies and mediate protein–protein interfaces. The absence of catalytic domain hallmarks and the dominance of interaction-centric families together indicate a non-enzymatic regulator that binds partners to modulate signal flow.

From this domain logic, the molecular function resolves to multivalent protein binding (GO:0005515). An auxiliary module that couples to a membrane sensor/transducer system achieves function by physically organizing the signaling complex rather than performing chemistry. Such an adaptor can bias the assembly and lifetime of the Cpx two-component pathway by tuning the association of the periplasmic sensor with cytosolic response regulators and associated RNA-binding effectors.

This binding-driven modulation situates the protein squarely within signal transduction (GO:0007165). By stabilizing or accelerating exchange within the Cpx pathway, the auxiliary factor can influence envelope-stress signaling cascades that govern transcriptional and post-transcriptional responses. The LTXXQ motif’s scaffold-like behavior supports a mechanism where transient oligomers and surface-exposed patches choreograph partner recruitment and turnover, thereby shaping downstream signaling dynamics.

Cellular localization follows from both the soluble interaction architecture and the functional coupling to envelope-stress signaling. The lack of transmembrane domains and the soluble nature implied by the family signatures point to the cytoplasm (GO:0005737), where the adaptor can access cytosolic faces of membrane-associated complexes and cytoplasmic response regulators. Cytoplasmic residence also allows rapid exchange with RNA-associated assemblies that interpret Cpx outputs.

Mechanistically, the protein likely nucleates a periplasm-to-cytosol signaling node by binding cytosolic components of the Cpx system and allied RNA-binding assemblies. By favoring specific oligomeric states and partner availabilities, it can increase the fidelity and speed of Cpx-mediated signal propagation. Expected partners include the membrane-associated sensor/transducer, periplasm-proximal folding modules that feed into Cpx, and cytosolic response regulators and RNA-binding proteins that execute the transcriptional/post-transcriptional arms of the pathway. Together, these interactions produce a tunable cytoplasmic hub that conditions envelope-stress signaling fidelity.

Functional Summary

A soluble cytoplasmic auxiliary factor that assembles and stabilizes the envelope-stress signaling hub governed by the Cpx two-component pathway in Escherichia coli. By using a conserved interaction module to form transient oligomers, it binds pathway partners and conditions the assembly and lifetime of the signaling complex, thereby tuning downstream transcriptional and post-transcriptional responses without catalysis.

UniProt Summary

Auxiliary component of the Cpx stress protein system.

InterPro Domains

• Cpx two-component system auxiliary protein (IPR052211, family) — residues 1-155
• LTXXQ motif family protein (IPR012899, family) — residues 6-144

GO Terms

Molecular Function: molecular_function (GO:0003674), binding (GO:0005488), ion binding (GO:0043167), protein binding (GO:0005515), identical protein binding (GO:0042802), cation binding (GO:0043169), metal ion binding (GO:0046872), transition metal ion binding (GO:0046914), zinc ion binding (GO:0008270)

Biological Process: biological_process (GO:0008150), cellular process (GO:0009987), protein folding (GO:0006457), chaperone-mediated protein folding (GO:0061077)

Cellular Component: cellular_component (GO:0005575), cellular anatomical entity (GO:0110165), intracellular anatomical structure (GO:0005622), organelle (GO:0043226), envelope (GO:0031975), membrane (GO:0016020), cytoplasm (GO:0005737), organelle membrane (GO:0031090), organelle envelope (GO:0031967), photosynthetic membrane (GO:0034357), intracellular organelle (GO:0043229), outer membrane (GO:0019867), membrane-bounded organelle (GO:0043227), mitochondrial envelope (GO:0005740), organelle outer membrane (GO:0031968), intracellular membrane-bounded organelle (GO:0043231), bounding membrane of organelle (GO:0098588), mitochondrial membrane (GO:0031966), mitochondrial outer membrane (GO:0005741)

Generated by BioReason

BioReason Chat Export

Exported on March 22, 2026 at 02:17 AM

Organism: Escherichia coli

Sequence:

MRIVTAAVMASTLAVSSLSHAAEVGSGDNWHPGEELTQRSTQSHMFDGISLTEHQRQQMRDLMQQARHEQPPVNVSELETMHRLVTAENFDENAVRAQAEKMANEQIARQVEMAKVRNQMYRLLTPEQQAVLNEKHQQRMEQLRDVTQWQKSSSLKLLSSSNSRSQ

Thinking Trace

The architecture begins with IPR052211 (Cpx two-component system auxiliary protein family) spanning residues 1–155 and is overlapped internally by IPR012899 (LTXXQ motif family protein) from residues 6–144. The full-length coverage of the auxiliary Cpx-SpvX family signature at the N-terminus and across the core of the protein establishes a dedicated adaptor/scaffold rather than an enzyme. The embedded LTXXQ motif family signature points to a conserved structural module often used to stabilize oligomeric assemblies and mediate protein–protein interfaces. The absence of catalytic domain hallmarks and the dominance of interaction-centric families together indicate a non-enzymatic regulator that binds partners to modulate signal flow.

From this domain logic, the molecular function resolves to multivalent protein binding (GO:0005515). An auxiliary module that couples to a membrane sensor/transducer system achieves function by physically organizing the signaling complex rather than performing chemistry. Such an adaptor can bias the assembly and lifetime of the Cpx two-component pathway by tuning the association of the periplasmic sensor with cytosolic response regulators and associated RNA-binding effectors.

This binding-driven modulation situates the protein squarely within signal transduction (GO:0007165). By stabilizing or accelerating exchange within the Cpx pathway, the auxiliary factor can influence envelope-stress signaling cascades that govern transcriptional and post-transcriptional responses. The LTXXQ motif’s scaffold-like behavior supports a mechanism where transient oligomers and surface-exposed patches choreograph partner recruitment and turnover, thereby shaping downstream signaling dynamics.

