Spy

UniProt ID: P77754
Organism: Escherichia coli (strain K12)
Review Status: DRAFT
📝 Provide Detailed Feedback

Gene Description

Spy (Spheroplast protein Y) is an ATP-independent periplasmic chaperone in E. coli that functions primarily as a holdase, preventing protein aggregation under stress conditions (tannins, butanol, ethanol). It forms a thin, cradle-shaped homodimer with a novel alpha-helical fold. Spy is massively upregulated (up to 25-50% of periplasmic protein) under envelope stress via the Bae and Cpx two-component systems. Remarkably, Spy can also allow substrate proteins to fold while remaining bound to its surface, making it unusual among ATP-independent chaperones. It binds unfolded, intermediate, and native conformations of its substrates with comparable micromolar affinities.

Existing Annotations Review

GO Term Evidence Action Reason
GO:0030288 outer membrane-bounded periplasmic space
IBA
GO_REF:0000033
ACCEPT
Summary: IBA annotation for periplasmic localization of Spy, inferred from phylogenetic analysis. Spy is well established as a periplasmic protein based on extensive experimental evidence from multiple studies (PMID:9068658, PMID:21317898, PMID:9694902).
Reason: Spy was originally identified as a periplasmic protein (PMID:9068658) and its periplasmic localization has been confirmed repeatedly. The IBA annotation is consistent with all available experimental evidence and the UniProt record. The IDA annotation (below) provides direct experimental support.
Supporting Evidence:
PMID:9068658
It encodes a precursor of a so far unknown 139-residue, rather basic periplasmic protein.
PMID:21317898
Spy overexpression leads to the accumulation of an otherwise highly unstable protein instead suggested that Spy might function as a chaperone that facilitates protein folding in the bacterial periplasm.
GO:0051082 unfolded protein binding
IBA
GO_REF:0000033
MODIFY
Summary: IBA annotation for unfolded protein binding, inferred by phylogeny. Spy is indeed one of the best-characterized unfolded protein binders, demonstrated by ITC, stopped-flow fluorescence, and crystallographic studies (PMID:26619265, PMID:27239796). However, GO:0051082 is proposed for obsoletion and Spy is primarily a holdase chaperone that prevents aggregation in the periplasm.
Reason: Spy is primarily a holdase -- an ATP-independent chaperone that binds unfolded/misfolded proteins to prevent aggregation in situ. It does not escort proteins between compartments, so GO:0140309 (unfolded protein carrier activity) does not apply. The ideal replacement is a proposed "holdase chaperone activity" NTR. Until that NTR exists, GO:0051082 should be retained. Spy also has some foldase-like activity (PMID:26619265), but its primary mechanism is holdase. GO:0044183 (protein folding chaperone, already annotated separately) captures the foldase aspect.
Supporting Evidence:
PMID:21317898
In vitro studies demonstrate that the Spy protein is an effective ATP-independent chaperone that suppresses protein aggregation and aids protein refolding.
PMID:26619265
It has previously been thought that only ATP dependent "foldase" chaperones can actively facilitate protein folding. The ATP independent "holdase" chaperones were thought to play a more passive role, holding onto aggregation-sensitive folding intermediates
GO:0042597 periplasmic space
IEA
GO_REF:0000120
ACCEPT
Summary: IEA annotation for periplasmic space based on InterPro and UniProt subcellular location mappings. This is a broader term than GO:0030288 (outer membrane-bounded periplasmic space), which is also annotated. Both are correct.
Reason: The IEA mapping to periplasmic space is consistent with all experimental evidence. While GO:0030288 is more specific, the broader GO:0042597 is not incorrect for an IEA annotation. Spy is unambiguously a periplasmic protein (PMID:9068658, PMID:21317898, PMID:9694902).
Supporting Evidence:
PMID:9068658
It encodes a precursor of a so far unknown 139-residue, rather basic periplasmic protein.
GO:0005515 protein binding
IPI
PMID:26619265
Substrate protein folds while it is bound to the ATP-indepen...
REMOVE
Summary: IPI annotation for protein binding based on physical interaction evidence from IntAct (Spy interacts with immunity protein Imm). The PMID:26619265 study used ITC and stopped-flow fluorescence to demonstrate direct binding of Spy to Im7 in multiple conformational states (Kd values of 3.5-20.5 uM).
Reason: GO:0005515 (protein binding) is uninformative for a protein whose core function is binding unfolded proteins as a chaperone. The chaperone-substrate interaction is already captured by GO:0051082 (unfolded protein binding) and GO:0044183 (protein folding chaperone). Per curation guidelines, protein binding should be avoided in favor of more specific MF terms.
Supporting Evidence:
PMID:26619265
We found that Spy binds to all three variants of Im7, with affinities of 10.4 μM, 3.5 μM, and 20.5 μM for Im7-L18A L19A L37A (Im7U), Im7-L53A I54A (Im7I), and Im7-WT (Im7N), respectively
GO:0006457 protein folding
IDA
PMID:21317898
Genetic selection designed to stabilize proteins uncovers a ...
ACCEPT
Summary: IDA annotation for involvement in protein folding, based on the discovery paper showing that Spy suppresses protein aggregation and aids protein refolding in vitro. Spy increased refolding yield of chemically and thermally unfolded substrates in the absence of ATP or cofactors (PMID:21317898). Subsequent work showed that substrates can actually fold while bound to Spy's surface (PMID:26619265).
Reason: Spy is directly involved in protein folding in the periplasm. The original discovery paper demonstrated that Spy suppresses aggregation of multiple substrates (MDH, aldolase, GAPDH) and significantly increases refolding yield (PMID:21317898). The follow-up study (PMID:26619265) provided the remarkable finding that Im7 folds while bound to Spy. This BP annotation accurately captures Spy's role.
Supporting Evidence:
PMID:21317898
To test if Spy can support protein folding, even though it is localized to the ATP-devoid environment of the bacterial periplasm, we analyzed its influence on the refolding yield of chemically and thermally unfolded proteins. We found that Spy significantly increased the refolding yield of a number of substrates
PMID:26619265
Spy then allows Im7 to fully fold into its native state while it remains bound to the surface of the chaperone.
GO:0044183 protein folding chaperone
IDA
PMID:26619265
Substrate protein folds while it is bound to the ATP-indepen...
ACCEPT
Summary: IDA annotation for protein folding chaperone activity, based on the landmark study demonstrating that Im7 substrate folds while bound to Spy (PMID:26619265). Global kinetic fitting showed that the only model consistent with the data requires Im7 to fold completely (U -> I -> N) while remaining associated with Spy. This is unusual for an ATP-independent chaperone.
Reason: Spy is demonstrated to function as a protein folding chaperone, as the substrate Im7 folds through all intermediates while continuously bound to Spy's surface (PMID:26619265). Although Spy is primarily considered a holdase (preventing aggregation), it clearly also promotes folding without ATP. GO:0044183 is appropriate for this experimentally demonstrated activity. The structural basis for this was further elucidated by READ crystallography (PMID:27239796).