Cellular localization follows from both the soluble interaction architecture and the functional coupling to envelope-stress signaling. The lack of transmembrane domains and the soluble nature implied by the family signatures point to the cytoplasm (GO:0005737), where the adaptor can access cytosolic faces of membrane-associated complexes and cytoplasmic response regulators. Cytoplasmic residence also allows rapid exchange with RNA-associated assemblies that interpret Cpx outputs.

Mechanistically, the protein likely nucleates a periplasm-to-cytosol signaling node by binding cytosolic components of the Cpx system and allied RNA-binding assemblies. By favoring specific oligomeric states and partner availabilities, it can increase the fidelity and speed of Cpx-mediated signal propagation. Expected partners include the membrane-associated sensor/transducer, periplasm-proximal folding modules that feed into Cpx, and cytosolic response regulators and RNA-binding proteins that execute the transcriptional/post-transcriptional arms of the pathway. Together, these interactions produce a tunable cytoplasmic hub that conditions envelope-stress signaling fidelity.

Functional Summary

A soluble cytoplasmic auxiliary factor that assembles and stabilizes the envelope-stress signaling hub governed by the Cpx two-component pathway in Escherichia coli. By using a conserved interaction module to form transient oligomers, it binds pathway partners and conditions the assembly and lifetime of the signaling complex, thereby tuning downstream transcriptional and post-transcriptional responses without catalysis.

UniProt Summary

Auxiliary component of the Cpx stress protein system.

InterPro Domains

• Cpx two-component system auxiliary protein (IPR052211, family) — residues 1-155
• LTXXQ motif family protein (IPR012899, family) — residues 6-144

GO Terms

Molecular Function: molecular_function (GO:0003674), binding (GO:0005488), ion binding (GO:0043167), protein binding (GO:0005515), identical protein binding (GO:0042802), cation binding (GO:0043169), metal ion binding (GO:0046872), transition metal ion binding (GO:0046914), zinc ion binding (GO:0008270)

Biological Process: biological_process (GO:0008150), cellular process (GO:0009987), protein folding (GO:0006457), chaperone-mediated protein folding (GO:0061077)

Cellular Component: cellular_component (GO:0005575), cellular anatomical entity (GO:0110165), intracellular anatomical structure (GO:0005622), organelle (GO:0043226), envelope (GO:0031975), membrane (GO:0016020), cytoplasm (GO:0005737), organelle membrane (GO:0031090), organelle envelope (GO:0031967), photosynthetic membrane (GO:0034357), intracellular organelle (GO:0043229), outer membrane (GO:0019867), membrane-bounded organelle (GO:0043227), mitochondrial envelope (GO:0005740), organelle outer membrane (GO:0031968), intracellular membrane-bounded organelle (GO:0043231), bounding membrane of organelle (GO:0098588), mitochondrial membrane (GO:0031966), mitochondrial outer membrane (GO:0005741)

Generated by BioReason

provider: falcon
model: Edison Scientific Literature
cached: false
start_time: '2026-03-22T17:57:47.961832'
end_time: '2026-03-22T18:12:58.717849'
duration_seconds: 910.76
template_file: templates/gene_research_go_focused.md
template_variables:
organism: ECOLI
gene_id: CpxP
gene_symbol: cpxP
uniprot_accession: P0AE85
protein_description: 'RecName: Full=Periplasmic protein CpxP {ECO:0000303|PubMed:9473036};
AltName: Full=ORF_o167 {ECO:0000303|PubMed:8346018}; AltName: Full=Periplasmic
accessory protein CpxP; Flags: Precursor;'
gene_info: Name=cpxP {ECO:0000303|PubMed:9473036}; Synonyms=yiiO; OrderedLocusNames=b4484,
JW5558;
organism_full: Escherichia coli (strain K12).
protein_family: Belongs to the CpxP/Spy family. .
protein_domains: Cpx_auxiliary_protein. (IPR052211); LTXXQ. (IPR012899); LTXXQ (PF07813)
provider_config:
timeout: 600
max_retries: 3
parameters:
allowed_domains: []
temperature: 0.1
citation_count: 50

Question

Gene Research for Functional Annotation

⚠️ CRITICAL: Gene/Protein Identification Context

BEFORE YOU BEGIN RESEARCH: You MUST verify you are researching the CORRECT gene/protein. Gene symbols can be ambiguous, especially for less well-characterized genes from non-model organisms.

Target Gene/Protein Identity (from UniProt):

• UniProt Accession: P0AE85
• Protein Description: RecName: Full=Periplasmic protein CpxP {ECO:0000303|PubMed:9473036}; AltName: Full=ORF_o167 {ECO:0000303|PubMed:8346018}; AltName: Full=Periplasmic accessory protein CpxP; Flags: Precursor;
• Gene Information: Name=cpxP {ECO:0000303|PubMed:9473036}; Synonyms=yiiO; OrderedLocusNames=b4484, JW5558;
• Organism (full): Escherichia coli (strain K12).
• Protein Family: Belongs to the CpxP/Spy family. .
• Key Domains: Cpx_auxiliary_protein. (IPR052211); LTXXQ. (IPR012899); LTXXQ (PF07813)

MANDATORY VERIFICATION STEPS:

1. Check if the gene symbol "cpxP" matches the protein description above
2. Verify the organism is correct: Escherichia coli (strain K12).
3. Check if protein family/domains align with what you find in literature
4. If you find literature for a DIFFERENT gene with the same or similar symbol, STOP

If Gene Symbol is Ambiguous or You Cannot Find Relevant Literature:

DO NOT PROCEED WITH RESEARCH ON A DIFFERENT GENE. Instead:
- State clearly: "The gene symbol 'cpxP' is ambiguous or literature is limited for this specific protein"
- Explain what you found (e.g., "Found extensive literature on a different gene with the same symbol in a different organism")
- Describe the protein based ONLY on the UniProt information provided above
- Suggest that the protein function can be inferred from domain/family information

Research Target:

Please provide a comprehensive research report on the gene cpxP (gene ID: CpxP, UniProt: P0AE85) in ECOLI.

The research report should be a detailed narrative explaining the function, biological processes, and localization of the gene product. Citations should be given for all claims.

You should prioritize authoritative reviews and primary scientific literature when conducting research. You can supplement
this with annotations you find in gene/protein databases, but these can be outdated or inaccurate.

We are specifically interested in the primary function of the gene - for enzymes, what reaction is catalyzed, and what is the substrate specificity? For transporters, what is the substrate? For structural proteins or adapters, what is the broader structural role? For signaling molecules, what is the role in the pathway.

We are interested in where in or outside the cell the gene product carries out its function.

We are also interested in the signaling or biochemical pathways in which the gene functions. We are less interested in broad pleiotropic effects, except where these elucidate the precise role.

Include evidence where possible. We are interested in both experimental evidence as well as inference from structure, evolution, or bioinformatic analysis. Precise studies should be prioritized over high-throughput, where available.

Output

Question: You are an expert researcher providing comprehensive, well-cited information.

Provide detailed information focusing on:
1. Key concepts and definitions with current understanding
2. Recent developments and latest research (prioritize 2023-2024 sources)
3. Current applications and real-world implementations
4. Expert opinions and analysis from authoritative sources
5. Relevant statistics and data from recent studies

Format as a comprehensive research report with proper citations. Include URLs and publication dates where available.
Always prioritize recent, authoritative sources and provide specific citations for all major claims.

Gene Research for Functional Annotation

⚠️ CRITICAL: Gene/Protein Identification Context

BEFORE YOU BEGIN RESEARCH: You MUST verify you are researching the CORRECT gene/protein. Gene symbols can be ambiguous, especially for less well-characterized genes from non-model organisms.

Target Gene/Protein Identity (from UniProt):

• UniProt Accession: P0AE85
• Protein Description: RecName: Full=Periplasmic protein CpxP {ECO:0000303|PubMed:9473036}; AltName: Full=ORF_o167 {ECO:0000303|PubMed:8346018}; AltName: Full=Periplasmic accessory protein CpxP; Flags: Precursor;
• Gene Information: Name=cpxP {ECO:0000303|PubMed:9473036}; Synonyms=yiiO; OrderedLocusNames=b4484, JW5558;
• Organism (full): Escherichia coli (strain K12).
• Protein Family: Belongs to the CpxP/Spy family. .
• Key Domains: Cpx_auxiliary_protein. (IPR052211); LTXXQ. (IPR012899); LTXXQ (PF07813)

MANDATORY VERIFICATION STEPS:

1. Check if the gene symbol "cpxP" matches the protein description above
2. Verify the organism is correct: Escherichia coli (strain K12).
3. Check if protein family/domains align with what you find in literature
4. If you find literature for a DIFFERENT gene with the same or similar symbol, STOP

If Gene Symbol is Ambiguous or You Cannot Find Relevant Literature:

DO NOT PROCEED WITH RESEARCH ON A DIFFERENT GENE. Instead:
- State clearly: "The gene symbol 'cpxP' is ambiguous or literature is limited for this specific protein"
- Explain what you found (e.g., "Found extensive literature on a different gene with the same symbol in a different organism")
- Describe the protein based ONLY on the UniProt information provided above
- Suggest that the protein function can be inferred from domain/family information

Research Target:

Please provide a comprehensive research report on the gene cpxP (gene ID: CpxP, UniProt: P0AE85) in ECOLI.

The research report should be a detailed narrative explaining the function, biological processes, and localization of the gene product. Citations should be given for all claims.

You should prioritize authoritative reviews and primary scientific literature when conducting research. You can supplement
this with annotations you find in gene/protein databases, but these can be outdated or inaccurate.

We are specifically interested in the primary function of the gene - for enzymes, what reaction is catalyzed, and what is the substrate specificity? For transporters, what is the substrate? For structural proteins or adapters, what is the broader structural role? For signaling molecules, what is the role in the pathway.

We are interested in where in or outside the cell the gene product carries out its function.

We are also interested in the signaling or biochemical pathways in which the gene functions. We are less interested in broad pleiotropic effects, except where these elucidate the precise role.

Include evidence where possible. We are interested in both experimental evidence as well as inference from structure, evolution, or bioinformatic analysis. Precise studies should be prioritized over high-throughput, where available.

Research Report: Functional Annotation of cpxP (UniProt P0AE85) in Escherichia coli K-12

Executive summary

CpxP is a small periplasmic accessory protein that modulates the E. coli Cpx envelope stress response (CpxA–CpxR two-component system). Current evidence supports a dual functional role: (i) negative regulation of the sensor kinase CpxA under non-stress conditions, and (ii) protein quality-control adaptor/chaperone activity linked to the periplasmic protease/chaperone DegP, including co-degradation of CpxP with misfolded substrates. (isaac2005theextracytoplasmicadaptor pages 1-2, tschauner2014dynamicinteractionbetween pages 1-2, thede2011structureofthe pages 1-2)

1) Target verification (gene/protein identity)

Target confirmed: the retrieved primary literature and reviews consistently describe CpxP as the E. coli K-12 periplasmic protein encoded by cpxP (yiiO), functioning as an accessory regulator of the CpxA/CpxR envelope stress response and belonging to the CpxP/Spy (LTXXQ/PF07813) family, in agreement with the UniProt description provided. (thede2011structureofthe pages 1-2, buelow2005cpxsignaltransduction pages 1-2, isaac2005theextracytoplasmicadaptor pages 1-2)

2) Key concepts and definitions (current understanding)

2.1 The Cpx envelope stress response (Cpx ESR)

The Cpx ESR is an envelope surveillance and repair system centered on the inner-membrane histidine kinase CpxA and cytosolic response regulator CpxR. When activated, CpxA phosphorylates CpxR, which induces genes involved in envelope protein folding/turnover (including degP) and other adaptation programs. CpxP is a regulon member that participates in negative feedback on signaling. (isaac2005theextracytoplasmicadaptor pages 1-2, buelow2005cpxsignaltransduction pages 1-2, macritchie2009envelopestressresponses pages 7-8)