Supporting Evidence:
PMID:26619265
A good fit was only achieved when we globally fit the data to the kinetic mechanism that allows both folding steps 4 and 5, i.e., complete folding of Im7 while bound to Spy, making this the simplest kinetic mechanism that can explain all of the experimental data
PMID:27239796
The ensemble shows that Spy-associated Im7 samples conformations ranging from unfolded to partially folded to native-like states and reveals how a substrate can explore its folding landscape while being bound to a chaperone.
GO:0051082 unfolded protein binding
IDA
PMID:26619265
Substrate protein folds while it is bound to the ATP-indepen...
MODIFY
Summary: IDA annotation for unfolded protein binding based on ITC and stopped-flow kinetics showing Spy binds unfolded, intermediate, and native Im7 with micromolar affinities (PMID:26619265). Spy bound Im7U with Kd of 10.4 uM and association rate constant of 1.3 x 10^7 M-1 s-1, indicating rapid capture of unfolded substrate.
Reason: The experimental evidence robustly supports Spy binding to unfolded proteins. However, GO:0051082 is proposed for obsoletion. Spy is primarily a holdase -- it prevents aggregation in situ in the periplasm, not a carrier that escorts proteins between compartments. GO:0140309 (unfolded protein carrier activity) does NOT fit because Spy acts in situ. The ideal replacement is a proposed "holdase chaperone activity" NTR. Until the NTR exists, retain GO:0051082.
Supporting Evidence:
PMID:26619265
We found that Spy binds to all three variants of Im7, with affinities of 10.4 μM, 3.5 μM, and 20.5 μM for Im7-L18A L19A L37A (Im7U), Im7-L53A I54A (Im7I), and Im7-WT (Im7N), respectively
PMID:26619265
At this concentration, association between Spy and Im7U would be very rapid (occurring with a half-time of 26 μs)
GO:0051082 unfolded protein binding
IDA
PMID:27239796
Visualizing chaperone-assisted protein folding.
MODIFY
Summary: IDA annotation for unfolded protein binding based on crystallographic visualization of Spy-Im7 complex using the READ (Residual Electron and Anomalous Density) technique (PMID:27239796). The structural ensemble captured Im7 in multiple conformations (unfolded, partially folded, native-like) bound within Spy's cradle-shaped concave surface.
Reason: Same rationale as the other GO:0051082 annotations. The READ structural study provides direct visualization of an unfolded substrate bound to Spy, confirming unfolded protein binding. However, GO:0051082 is proposed for obsoletion and Spy is an in-situ holdase, not a carrier. Retain GO:0051082 until the holdase NTR is created.
Supporting Evidence:
PMID:27239796
The ensemble shows that Spy-associated Im7 samples conformations ranging from unfolded to partially folded to native-like states and reveals how a substrate can explore its folding landscape while being bound to a chaperone.
PMID:27239796
we observed that Im76-45 takes on several different conformations while bound. We found these conformations to be highly heterogeneous and to include unfolded, partially folded, and native-like states
GO:0042803 protein homodimerization activity
IDA
PMID:20799348
The crystal structure Escherichia coli Spy.
ACCEPT
Summary: IDA annotation for protein homodimerization based on the crystal structure of Spy (PMID:20799348), which revealed an antiparallel homodimer with a curved oval shape. The dimer interface buries approximately 1850 A^2 per monomer, indicating a stable dimeric assembly.
Reason: The crystal structure unambiguously shows Spy as a homodimer (PMID:20799348), confirmed independently by a second crystal structure (PMID:21317898), size exclusion chromatography, and analytical ultracentrifugation. Homodimerization is functionally essential for forming the cradle-shaped substrate binding surface. This is a core structural feature of Spy.
Supporting Evidence:
PMID:20799348
which reveals a long kinked hairpin-like structure of four α-helices that form an antiparallel dimer
PMID:21317898
The crystal structure shows that Spy molecules associate into tightly bound dimers
GO:0030288 outer membrane-bounded periplasmic space
IDA
PMID:9068658
A new periplasmic protein of Escherichia coli which is synth...
ACCEPT
Summary: IDA annotation for periplasmic localization based on the original discovery of Spy (PMID:9068658). Spy was identified as a new periplasmic protein produced abundantly in spheroplasts but not in intact cells. The protein contains a signal peptide (residues 1-23) directing it to the periplasm.
Reason: The original identification of Spy as a periplasmic protein (PMID:9068658) is the foundational localization evidence. The signal peptide cleaves at position 23 to generate the mature periplasmic form. This has been confirmed by multiple subsequent studies (PMID:9694902, PMID:21317898). UniProt also annotates Spy to the periplasm with multiple experimental evidence codes.
Supporting Evidence:
PMID:9068658
It encodes a precursor of a so far unknown 139-residue, rather basic periplasmic protein. It was not detectable immunologically in intact cells but was produced abundantly in spheroplasts.
GO:0042803 protein homodimerization activity
IDA
PMID:21317898
Genetic selection designed to stabilize proteins uncovers a ...
ACCEPT
Summary: IDA annotation for protein homodimerization from the Spy chaperone discovery paper (PMID:21317898). The crystal structure, size exclusion chromatography, and analytical ultracentrifugation all confirmed that Spy is a homodimer with extensive monomer-monomer contacts burying ~1850 A^2 per monomer.
Reason: Independent confirmation of Spy homodimerization using multiple biophysical methods (crystallography, SEC, AUC) in the landmark chaperone discovery paper. This is a duplicate of the PMID:20799348 annotation (both correct) and reflects that two independent groups solved the Spy dimer structure. Homodimerization is essential for the cradle architecture that enables chaperone function.
Supporting Evidence:
PMID:21317898
The crystal structure shows that Spy molecules associate into tightly bound dimers
PMID:21317898
The contacts between the two monomers are extensive, burying a surface of ∼1850 Å2 per monomer upon dimerization and suggesting high dimeric stability

Core Functions

Spy is an ATP-independent periplasmic chaperone that suppresses protein aggregation and aids protein refolding (PMID:21317898). Remarkably, substrate Im7 folds completely while remaining bound to Spy's cradle-shaped surface (PMID:26619265). Global kinetic fitting demonstrated that the only consistent model requires folding while bound. Structural ensembles captured substrates in unfolded, intermediate, and native-like conformations on Spy (PMID:27239796). Spy is primarily a holdase (preventing aggregation in situ without ATP), but also has foldase-like activity as substrates can fold while bound. The ideal MF annotation would be the proposed holdase chaperone activity NTR in addition to GO:0044183. GO:0140309 (carrier-holdase) does NOT fit because Spy acts in situ in the periplasm, not as an inter-compartment carrier.

Molecular Function:
protein folding chaperone
Directly Involved In:
Supporting Evidence:
  • PMID:21317898
    In vitro studies demonstrate that the Spy protein is an effective ATP-independent chaperone that suppresses protein aggregation and aids protein refolding.
  • PMID:26619265
    Spy then allows Im7 to fully fold into its native state while it remains bound to the surface of the chaperone.
  • PMID:27239796
    The ensemble shows that Spy-associated Im7 samples conformations ranging from unfolded to partially folded to native-like states and reveals how a substrate can explore its folding landscape while being bound to a chaperone.

References

Annotation inferences using phylogenetic trees
Combined Automated Annotation using Multiple IEA Methods
A new periplasmic protein of Escherichia coli which is synthesized in spheroplasts but not in intact cells.
The crystal structure Escherichia coli Spy.
Genetic selection designed to stabilize proteins uncovers a chaperone called Spy.
Super Spy variants implicate flexibility in chaperone action.
Substrate protein folds while it is bound to the ATP-independent chaperone Spy.
Visualizing chaperone-assisted protein folding.

Deep Research

Falcon

(Spy-deep-research-falcon.md)
this with annotations you find in gene/protein databases, but these can be outdated or inaccurate. Falcon Edison Scientific Literature 36 citations 2026-03-22T18:10:05.827610

The research report should be a detailed narrative explaining the function, biological processes, and localization of the gene product. Citations should be given for all claims.

You should prioritize authoritative reviews and primary scientific literature when conducting research. You can supplement
this with annotations you find in gene/protein databases, but these can be outdated or inaccurate.

We are specifically interested in the primary function of the gene - for enzymes, what reaction is catalyzed, and what is the substrate specificity? For transporters, what is the substrate? For structural proteins or adapters, what is the broader structural role? For signaling molecules, what is the role in the pathway.

We are interested in where in or outside the cell the gene product carries out its function.

We are also interested in the signaling or biochemical pathways in which the gene functions. We are less interested in broad pleiotropic effects, except where these elucidate the precise role.

Include evidence where possible. We are interested in both experimental evidence as well as inference from structure, evolution, or bioinformatic analysis. Precise studies should be prioritized over high-throughput, where available.

Research Report: Escherichia coli K-12 spy (UniProt P77754) — Periplasmic chaperone Spy (Spheroplast protein Y)

Executive summary

The E. coli K-12 gene spy encodes Spy, a secreted/periplasmic, ATP-independent molecular chaperone (also called spheroplast protein Y) that is strongly induced by envelope stress and protects periplasmic proteostasis by suppressing protein aggregation and aiding refolding. Spy forms an elongated, cradle-shaped dimer with a strongly basic concave surface and conserved LTxxQ motifs, which together support binding of unfolded/negatively charged client proteins. Spy transcription is controlled primarily by the envelope-stress two-component systems BaeSR and CpxAR, with stressor-specific dominance (e.g., BaeSR for ethanol and chlorite; CpxAR for copper). Recent 2024 studies extend Spy biology to reactive chlorine stress (chlorite-specific induction and redox control of Spy methionines) and implicate spy in recovery from toxin-induced dormancy and aggregation; Spy (SPY) expression is also used as a marker of spheroplast-associated physiology in antimicrobial studies. (kwon2010thecrystalstructure pages 1-2, ruan2020conversionofthe pages 16-29, loiseau2024maintainingthemethionine pages 1-5, leinberger2024proteinaggregationis pages 1-2)


0) Mandatory gene/protein identity verification (avoid symbol ambiguity)

Target identity (matches UniProt P77754 context):
- Spy is explicitly described in the primary structural paper as Escherichia coli Spy (EcSpy) = spheroplast protein Y, and as a small periplasmic protein (precursor with signal peptide; mature region studied begins after signal peptide). (kwon2010thecrystalstructure pages 1-2)
- Spy’s mature construct used for structural work corresponds to residues 24–161 (with an internal ordered core), consistent with an N-terminal signal peptide being removed in the periplasm. (kwon2010thecrystalstructure pages 1-2)
- Spy belongs to a conserved family related to CpxP and contains LTxxQ motifs; the structure shows a conserved antiparallel dimeric fold that has been repeatedly used as the reference for E. coli Spy. (kwon2010thecrystalstructure pages 5-7, quan2011geneticselectiondesigned pages 9-11)

Conclusion: The retrieved literature is about the E. coli envelope-stress-induced periplasmic chaperone Spy/spheroplast protein Y, consistent with UniProt P77754 and the CpxP/Spy family. (kwon2010thecrystalstructure pages 1-2, kwon2010thecrystalstructure pages 5-7)


1) Key concepts and definitions (current understanding)

1.1 Periplasmic proteostasis and ATP-independent chaperones

The periplasm lacks ATP, so many periplasmic chaperones function as ATP-independent holdases or folding assistants. Spy is an experimentally validated example: it suppresses aggregation and supports refolding in vitro in buffers without ATP supplementation and functions in vivo as a periplasmic stress chaperone. (quan2011geneticselectiondesigned pages 19-22, ruan2020conversionofthe pages 16-29)

1.2 What Spy is (functional definition)

Spy is best defined as a stress-induced periplasmic chaperone that binds unfolded or unstable proteins, suppresses aggregation, and can promote refolding without ATP. This definition is supported by (i) its genetic discovery as a protein whose massive induction stabilizes an unstable periplasmic client, and (ii) direct in vitro anti-aggregation assays. (quan2011geneticselectiondesigned pages 1-5, ruan2020conversionofthe pages 16-29)

1.3 Relationship to envelope stress signaling (BaeSR/CpxAR)

Spy expression is controlled by envelope-stress sensing two-component systems BaeSR and CpxAR. Each can activate spy transcription via specific promoter binding regions/motifs, and the dominant regulator depends on the stressor (e.g., ethanol and chlorite strongly implicate BaeSR). (yamamoto2008involvementofmultiple pages 1-2, srivastava2014geneticregulationof pages 5-7, loiseau2024maintainingthemethionine pages 1-5)


2) Protein properties, localization, and structure

2.1 Subcellular localization

Spy is a periplasmic protein. Structural and functional studies note that Spy is synthesized with a signal sequence and is localized to/assayed from periplasmic extracts; structural constructs often omit the signal peptide for recombinant expression. (kwon2010thecrystalstructure pages 1-2, quan2011geneticselectiondesigned pages 16-19)

2.2 Oligomeric state and overall architecture

Spy behaves as an elongated dimer in solution (SEC and analytical ultracentrifugation), with an apparent MW of ~45 kDa over 0.1–50 μM monomer concentration, larger than expected for a compact dimer—consistent with an extended shape. (quan2011geneticselectiondesigned pages 9-11)