2.2 What CpxP is (functional definition)

CpxP is best described as a periplasmic auxiliary regulator (sometimes termed an inhibitor or adaptor) that (i) suppresses CpxA kinase output under basal conditions and (ii) participates in periplasmic protein quality control by assisting DegP-dependent proteolysis of specific misfolded envelope proteins, with CpxP itself being degraded as part of that process. (isaac2005theextracytoplasmicadaptor pages 1-2, thede2011structureofthe pages 1-2, wan2024regulatoryroleof pages 1-2)

3) Protein features relevant for functional annotation

3.1 Subcellular localization and processing

Across key primary studies, CpxP is repeatedly described as periplasmic. In Isaac et al. (2005), CpxP was purified using a cold osmotic shock protocol, consistent with periplasmic localization. (isaac2005theextracytoplasmicadaptor pages 1-2)

Limitations: In the retrieved text segments, the native Sec signal peptide and its precise cleavage site were not explicitly reported. However, structural work often used constructs lacking the extreme N-terminus (e.g., crystallized CpxP(40–151) in a dissertation), consistent with removal of an N-terminal leader region for soluble expression/crystallography rather than direct demonstration of signal peptidase cleavage. (thede2012biochemicalandstructural pages 82-87)

3.2 Structure and family/domain context (Spy/CpxP family)

A high-confidence, experimentally solved structure shows CpxP is a small (~147 aa) protein that forms an antiparallel dimer of intertwined α-helices, where each monomer resembles a hooked/bent hairpin. Conserved LTXXQ motifs help define the fold and family (PF07813), and the dimer presents a basic concave surface implicated in interactions. (thede2011structureofthe pages 1-2)

Figures from Thede et al. (2011) visually confirm the dimer architecture and motif placement, supporting the structural basis for functional hypotheses about protein–protein interactions in the periplasm. (thede2011structureofthe media fc052df4, thede2011structureofthe media d6756f7c)

4) Mechanistic role in the Cpx pathway (best-supported model)

4.1 Negative regulation of CpxA by CpxP

Multiple lines of evidence support that, in unstressed cells, CpxP associates with the periplasmic sensor domain of CpxA and reduces pathway output. Genetic and biochemical evidence indicates that overexpression of cpxP represses Cpx signaling, and that purified CpxP can inhibit CpxA autophosphorylation in reconstituted systems. (buelow2005cpxsignaltransduction pages 1-2, tschauner2014dynamicinteractionbetween pages 1-2)

Mechanistically, a widely used model is: CpxP binds CpxA under basal conditions to suppress autokinase activity; during stress, the inhibitory complex is disrupted, allowing CpxA activation and CpxR phosphorylation. (wan2024regulatoryroleof pages 1-2, macritchie2009envelopestressresponses pages 7-8)

4.2 Dynamic interaction and stress-dependent displacement

A key advance was direct in vivo evidence for CpxP–CpxA interaction and its dynamic disruption. Tschauner et al. (2014) demonstrated CpxP interacts with CpxA (bacterial two-hybrid and interaction experiments) and showed that high salt and a misfolded pilus subunit (PapE) can displace CpxP from CpxA in vivo, linking displacement to signal recognition. (tschauner2014dynamicinteractionbetween pages 1-2, tschauner2014dynamicinteractionbetween pages 2-3)

4.3 CpxP as adaptor/chaperone coupled to DegP proteolysis

A foundational primary study demonstrated that CpxP functions as an extracytoplasmic adaptor: it promotes DegP-dependent degradation of certain misfolded pilus subunits and CpxP is degraded by DegP along with the substrate, with misfolded substrate enhancing CpxP proteolysis. (isaac2005theextracytoplasmicadaptor pages 1-2)

Structural interpretation and later synthesis support a model where CpxP has mild chaperone activity—binding misfolded proteins (via a hydrophobic surface/groove proposed in structural analyses) to prevent aggregation and facilitate delivery to DegP—thereby coupling stress sensing, proteolysis, and negative feedback. (thede2012biochemicalandstructural pages 138-142, thede2012biochemicalandstructural pages 133-138)

5) Quantitative/experimental data useful for annotation

5.1 CpxP inhibition magnitude (reconstituted assays)

A mechanistic review and structural dissertation sources summarize biochemical reconstitution where a 1:1 CpxP:CpxA ratio reduces CpxA autokinase activity by ~50%, implying that additional determinants (membrane context, other factors, or partial occupancy) influence full repression. (macritchie2009envelopestressresponses pages 7-8, thede2012biochemicalandstructural pages 138-142)

5.2 Interaction strength (CpxA–CpxP versus CpxA–CpxR)

Hörnschemeyer et al. (2016) quantified interaction properties for membrane-embedded CpxA in nanodiscs. They reported that the CpxA–CpxR affinity increases ~10-fold in the presence of ATP, and that the CpxA–CpxP affinity is substantially lower than the CpxA–CpxR interaction (measured by microscale thermophoresis). The excerpt available did not include explicit Kd values, but it establishes relative interaction strengths and experimental modalities (SPR + MST) relevant for mechanistic modeling. (hornschemeyer2016interactionanalysisof pages 1-2)

5.3 Mutational evidence linking structure to function

Loss-of-function substitutions cluster near conserved motifs and surfaces implicated in protein–protein interactions; for example, structural analysis highlights mutations around the LTXXQ region and residues such as R60/D61 that can affect signaling inhibition and/or interactions. (thede2011structureofthe pages 1-2, thede2012biochemicalandstructural pages 133-138)

6) Recent developments and latest research (prioritizing 2023–2024)

6.1 2024 expert synthesis: CpxP as inhibitor and co-degraded adaptor

A 2024 review in Virulence describes CpxP as a periplasmic inhibitor that binds CpxA to keep it inactive, and emphasizes a quality-control mechanism where misfolded proteins titrate CpxP away from CpxA and DegP degrades the misfolded-protein–CpxP complex (and/or CpxP), linking stress sensing to proteostasis. The review also notes activation conditions including alkaline and saline stress as interfering with CpxP–CpxA binding. (wan2024regulatoryroleof pages 1-2)