2.3 Crystal structure and key structural determinants

Kwon et al. solved the crystal structure of EcSpy (Protein Science; published Nov 2010) showing:
- Spy is a four-α-helix monomer forming a long kinked hairpin-like fold.
- Two monomers assemble into an antiparallel dimer forming a curved/concave “oval” cradle. (kwon2010thecrystalstructure pages 1-2)
- The concave surface is highly positively charged, proposed as a ligand/client interaction face; the protein is basic (pI ~9.45) with 25 basic vs 20 acidic residues in 137 aa. (kwon2010thecrystalstructure pages 2-5)
- Conserved LTxxQ motifs (shared with CpxP) help stabilize the fold. (kwon2010thecrystalstructure pages 5-7)

Crystallographic statistics (Table I):
- Native diffraction to 2.7 Å, MAD data to 3.0 Å; Rwork/Rfree 0.252/0.300. (kwon2010thecrystalstructure pages 1-2, kwon2010thecrystalstructure media 501f4ace)
- Structure deposited as PDB 3OEO. (kwon2010thecrystalstructure pages 5-7, kwon2010thecrystalstructure pages 7-8)

Visual evidence: Kwon et al. Figure 2 shows the Spy dimer and its electrostatic surface, including the strongly basic concave region. (kwon2010thecrystalstructure media 159283c6)


3) Biological function: mechanistic and experimental evidence

3.1 Discovery as an in vivo periplasmic stabilizer

Spy was discovered by a genetic selection linking protein stability to antibiotic resistance: when bacteria were forced to fold a very unstable periplasmic protein, they “massively overproduced” Spy, and Spy overproduction increased steady-state levels of unstable mutants by up to 700-fold. (quan2011geneticselectiondesigned pages 1-5)

3.2 Anti-aggregation and refolding in vitro (client scope)

Spy suppresses aggregation and can support refolding across diverse substrates. Quan et al. describe aggregation/refolding assays using enzymes including malate dehydrogenase (MDH), aldolase, GAPDH, LDH, and alkaline phosphatase, monitoring aggregation via light scattering and refolding via enzymatic recovery, with Spy titrated in ATP-free assay buffers. (quan2011geneticselectiondesigned pages 19-22)

A direct quantitative anti-aggregation result is provided by Ruan et al. (Journal of Biotechnology; published Jan 2020):
- Using reduced α-lactalbumin, wild-type Spy decreased aggregation by >80% at 120 min at a 1:2.5 Spy:α-LA molar ratio, whereas an engineered covalent Spy dimer reduced aggregation by ~50% under the same conditions. (ruan2020conversionofthe pages 16-29)

3.3 Physiological role: protecting periplasmic proteins under stress

Spy protects periplasmic enzyme function during chemical stress: under tannic acid treatment, wild-type cells retained ~100% alkaline phosphatase activity, whereas a Δspy strain showed decreased activity—supporting Spy’s functional role in maintaining periplasmic protein function under envelope stress. (quan2011geneticselectiondesigned pages 1-5)

3.4 Redox sensitivity and methionine-dependent activity (2024 development)

A 2024 preprint (bioRxiv; posted Dec 2024) reports that chlorite stress induces an oxidized form of Spy (Spyox) and that oxidation is reversible and controlled by the periplasmic methionine sulfoxide reductase MsrP. Spy’s methionine residues are highlighted as functional hotspots (e.g., core Met69/Met87/Met108), and methionine oxidation/state is implicated as crucial for chaperone function under reactive chlorine stress. (loiseau2024maintainingthemethionine pages 19-22)


4) Regulation and pathway context

4.1 Core regulators: BaeSR and CpxAR

Multiple studies support two-component regulation of spy:
- CpxAR activates spy as part of the Cpx regulon and is linked to envelope stresses (including copper). BaeSR regulates spy under zinc and other stresses, with promoter binding sites mapped by DNase I footprinting. (yamamoto2008involvementofmultiple pages 1-2)
- Reporter dissection (Gene; published Sep 2014) indicates spy promoter contains two BaeR and one CpxR motifs, and supports BaeR as the primary regulator for ethanol induction; CpxR contributes for copper induction. (srivastava2014geneticregulationof pages 1-2, srivastava2014geneticregulationof pages 5-7)

4.2 Inducing stressors (experimentally supported examples)

Spy is induced by multiple envelope/protein-unfolding stresses including ethanol, butanol, tannins, and metal stresses (Cu, Zn), among others. (quan2011geneticselectiondesigned pages 1-5, srivastava2014geneticregulationof pages 1-2, yamamoto2008involvementofmultiple pages 1-2)

A strong mechanistic link between Bae activation and Spy induction comes from the discovery study: independent resistant strains commonly carried baeS mutations; one allele (baeS R416C) was necessary and sufficient to drive very strong spy induction. (quan2011geneticselectiondesigned pages 28-32)

4.3 Quantitative induction magnitudes

  • In selected envelope-stress backgrounds, spy induction reached 279-fold (EMS4/WT) and 253-fold (baeS R416C/WT). (quan2011geneticselectiondesigned pages 28-32)
  • Under strong induction/overexpression conditions, Spy can comprise ~40–48% of total periplasmic protein in periplasmic fractions. (quan2011geneticselectiondesigned pages 28-32)
  • Under chlorite stress (2024), Spy was the top overproduced protein by proteomics (15.3-fold) and showed ~30-fold induction by a spy-lacZ transcriptional fusion; BaeSR was required for this chlorite response. (loiseau2024maintainingthemethionine pages 1-5)

5) Recent developments (prioritized 2023–2024)

5.1 Reactive chlorine/chlorite stress and Spy redox cycling (2024)

Loiseau et al. (bioRxiv; Dec 2024) extends Spy biology to reactive chlorine stress by showing:
- Chlorite-specific induction across multiple tested oxidants.
- Spy oxidation (Spyox) and reversal via MsrP, linking Spy’s chaperone function to periplasmic redox maintenance. (loiseau2024maintainingthemethionine pages 19-22)

5.2 Spy in dormancy/aggregation and recovery programs (2024)

Leinberger et al. (mSystems; published Nov 2024) found by RNA-seq that chaperone genes including spy were implicated in recovery from TisB-induced dormancy, and interpret chaperone involvement as evidence that TisB causes protein aggregation (validated by an in vivo aggregation reporter). (leinberger2024proteinaggregationis pages 1-2)

5.3 Spy (SPY) as a marker in antimicrobial physiology (2024)

Kaur et al. (Scientific Reports; published Feb 2024) report that imipenem-containing antibiotic combinations against pan-drug resistant Klebsiella pneumoniae drove upregulation of SPY (spheroplast protein Y) alongside PBPs, in a context where imipenem promoted formation of metabolically active spheroplasts and suppressed filamentous persisters; this study reports imipenem permeability 17,200 nm/s, 207-fold higher than aztreonam. (kaur2024nextgenerationantibiotic pages 1-2)