6.2 2024 antimicrobial context: ESRs (including Cpx) as therapeutic leverage points

A 2024 Pathogens review frames envelope stress responses (including Cpx) as contributors to bacterial adaptation and antibiotic resistance. It explicitly summarizes CpxRA as comprising CpxA, CpxR, and the periplasmic negative regulator CpxP, with DegP relieving inhibition by degrading CpxP, and links Cpx activation to multidrug-resistance-associated phenotypes (e.g., efflux and envelope adaptation). While it does not provide CpxP-targeting drugs, it captures expert consensus that the pathway is an antimicrobial-relevant node. (bisht2024breakingbarriersexploiting pages 11-12)

6.3 2024 transcriptomics: strong cpxP induction under antimicrobial photodynamic therapy

A 2024 peer-reviewed RNA-seq study of sublethal antimicrobial photodynamic therapy (SAPYR-mediated aPDT) in stationary-phase E. coli reported 1,018 up-regulated and 648 down-regulated genes compared to irradiated controls. (muehler2024stressresponsein pages 1-3)

In this dataset, cpxP was strongly induced (RNA-seq log2FC 6.4, adjusted p = 4.1×10−99), with qRT-PCR validation (log2FC 6.4 in the same comparison; additional comparisons reported). This positions cpxP as a sensitive envelope-stress marker under clinically relevant antimicrobial stress modalities. (muehler2024stressresponsein pages 8-10, muehler2024stressresponsein pages 10-11)

6.4 2024 (preprint) functional deployment of cpxP as a Cpx readout

A 2024 bioRxiv preprint using Cpx biology in metabolic/redox contexts reported that NlpE overexpression (a known Cpx activator) caused an approximately 4-fold increase in cpxP expression under their growth condition (TBK medium), but that Cpx activation alone did not account for downstream metabolic changes in their system. (shrivastava2024anenvelopestress pages 7-8)

7) Current applications and real-world implementations

7.1 cpxP promoter reporters for pathway activity (screening and monitoring)

CpxP is widely used as a readout of Cpx pathway activation via promoter reporters (e.g., chromosomal cpxP′-lacZ fusions). These reporters enable quantitative measurement of ESR induction under defined stimuli (buffered pH shifts; NlpE induction), using standard ONPG β-galactosidase kinetics and normalization to OD600. (hs2024mechanismsofsensory pages 114-118, hs2024mechanismsofsensory pages 105-109)

A 2008 thesis describes practical workflows for indicator-plate screening (e.g., lactose-MacConkey), microtiter β-galactosidase assays, and mutagenesis screens that use cpxP reporters to discover regulators or perturbations affecting envelope stress signaling. (19802008characterizationofa pages 130-133)

7.2 Implications for antimicrobial development strategies

Cpx biology is relevant to antimicrobial strategy both as (i) a potential anti-virulence/adaptation target (inhibiting bacterial capacity to respond to envelope stress) and (ii) a potential killing strategy by hyper-activating envelope stress pathways to push cells into lethal dysregulation, as discussed in mechanistic analyses of two-component-system targeting concepts. (thede2012biochemicalandstructural pages 138-142)

8) Expert analysis and synthesis (authoritative interpretation)

8.1 Primary functional assignment

For functional annotation purposes, the best-supported primary function of CpxP in E. coli K-12 is:

1) Periplasmic negative feedback inhibitor of the CpxA–CpxR pathway (suppresses CpxA autokinase activity under basal conditions). (buelow2005cpxsignaltransduction pages 1-2, tschauner2014dynamicinteractionbetween pages 1-2, wan2024regulatoryroleof pages 1-2)

2) Periplasmic adaptor/chaperone-like factor that binds certain misfolded envelope proteins and promotes their DegP-dependent degradation, with CpxP itself being degraded with substrates, thereby coupling proteostasis to regulation of signaling amplitude and shutoff. (isaac2005theextracytoplasmicadaptor pages 1-2, thede2011structureofthe pages 1-2, wan2024regulatoryroleof pages 1-2)

8.2 Localization of function

CpxP’s functional site is the periplasm, acting at the interface with the periplasmic sensor domain of the inner membrane kinase CpxA and engaging the periplasmic protease/chaperone DegP. (tschauner2014dynamicinteractionbetween pages 1-2, isaac2005theextracytoplasmicadaptor pages 1-2)

8.3 What is not yet fully resolved

Despite strong evidence for periplasmic function and inhibitory/adaptor roles, several mechanistic details remain incompletely resolved in the retrieved corpus: (i) exact signal peptide cleavage parameters, (ii) high-resolution structural definition of the CpxP–CpxA complex, and (iii) substrate breadth for CpxP-dependent DegP targeting beyond specific tested misfolded pilus proteins. (thede2012biochemicalandstructural pages 82-87, thede2012biochemicalandstructural pages 133-138)

Evidence summary table

The following evidence map consolidates key findings, sources, and quantitative values.

Table: This table summarizes experimentally supported functional annotation for E. coli K-12 CpxP (UniProt P0AE85), including localization, structure, mechanism, DegP-linked quality control, stimuli, quantitative data, and recent 2024 transcriptomic evidence. It is useful as a compact evidence map for gene function and pathway context.