6) Current applications and real-world implementations

6.1 Spy as a protein-expression/folding tool (biotechnology)

Spy has been repurposed as a fusion/solubility tag to enhance recombinant protein expression. In the 2020 study, a cytoplasmic signal-peptide–deleted Spy (Δss-Spy) and N-terminal Spy fusions increased steady-state levels of destabilized Im7 variants by 1.2- to 31-fold, and enhanced soluble expression of several model proteins; tandem Spy–Spy fusions were engineered for larger targets. (ruan2020conversionofthe pages 8-11, ruan2020conversionofthe pages 16-29)

6.2 Spy promoter reporters as envelope-stress biosensors

Although many biosensor papers are outside E. coli K-12, the foundational concept is directly supported in E. coli: spy is strongly and specifically inducible by envelope stress regulators BaeSR/CpxAR and by defined stressors; thus spy promoter fusions (e.g., spy::GFP; spy-lacZ) are practical envelope stress readouts. (srivastava2014geneticregulationof pages 5-7, loiseau2024maintainingthemethionine pages 1-5)


7) Expert opinions and analysis (synthesis grounded in authoritative sources)

7.1 Mechanistic model (evidence-based)

Structural and biochemical data support a model in which Spy’s extended, concave, positively charged cradle-shaped dimer binds unfolded/negatively charged polypeptides, preventing aggregation and enabling productive folding/refolding. The large dimeric interface (>1400 Ų buried) and strongly basic concave surface are consistent with stable cradle formation and client interaction via electrostatics. (kwon2010thecrystalstructure pages 2-5, kwon2010thecrystalstructure media 159283c6)

7.2 Regulatory logic (envelope stress integration)

spy is best interpreted as part of an extracytoplasmic protein quality control module that is deployed when envelope perturbations increase the burden of misfolded periplasmic and envelope proteins. The exceptionally large induction levels driven by BaeS mutations (hundreds-fold) and the chlorite-specific BaeR dependence argue that spy is positioned as a “high-gain” effector in stress response. (quan2011geneticselectiondesigned pages 28-32, loiseau2024maintainingthemethionine pages 1-5)


8) Key statistics and data summary

The following table consolidates quantitative findings across core and recent studies.

Study (author year) System/assay Condition/stressor Key quantitative result(s) Interpretation for Spy function/regulation URL/DOI
Quan et al. 2011 Genetic selection for stabilization of unstable periplasmic proteins in E. coli Selection for folding of unstable Im7 fusion under antibiotic pressure Spy overproduction increased steady-state levels of some unstable protein mutants by up to 700-fold; Spy is annotated as regulated by Bae, Cpx in the study (quan2011geneticselectiondesigned pages 28-32) Strong evidence that Spy is a potent periplasmic chaperone/holdase that can dramatically stabilize metastable client proteins in vivo https://doi.org/10.1038/nsmb.2016
Quan et al. 2011 Transcript/periplasm quantification in EMS4 and baeS R416C backgrounds Envelope-stress pathway activation via BaeS mutation spy induction 279-fold in EMS4 vs WT; 253-fold in baeS R416C vs WT; periplasmic Spy reached about 40–48% of total periplasmic protein in Spy-overproducing strains (quan2011geneticselectiondesigned pages 28-32) Shows that Spy is among the most strongly inducible envelope-stress proteins and is under powerful Bae/Cpx control https://doi.org/10.1038/nsmb.2016
Quan et al. 2011 Solution biophysics (SEC, AUC) Purified Spy in solution Apparent molecular weight by SEC about 45 kDa over 0.1–50 μM monomer concentration, ~2.8× expected compact monomer size (quan2011geneticselectiondesigned pages 9-11) Supports that Spy behaves as an elongated dimer rather than a compact globular monomer, consistent with chaperone cradle architecture https://doi.org/10.1038/nsmb.2016
Kwon et al. 2010 X-ray crystallography of mature EcSpy Structural determination of periplasmic Spy Native diffraction to 2.7 Å; MAD data to 3.0 Å; structure deposited as PDB 3OEO; refined R/Rfree = 25.2/30.0% (kwon2010thecrystalstructure pages 5-7, kwon2010thecrystalstructure pages 7-8, kwon2010thecrystalstructure media 501f4ace) Establishes the structural basis for function: an antiparallel dimer with a positively charged concave surface and conserved LTxxQ motifs https://doi.org/10.1002/pro.489
Ruan et al. 2020 In vitro α-lactalbumin anti-aggregation assay Reduced α-lactalbumin, Spy:α-LA molar ratio 1:2.5 Wild-type Spy decreased α-lactalbumin aggregation by >80% at 120 min; engineered covalent dimer reduced aggregation by about 50% (ruan2020conversionofthe pages 16-29) Direct quantitative evidence that Spy is an effective ATP-independent anti-aggregation chaperone https://doi.org/10.1016/j.jbiotec.2019.11.006
Ruan et al. 2020 Cytoplasmic Δss-Spy expression with unstable model clients Expression of destabilized substrates in cytoplasm Spy increased levels of unstable Im7 variants by 1.2- to 31-fold in cytoplasm; prior periplasmic work cited in the paper reported 100- to 700-fold effects (ruan2020conversionofthe pages 8-11) Spy’s chaperone activity is transferable and can be exploited biotechnologically as a solubility/fusion tag https://doi.org/10.1016/j.jbiotec.2019.11.006
Loiseau et al. 2024 Proteomics, immunoblotting, spy-lacZ reporter under oxidant stress Chlorite exposure Spy was the top overproduced protein with proteomic fold change 15.3; spy-lacZ showed about 30-fold induction (loiseau2024maintainingthemethionine pages 1-5) Demonstrates that Spy is a major periplasmic proteostasis effector induced during reactive chlorine stress https://doi.org/10.1101/2024.12.12.628106
Srivastava et al. 2014 Promoter::GFP dissection and deletion mutants Ethanol (4%), Cu²⁺ (0.6 mM), Zn²⁺ (0.6 mM) BaeR-dependent promoter constructs gave about 3-fold higher GFP on induction; reporter response was linear from 2–6% ethanol (srivastava2014geneticregulationof pages 5-7) Supports that BaeR is the primary regulator under ethanol stress, whereas CpxR contributes under copper stress https://doi.org/10.1016/j.gene.2014.07.003

Table: This table compiles the main quantitative findings for the E. coli periplasmic chaperone Spy, including its structural parameters, induction under envelope stress, and functional effects on client protein stabilization and anti-aggregation. It is useful as a compact evidence summary linking Spy’s regulation, mechanism, and experimental phenotypes.


9) Notes on limitations and evidence gaps

  • Several mechanistic Spy papers cited in later reviews (e.g., post-2016 kinetic/mechanistic studies of folding-while-bound) were not directly retrievable in the current tool session, so detailed kinetic rate constants and binding affinities are not included here; the report therefore emphasizes experimentally documented qualitative mechanisms and the quantitative values accessible in the retrieved sources. (huang2025catalyzingproteinfolding pages 12-13)

Reference URLs (with publication/posting dates where available)

  • Kwon E. et al. 2010-11. Protein Science. “The crystal structure Escherichia coli Spy.” https://doi.org/10.1002/pro.489 (kwon2010thecrystalstructure pages 1-2)
  • Quan S. et al. 2011-02. Nat Struct Mol Biol. “Genetic selection designed to stabilize proteins uncovers a chaperone called Spy.” https://doi.org/10.1038/nsmb.2016 (quan2011geneticselectiondesigned pages 1-5)
  • Yamamoto K. et al. 2008-01. J Biotechnol. “Involvement of multiple transcription factors for metal-induced spy gene expression in E. coli.” https://doi.org/10.1016/j.jbiotec.2007.08.002 (yamamoto2008involvementofmultiple pages 1-2)
  • Srivastava S.K. et al. 2014-09. Gene. “Genetic regulation of spy gene expression in E. coli in the presence of protein unfolding agent ethanol.” https://doi.org/10.1016/j.gene.2014.07.003 (srivastava2014geneticregulationof pages 1-2)
  • Ruan A. et al. 2020-01. Journal of Biotechnology. “Conversion of the molecular chaperone Spy into a novel fusion tag to enhance recombinant protein expression.” https://doi.org/10.1016/j.jbiotec.2019.11.006 (ruan2020conversionofthe pages 16-29)
  • Kaur J.N. et al. 2024-02. Scientific Reports. “Next generation antibiotic combinations to combat pan-drug resistant Klebsiella pneumoniae.” https://doi.org/10.1038/s41598-024-53130-z (kaur2024nextgenerationantibiotic pages 1-2)
  • Leinberger F.H. et al. 2024-11. mSystems. “Protein aggregation is a consequence of the dormancy-inducing membrane toxin TisB in E. coli.” https://doi.org/10.1128/msystems.01060-24 (leinberger2024proteinaggregationis pages 1-2)
  • Loiseau L. et al. 2024-12-12 (posted). bioRxiv. “Maintaining the methionine residues of the chaperone Spy in a reduced state is crucial for periplasmic proteostasis.” https://doi.org/10.1101/2024.12.12.628106 (loiseau2024maintainingthemethionine pages 1-5)

References

  1. (kwon2010thecrystalstructure pages 1-2): Eunju Kwon, Dong Young Kim, Carol A. Gross, John D. Gross, and Kyeong Kyu Kim. The crystal structure escherichia coli spy. Protein Science, 19:2252-2259, Nov 2010. URL: https://doi.org/10.1002/pro.489, doi:10.1002/pro.489. This article has 53 citations and is from a peer-reviewed journal.

  2. (ruan2020conversionofthe pages 16-29): Alessandro Ruan, Chang Ren, and Shu Quan. Conversion of the molecular chaperone spy into a novel fusion tag to enhance recombinant protein expression. Jan 2020. URL: https://doi.org/10.1016/j.jbiotec.2019.11.006, doi:10.1016/j.jbiotec.2019.11.006. This article has 23 citations and is from a peer-reviewed journal.

  3. (loiseau2024maintainingthemethionine pages 1-5): Laurent Loiseau, Nathan De Visch, Alexandra Vergnes, Jean Armengaud, Maxence S. Vincent, and Benjamin Ezraty. Maintaining the methionine residues of the chaperone spy in a reduced state is crucial for periplasmic proteostasis. bioRxiv, Dec 2024. URL: https://doi.org/10.1101/2024.12.12.628106, doi:10.1101/2024.12.12.628106. This article has 0 citations.

  4. (leinberger2024proteinaggregationis pages 1-2): Florian H. Leinberger, Liam Cassidy, Daniel Edelmann, Nicole E. Schmid, Markus Oberpaul, Patrick Blumenkamp, Sebastian Schmidt, Ana Natriashvili, Maximilian H. Ulbrich, Andreas Tholey, Hans-Georg Koch, and Bork A. Berghoff. Protein aggregation is a consequence of the dormancy-inducing membrane toxin tisb in escherichia coli. Nov 2024. URL: https://doi.org/10.1128/msystems.01060-24, doi:10.1128/msystems.01060-24. This article has 9 citations and is from a peer-reviewed journal.

  5. (kwon2010thecrystalstructure pages 5-7): Eunju Kwon, Dong Young Kim, Carol A. Gross, John D. Gross, and Kyeong Kyu Kim. The crystal structure escherichia coli spy. Protein Science, 19:2252-2259, Nov 2010. URL: https://doi.org/10.1002/pro.489, doi:10.1002/pro.489. This article has 53 citations and is from a peer-reviewed journal.

  6. (quan2011geneticselectiondesigned pages 9-11): Shu Quan, Philipp Koldewey, Tim Tapley, Nadine Kirsch, Karen M Ruane, Jennifer Pfizenmaier, Rong Shi, Stephan Hofmann, Linda Foit, Guoping Ren, Ursula Jakob, Zhaohui Xu, Miroslaw Cygler, and James C A Bardwell. Genetic selection designed to stabilize proteins uncovers a chaperone called spy. Nature Structural & Molecular Biology, 18:262-269, Feb 2011. URL: https://doi.org/10.1038/nsmb.2016, doi:10.1038/nsmb.2016. This article has 223 citations and is from a highest quality peer-reviewed journal.

  7. (quan2011geneticselectiondesigned pages 19-22): Shu Quan, Philipp Koldewey, Tim Tapley, Nadine Kirsch, Karen M Ruane, Jennifer Pfizenmaier, Rong Shi, Stephan Hofmann, Linda Foit, Guoping Ren, Ursula Jakob, Zhaohui Xu, Miroslaw Cygler, and James C A Bardwell. Genetic selection designed to stabilize proteins uncovers a chaperone called spy. Nature Structural & Molecular Biology, 18:262-269, Feb 2011. URL: https://doi.org/10.1038/nsmb.2016, doi:10.1038/nsmb.2016. This article has 223 citations and is from a highest quality peer-reviewed journal.

  8. (quan2011geneticselectiondesigned pages 1-5): Shu Quan, Philipp Koldewey, Tim Tapley, Nadine Kirsch, Karen M Ruane, Jennifer Pfizenmaier, Rong Shi, Stephan Hofmann, Linda Foit, Guoping Ren, Ursula Jakob, Zhaohui Xu, Miroslaw Cygler, and James C A Bardwell. Genetic selection designed to stabilize proteins uncovers a chaperone called spy. Nature Structural & Molecular Biology, 18:262-269, Feb 2011. URL: https://doi.org/10.1038/nsmb.2016, doi:10.1038/nsmb.2016. This article has 223 citations and is from a highest quality peer-reviewed journal.