Key references (with publication dates and URLs)

• Isaac DD, Pinkner JS, Hultgren SJ, Silhavy TJ. 2005-12. PNAS. “The extracytoplasmic adaptor protein CpxP is degraded with substrate by DegP.” https://doi.org/10.1073/pnas.0508936102 (isaac2005theextracytoplasmicadaptor pages 1-2)
• Buelow DR, Raivio TL. 2005-10. Journal of Bacteriology. “Cpx signal transduction is influenced by a conserved N-terminal domain in the novel inhibitor CpxP and the periplasmic protease DegP.” https://doi.org/10.1128/JB.187.19.6622-6630.2005 (buelow2005cpxsignaltransduction pages 1-2)
• Thede GL et al. 2011-05. Journal of Bacteriology. “Structure of the periplasmic stress response protein CpxP.” https://doi.org/10.1128/JB.01296-10 (thede2011structureofthe pages 1-2)
• Tschauner K et al. 2014-09. PLoS ONE. “Dynamic interaction between the CpxA sensor kinase and the periplasmic accessory protein CpxP mediates signal recognition in E. coli.” https://doi.org/10.1371/journal.pone.0107383 (tschauner2014dynamicinteractionbetween pages 1-2)
• Hörnschemeyer P et al. 2016-02. PLoS ONE. “Interaction analysis of a two-component system using nanodiscs.” https://doi.org/10.1371/journal.pone.0149187 (hornschemeyer2016interactionanalysisof pages 1-2)
• Wan J, Gao X, Liu F. 2024-09. Virulence. “Regulatory role of the Cpx ESR in bacterial behaviours.” https://doi.org/10.1080/21505594.2024.2404951 (wan2024regulatoryroleof pages 1-2)
• Bisht R et al. 2024-10. Pathogens. “Breaking Barriers: Exploiting Envelope Biogenesis and Stress Responses to Develop Novel Antimicrobial Strategies in Gram-Negative Bacteria.” https://doi.org/10.3390/pathogens13100889 (bisht2024breakingbarriersexploiting pages 11-12)
• Muehler D et al. 2024-08. Photochemical & Photobiological Sciences. “Stress response in E. coli following sublethal phenalene-1-one mediated antimicrobial photodynamic therapy: an RNA-Seq study.” https://doi.org/10.1007/s43630-024-00617-3 (muehler2024stressresponsein pages 8-10)
• Shrivastava M et al. 2024-10 (preprint). bioRxiv. “An envelope stress response governs long-chain fatty acid metabolism via a small RNA to maintain redox homeostasis in E. coli.” https://doi.org/10.1101/2024.10.18.618624 (shrivastava2024anenvelopestress pages 7-8)

References

1. (isaac2005theextracytoplasmicadaptor pages 1-2): Daniel D. Isaac, Jerome S. Pinkner, Scott J. Hultgren, and Thomas J. Silhavy. The extracytoplasmic adaptor protein cpxp is degraded with substrate by degp. Proceedings of the National Academy of Sciences of the United States of America, 102 49:17775-9, Dec 2005. URL: https://doi.org/10.1073/pnas.0508936102, doi:10.1073/pnas.0508936102. This article has 219 citations and is from a highest quality peer-reviewed journal.

2. (tschauner2014dynamicinteractionbetween pages 1-2): Karolin Tschauner, Patrick Hörnschemeyer, Volker Steffen Müller, and Sabine Hunke. Dynamic interaction between the cpxa sensor kinase and the periplasmic accessory protein cpxp mediates signal recognition in e. coli. PLoS ONE, 9:e107383, Sep 2014. URL: https://doi.org/10.1371/journal.pone.0107383, doi:10.1371/journal.pone.0107383. This article has 75 citations and is from a peer-reviewed journal.

3. (thede2011structureofthe pages 1-2): Gina L. Thede, David C. Arthur, Ross A. Edwards, Daelynn R. Buelow, Julia L. Wong, Tracy L. Raivio, and J. N. Mark Glover. Structure of the periplasmic stress response protein cpxp. May 2011. URL: https://doi.org/10.1128/jb.01296-10, doi:10.1128/jb.01296-10. This article has 75 citations and is from a peer-reviewed journal.

4. (buelow2005cpxsignaltransduction pages 1-2): Daelynn R. Buelow and Tracy L. Raivio. Cpx signal transduction is influenced by a conserved n-terminal domain in the novel inhibitor cpxp and the periplasmic protease degp. Journal of Bacteriology, 187:6622-6630, Oct 2005. URL: https://doi.org/10.1128/jb.187.19.6622-6630.2005, doi:10.1128/jb.187.19.6622-6630.2005. This article has 119 citations and is from a peer-reviewed journal.

5. (macritchie2009envelopestressresponses pages 7-8): Dawn M. Macritchie and Tracy L. Raivio. Envelope stress responses. Dec 2009. URL: https://doi.org/10.1128/ecosalplus.5.4.7, doi:10.1128/ecosalplus.5.4.7. This article has 40 citations.

6. (wan2024regulatoryroleof pages 1-2): Jiajia Wan, Xuejun Gao, and Feng Liu. Regulatory role of the cpx esr in bacterial behaviours. Virulence, Sep 2024. URL: https://doi.org/10.1080/21505594.2024.2404951, doi:10.1080/21505594.2024.2404951. This article has 7 citations and is from a peer-reviewed journal.

7. (thede2012biochemicalandstructural pages 82-87): Gina L. Thede. Biochemical and structural characterization of cpxp and cpxa, key components of an envelope stress response in escherichia coli. Text, Sep 2012. URL: https://doi.org/10.7939/r31c7m, doi:10.7939/r31c7m. This article has 0 citations and is from a peer-reviewed journal.

8. (thede2011structureofthe media fc052df4): Gina L. Thede, David C. Arthur, Ross A. Edwards, Daelynn R. Buelow, Julia L. Wong, Tracy L. Raivio, and J. N. Mark Glover. Structure of the periplasmic stress response protein cpxp. May 2011. URL: https://doi.org/10.1128/jb.01296-10, doi:10.1128/jb.01296-10. This article has 75 citations and is from a peer-reviewed journal.

9. (thede2011structureofthe media d6756f7c): Gina L. Thede, David C. Arthur, Ross A. Edwards, Daelynn R. Buelow, Julia L. Wong, Tracy L. Raivio, and J. N. Mark Glover. Structure of the periplasmic stress response protein cpxp. May 2011. URL: https://doi.org/10.1128/jb.01296-10, doi:10.1128/jb.01296-10. This article has 75 citations and is from a peer-reviewed journal.