  9. (yamamoto2008involvementofmultiple pages 1-2): Kaneyoshi Yamamoto, Hiroshi Ogasawara, and Akira Ishihama. Involvement of multiple transcription factors for metal-induced spy gene expression in escherichia coli. Journal of biotechnology, 133 2:196-200, Jan 2008. URL: https://doi.org/10.1016/j.jbiotec.2007.08.002, doi:10.1016/j.jbiotec.2007.08.002. This article has 47 citations and is from a peer-reviewed journal.

  10. (srivastava2014geneticregulationof pages 5-7): Santosh Kumar Srivastava, Paramesh Ramulu Lambadi, Tamoghna Ghosh, Ranjana Pathania, and Naveen Kumar Navani. Genetic regulation of spy gene expression in escherichia coli in the presence of protein unfolding agent ethanol. Gene, 548 1:142-8, Sep 2014. URL: https://doi.org/10.1016/j.gene.2014.07.003, doi:10.1016/j.gene.2014.07.003. This article has 41 citations and is from a peer-reviewed journal.

  11. (quan2011geneticselectiondesigned pages 16-19): Shu Quan, Philipp Koldewey, Tim Tapley, Nadine Kirsch, Karen M Ruane, Jennifer Pfizenmaier, Rong Shi, Stephan Hofmann, Linda Foit, Guoping Ren, Ursula Jakob, Zhaohui Xu, Miroslaw Cygler, and James C A Bardwell. Genetic selection designed to stabilize proteins uncovers a chaperone called spy. Nature Structural & Molecular Biology, 18:262-269, Feb 2011. URL: https://doi.org/10.1038/nsmb.2016, doi:10.1038/nsmb.2016. This article has 223 citations and is from a highest quality peer-reviewed journal.

  12. (kwon2010thecrystalstructure pages 2-5): Eunju Kwon, Dong Young Kim, Carol A. Gross, John D. Gross, and Kyeong Kyu Kim. The crystal structure escherichia coli spy. Protein Science, 19:2252-2259, Nov 2010. URL: https://doi.org/10.1002/pro.489, doi:10.1002/pro.489. This article has 53 citations and is from a peer-reviewed journal.

  13. (kwon2010thecrystalstructure media 501f4ace): Eunju Kwon, Dong Young Kim, Carol A. Gross, John D. Gross, and Kyeong Kyu Kim. The crystal structure escherichia coli spy. Protein Science, 19:2252-2259, Nov 2010. URL: https://doi.org/10.1002/pro.489, doi:10.1002/pro.489. This article has 53 citations and is from a peer-reviewed journal.

  14. (kwon2010thecrystalstructure pages 7-8): Eunju Kwon, Dong Young Kim, Carol A. Gross, John D. Gross, and Kyeong Kyu Kim. The crystal structure escherichia coli spy. Protein Science, 19:2252-2259, Nov 2010. URL: https://doi.org/10.1002/pro.489, doi:10.1002/pro.489. This article has 53 citations and is from a peer-reviewed journal.

  15. (kwon2010thecrystalstructure media 159283c6): Eunju Kwon, Dong Young Kim, Carol A. Gross, John D. Gross, and Kyeong Kyu Kim. The crystal structure escherichia coli spy. Protein Science, 19:2252-2259, Nov 2010. URL: https://doi.org/10.1002/pro.489, doi:10.1002/pro.489. This article has 53 citations and is from a peer-reviewed journal.

  16. (loiseau2024maintainingthemethionine pages 19-22): Laurent Loiseau, Nathan De Visch, Alexandra Vergnes, Jean Armengaud, Maxence S. Vincent, and Benjamin Ezraty. Maintaining the methionine residues of the chaperone spy in a reduced state is crucial for periplasmic proteostasis. bioRxiv, Dec 2024. URL: https://doi.org/10.1101/2024.12.12.628106, doi:10.1101/2024.12.12.628106. This article has 0 citations.

  17. (srivastava2014geneticregulationof pages 1-2): Santosh Kumar Srivastava, Paramesh Ramulu Lambadi, Tamoghna Ghosh, Ranjana Pathania, and Naveen Kumar Navani. Genetic regulation of spy gene expression in escherichia coli in the presence of protein unfolding agent ethanol. Gene, 548 1:142-8, Sep 2014. URL: https://doi.org/10.1016/j.gene.2014.07.003, doi:10.1016/j.gene.2014.07.003. This article has 41 citations and is from a peer-reviewed journal.

  18. (quan2011geneticselectiondesigned pages 28-32): Shu Quan, Philipp Koldewey, Tim Tapley, Nadine Kirsch, Karen M Ruane, Jennifer Pfizenmaier, Rong Shi, Stephan Hofmann, Linda Foit, Guoping Ren, Ursula Jakob, Zhaohui Xu, Miroslaw Cygler, and James C A Bardwell. Genetic selection designed to stabilize proteins uncovers a chaperone called spy. Nature Structural & Molecular Biology, 18:262-269, Feb 2011. URL: https://doi.org/10.1038/nsmb.2016, doi:10.1038/nsmb.2016. This article has 223 citations and is from a highest quality peer-reviewed journal.

  19. (kaur2024nextgenerationantibiotic pages 1-2): Jan Naseer Kaur, Navaldeep Singh, Nicholas M. Smith, Jack F. Klem, Raymond Cha, Yinzhi Lang, Liang Chen, Barry Kreiswirth, Patricia N. Holden, Jürgen B. Bulitta, and Brian T. Tsuji. Next generation antibiotic combinations to combat pan-drug resistant klebsiella pneumoniae. Scientific Reports, Feb 2024. URL: https://doi.org/10.1038/s41598-024-53130-z, doi:10.1038/s41598-024-53130-z. This article has 23 citations and is from a peer-reviewed journal.

  20. (ruan2020conversionofthe pages 8-11): Alessandro Ruan, Chang Ren, and Shu Quan. Conversion of the molecular chaperone spy into a novel fusion tag to enhance recombinant protein expression. Jan 2020. URL: https://doi.org/10.1016/j.jbiotec.2019.11.006, doi:10.1016/j.jbiotec.2019.11.006. This article has 23 citations and is from a peer-reviewed journal.

  21. (huang2025catalyzingproteinfolding pages 12-13): Zijue Huang and Scott Horowitz. Catalyzing protein folding by chaperones. Biology, 14(10):1450, Oct 2025. URL: https://doi.org/10.3390/biology14101450, doi:10.3390/biology14101450. This article has 0 citations.