10. (tschauner2014dynamicinteractionbetween pages 2-3): Karolin Tschauner, Patrick Hörnschemeyer, Volker Steffen Müller, and Sabine Hunke. Dynamic interaction between the cpxa sensor kinase and the periplasmic accessory protein cpxp mediates signal recognition in e. coli. PLoS ONE, 9:e107383, Sep 2014. URL: https://doi.org/10.1371/journal.pone.0107383, doi:10.1371/journal.pone.0107383. This article has 75 citations and is from a peer-reviewed journal.

11. (thede2012biochemicalandstructural pages 138-142): Gina L. Thede. Biochemical and structural characterization of cpxp and cpxa, key components of an envelope stress response in escherichia coli. Text, Sep 2012. URL: https://doi.org/10.7939/r31c7m, doi:10.7939/r31c7m. This article has 0 citations and is from a peer-reviewed journal.

12. (thede2012biochemicalandstructural pages 133-138): Gina L. Thede. Biochemical and structural characterization of cpxp and cpxa, key components of an envelope stress response in escherichia coli. Text, Sep 2012. URL: https://doi.org/10.7939/r31c7m, doi:10.7939/r31c7m. This article has 0 citations and is from a peer-reviewed journal.

13. (hornschemeyer2016interactionanalysisof pages 1-2): Patrick Hörnschemeyer, Viktoria Liss, Ralf Heermann, Kirsten Jung, and Sabine Hunke. Interaction analysis of a two-component system using nanodiscs. PLoS ONE, 11:e0149187, Feb 2016. URL: https://doi.org/10.1371/journal.pone.0149187, doi:10.1371/journal.pone.0149187. This article has 28 citations and is from a peer-reviewed journal.

14. (bisht2024breakingbarriersexploiting pages 11-12): Renu Bisht, Pierre D. Charlesworth, Paola Sperandeo, and Alessandra Polissi. Breaking barriers: exploiting envelope biogenesis and stress responses to develop novel antimicrobial strategies in gram-negative bacteria. Pathogens, 13:889, Oct 2024. URL: https://doi.org/10.3390/pathogens13100889, doi:10.3390/pathogens13100889. This article has 10 citations.

15. (muehler2024stressresponsein pages 1-3): Denise Muehler, Silvia Morini, Janina Geißert, Christina Engesser, Karl-Anton Hiller, Matthias Widbiller, Tim Maisch, Wolfgang Buchalla, and Fabian Cieplik. Stress response in escherichia coli following sublethal phenalene-1-one mediated antimicrobial photodynamic therapy: an rna-seq study. Photochemical & photobiological sciences : Official journal of the European Photochemistry Association and the European Society for Photobiology, 23:1573-1586, Aug 2024. URL: https://doi.org/10.1007/s43630-024-00617-3, doi:10.1007/s43630-024-00617-3. This article has 2 citations.

16. (muehler2024stressresponsein pages 8-10): Denise Muehler, Silvia Morini, Janina Geißert, Christina Engesser, Karl-Anton Hiller, Matthias Widbiller, Tim Maisch, Wolfgang Buchalla, and Fabian Cieplik. Stress response in escherichia coli following sublethal phenalene-1-one mediated antimicrobial photodynamic therapy: an rna-seq study. Photochemical & photobiological sciences : Official journal of the European Photochemistry Association and the European Society for Photobiology, 23:1573-1586, Aug 2024. URL: https://doi.org/10.1007/s43630-024-00617-3, doi:10.1007/s43630-024-00617-3. This article has 2 citations.

17. (muehler2024stressresponsein pages 10-11): Denise Muehler, Silvia Morini, Janina Geißert, Christina Engesser, Karl-Anton Hiller, Matthias Widbiller, Tim Maisch, Wolfgang Buchalla, and Fabian Cieplik. Stress response in escherichia coli following sublethal phenalene-1-one mediated antimicrobial photodynamic therapy: an rna-seq study. Photochemical & photobiological sciences : Official journal of the European Photochemistry Association and the European Society for Photobiology, 23:1573-1586, Aug 2024. URL: https://doi.org/10.1007/s43630-024-00617-3, doi:10.1007/s43630-024-00617-3. This article has 2 citations.

18. (shrivastava2024anenvelopestress pages 7-8): Megha Shrivastava, Manmehar Kaur, Liz Maria Luke, Richa Ashok Kakkar, Deeptodeep Roy, Shivam Singla, Vanshika Sharma, Gaurav Sharma, and Rachna Chaba. An envelope stress response governs long-chain fatty acid metabolism via a small rna to maintain redox homeostasis in escherichia coli. bioRxiv, Oct 2024. URL: https://doi.org/10.1101/2024.10.18.618624, doi:10.1101/2024.10.18.618624. This article has 2 citations.

19. (hs2024mechanismsofsensory pages 114-118): Timothy HS Cho. Mechanisms of sensory signal transduction across the envelope in the cpxra system of escherichia coli. Text, 2024. URL: https://doi.org/10.7939/r3-kpc4-mn64, doi:10.7939/r3-kpc4-mn64. This article has 0 citations and is from a peer-reviewed journal.

20. (hs2024mechanismsofsensory pages 105-109): Timothy HS Cho. Mechanisms of sensory signal transduction across the envelope in the cpxra system of escherichia coli. Text, 2024. URL: https://doi.org/10.7939/r3-kpc4-mn64, doi:10.7939/r3-kpc4-mn64. This article has 0 citations and is from a peer-reviewed journal.

21. (19802008characterizationofa pages 130-133): 1980- Buelow, Daelynn Rose. Characterization of a novel periplasmic accessory protein, cpxp. Text, 2008. URL: https://doi.org/10.7939/r3-41rp-g083, doi:10.7939/r3-41rp-g083. This article has 0 citations and is from a peer-reviewed journal.

22. (thede2012biochemicalandstructural pages 18-22): Gina L. Thede. Biochemical and structural characterization of cpxp and cpxa, key components of an envelope stress response in escherichia coli. Text, Sep 2012. URL: https://doi.org/10.7939/r31c7m, doi:10.7939/r31c7m. This article has 0 citations and is from a peer-reviewed journal.

Citations

1. isaac2005theextracytoplasmicadaptor pages 1-2
2. thede2012biochemicalandstructural pages 82-87
3. thede2011structureofthe pages 1-2
4. hornschemeyer2016interactionanalysisof pages 1-2
5. wan2024regulatoryroleof pages 1-2
6. bisht2024breakingbarriersexploiting pages 11-12
7. muehler2024stressresponsein pages 1-3
8. shrivastava2024anenvelopestress pages 7-8
9. thede2012biochemicalandstructural pages 138-142
10. buelow2005cpxsignaltransduction pages 1-2
11. tschauner2014dynamicinteractionbetween pages 1-2
12. muehler2024stressresponsein pages 8-10
13. macritchie2009envelopestressresponses pages 7-8
14. tschauner2014dynamicinteractionbetween pages 2-3
15. thede2012biochemicalandstructural pages 133-138
16. muehler2024stressresponsein pages 10-11
17. hs2024mechanismsofsensory pages 114-118
18. hs2024mechanismsofsensory pages 105-109
19. thede2012biochemicalandstructural pages 18-22
20. https://doi.org/10.1073/pnas.0508936102;
21. https://doi.org/10.1128/JB.01296-10;
22. https://doi.org/10.7939/r31c7m
23. https://doi.org/10.1128/JB.187.19.6622-6630.2005;
24. https://doi.org/10.1371/journal.pone.0107383;
25. https://doi.org/10.1080/21505594.2024.2404951;
26. https://doi.org/10.7939/r31c7m;
27. https://doi.org/10.1080/21505594.2024.2404951
28. https://doi.org/10.1371/journal.pone.0149187;
29. https://doi.org/10.1128/JB.01296-10
30. https://doi.org/10.1007/s43630-024-00617-3;
31. https://doi.org/10.1101/2024.10.18.618624
32. https://doi.org/10.1073/pnas.0508936102
33. https://doi.org/10.1128/JB.187.19.6622-6630.2005
34. https://doi.org/10.1371/journal.pone.0107383
35. https://doi.org/10.1371/journal.pone.0149187
36. https://doi.org/10.3390/pathogens13100889
37. https://doi.org/10.1007/s43630-024-00617-3
38. https://doi.org/10.1073/pnas.0508936102,
39. https://doi.org/10.1371/journal.pone.0107383,
40. https://doi.org/10.1128/jb.01296-10,
41. https://doi.org/10.1128/jb.187.19.6622-6630.2005,
42. https://doi.org/10.1128/ecosalplus.5.4.7,
43. https://doi.org/10.1080/21505594.2024.2404951,
44. https://doi.org/10.7939/r31c7m,
45. https://doi.org/10.1371/journal.pone.0149187,
46. https://doi.org/10.3390/pathogens13100889,
47. https://doi.org/10.1007/s43630-024-00617-3,
48. https://doi.org/10.1101/2024.10.18.618624,
49. https://doi.org/10.7939/r3-kpc4-mn64,
50. https://doi.org/10.7939/r3-41rp-g083,

BioReason-Pro RL Review: CpxP (E. coli)

Source: CpxP-deep-research-bioreason-rl.md

• Correctness: 2/5
• Completeness: 2/5

Functional Summary Review

The BioReason functional summary describes CpxP as:

A soluble cytoplasmic auxiliary factor that assembles and stabilizes the envelope-stress signaling hub governed by the Cpx two-component pathway in Escherichia coli. By using a conserved interaction module to form transient oligomers, it binds pathway partners and conditions the assembly and lifetime of the signaling complex, thereby tuning downstream transcriptional and post-transcriptional responses without catalysis.

This summary contains two major errors:

1. Wrong localization: CpxP is described as "cytoplasmic," but it is a well-established periplasmic protein with a signal peptide (residues 1-21). The curated review and multiple crystal structures (PMID:21239493, PMID:21317318) confirm periplasmic localization. This is a critical error since CpxP's function depends on its periplasmic location, where it directly interacts with the periplasmic sensor domain of CpxA.

2. Vague functional description: The summary describes CpxP generically as "tuning downstream transcriptional and post-transcriptional responses." In reality, CpxP has two well-defined functions: (a) it inhibits CpxA autophosphorylation by binding its periplasmic sensor domain, acting as a negative regulator of the Cpx pathway (PMID:17259177), and (b) it functions as a periplasmic adaptor protein that delivers misfolded proteins (e.g., PapE pilus subunits) to the DegP protease for degradation (PMID:16303867).

The summary correctly identifies CpxP as non-catalytic and associated with the Cpx pathway, but misses the dual-function adaptor/inhibitor mechanism and gets the cellular compartment wrong.

Notably, the GO term predictions include mitochondrial terms (GO:0005741 mitochondrial outer membrane, GO:0005740 mitochondrial envelope) which are nonsensical for a bacterial protein.

Comparison with interpro2go:

CpxP has no GO_REF:0000002 annotations in the curated review. The BioReason model correctly identifies the Cpx system association from IPR052211, but then misinterprets the localization and function. The model's CC predictions include periplasmic space (GO:0042597) and outer membrane-bounded periplasmic space (GO:0030288) in its GO terms, contradicting its own functional summary that says "cytoplasmic." This internal inconsistency suggests the narrative generation and GO prediction pipelines may not be well integrated.

Notes on thinking trace

The trace correctly identifies the IPR052211 (Cpx auxiliary protein) and IPR012899 (LTXXQ motif) domains. However, it then infers cytoplasmic localization "from the absence of transmembrane segments," ignoring that the protein has a signal peptide for periplasmic export. The trace also mentions "RNA-binding assemblies" as interaction partners, which has no experimental support for CpxP.