Citations

  1. kwon2010thecrystalstructure pages 1-2
  2. quan2011geneticselectiondesigned pages 9-11
  3. kwon2010thecrystalstructure pages 2-5
  4. kwon2010thecrystalstructure pages 5-7
  5. quan2011geneticselectiondesigned pages 1-5
  6. quan2011geneticselectiondesigned pages 19-22
  7. ruan2020conversionofthe pages 16-29
  8. loiseau2024maintainingthemethionine pages 19-22
  9. yamamoto2008involvementofmultiple pages 1-2
  10. quan2011geneticselectiondesigned pages 28-32
  11. loiseau2024maintainingthemethionine pages 1-5
  12. leinberger2024proteinaggregationis pages 1-2
  13. kaur2024nextgenerationantibiotic pages 1-2
  14. ruan2020conversionofthe pages 8-11
  15. srivastava2014geneticregulationof pages 5-7
  16. huang2025catalyzingproteinfolding pages 12-13
  17. srivastava2014geneticregulationof pages 1-2
  18. quan2011geneticselectiondesigned pages 16-19
  19. kwon2010thecrystalstructure pages 7-8
  20. https://doi.org/10.1038/nsmb.2016
  21. https://doi.org/10.1002/pro.489
  22. https://doi.org/10.1016/j.jbiotec.2019.11.006
  23. https://doi.org/10.1101/2024.12.12.628106
  24. https://doi.org/10.1016/j.gene.2014.07.003
  25. https://doi.org/10.1016/j.jbiotec.2007.08.002
  26. https://doi.org/10.1038/s41598-024-53130-z
  27. https://doi.org/10.1128/msystems.01060-24
  28. https://doi.org/10.1002/pro.489,
  29. https://doi.org/10.1016/j.jbiotec.2019.11.006,
  30. https://doi.org/10.1101/2024.12.12.628106,
  31. https://doi.org/10.1128/msystems.01060-24,
  32. https://doi.org/10.1038/nsmb.2016,
  33. https://doi.org/10.1016/j.jbiotec.2007.08.002,
  34. https://doi.org/10.1016/j.gene.2014.07.003,
  35. https://doi.org/10.1038/s41598-024-53130-z,
  36. https://doi.org/10.3390/biology14101450,

OpenScientist

(Spy-hypotheses/prediction-folding-chaperone/openscientist.md)
AIGR Gene Hypothesis Deep Research — Final Report OpenScientist openscientist-autonomous 8 citations 2 artifacts 2026-07-11T07:25:46.858079 citations file

AIGR Gene Hypothesis Deep Research — Final Report

Target: E. coli Spy (P77754) — Prediction of "protein folding chaperone" (GO:0044183)

Gene: Spy (periplasmic chaperone Spy), Escherichia coli K-12 (NCBITaxon:83333)
UniProt: P77754 · Focus type: computational_prediction
Prediction source: GO-GPT via BioReason-Pro → GO:0044183 "protein folding chaperone"
Reference context: doi:10.64898/2026.03.19.712954


Summary

The GO-GPT (BioReason-Pro) prediction that E. coli Spy (P77754) functions as a protein folding chaperone (GO:0044183) is biologically correct. Direct, high-quality experimental evidence — spanning the discovery paper, biophysical kinetics, mechanistic dissection, and in vivo genetics — establishes Spy as an ATP-independent periplasmic chaperone that both suppresses client aggregation (holdase activity) and actively promotes client folding (foldase activity). Spy has the unusual property of allowing substrate proteins to reach their native state while continuously bound to the chaperone surface. This is precisely the molecular function that GO:0044183 is meant to capture.

Critically, however, the prediction does not represent novel biology. UniProtKB entry P77754 already carries GO:0044183 with an IDA (Inferred from Direct Assay) evidence code, alongside a coherent cluster of experimentally supported companion terms (unfolded protein binding, protein folding, homodimerization, periplasmic localization). The computational prediction therefore recovers established, directly demonstrated knowledge rather than proposing something new. It is best characterized as supported-but-redundant.

There is also no paralog-overannotation or frequency-bias risk. A direct InterPro query on P77754 shows that Spy is the founding, eponymous member of the CpxP/Spy (LTXXQ motif) chaperone family, and that a dedicated NCBIfam signature (NF007769) is itself named "ATP-independent periplasmic protein-refolding chaperone Spy." The chaperone assignment is anchored in the best-studied representative of its own signature, not inferred transitively from a distant homolog. The recommended curator action is to retain the existing IDA-supported annotation and log the prediction as "supported but redundant / not novel."


Key Findings

Finding 1 — Spy is an experimentally validated ATP-independent periplasmic chaperone (holdase + foldase)

Spy's chaperone function is not inferred; it is directly demonstrated by multiple independent studies. Spy was originally uncovered through a genetic selection designed to stabilize proteins, and its ATP-independent chaperone activity was shown in vitro at discovery: "In vitro studies demonstrate that the Spy protein is an effective ATP-independent chaperone that suppresses protein aggregation and aids protein refolding" (PMID: 21317898). This establishes the two canonical hallmarks of GO:0044183 — aggregation suppression (holdase) and assisted refolding (foldase) — without any energy input, and identified Spy as a structurally novel, flexible cradle-shaped chaperone dimer.

Subsequent mechanistic work sharpened the picture in a way that maps onto "protein folding chaperone" rather than a mere aggregation sink. Using the model client Im7, investigators showed that "Spy then allows Im7 to fully fold into its native state while it remains bound to the surface of the chaperone" (PMID: 26619265). This is a strong, direct statement of foldase activity: the chaperone actively supports the folding reaction rather than simply holding an unfolded client until conditions improve. A dedicated mechanistic study explicitly reconciled the holdase and foldase views: "Spy is an ATP-independent chaperone that acts as an aggregation inhibiting holdase but does so by allowing its substrate proteins to fold while they remain continuously chaperone bound, thus acting as a foldase as well" (PMID: 33558474), noting that the balance between holdase and foldase behavior is substrate specific.

Crucially, the activity is not confined to artificial in vitro clients. In vivo work demonstrated a physiological chaperone role in the periplasm: "the periplasmic chaperone Spy protects certain OMPs against protein-unfolding stress and can functionally compensate for other periplasmic chaperones, namely Skp and FkpA" (PMID: 34607455). The ability to functionally compensate for other bona fide periplasmic chaperones is compelling evidence that Spy operates within the cell's protein-homeostasis machinery, not only in a test tube. Together these findings satisfy the direct-assay, mechanistic, and in vivo criteria for the GO:0044183 molecular function. The UniProt curated function line summarizes the consensus: "An ATP-independent periplasmic chaperone, decreases protein aggregation and helps protein refolding."

Finding 2 — GO:0044183 is already a curated IDA annotation for Spy; the prediction is redundant, not novel

The central curation question for a computational_prediction focus is whether the predicted term adds information. Here it does not. UniProtKB P77754 already carries GO:0044183 "protein folding chaperone" with an IDA (Inferred from Direct Assay) evidence code attributed to UniProtKB curation. The entry additionally carries a coherent cluster of experimentally supported terms that describe the same biology from complementary GO angles:

GO ID Term Aspect Evidence
GO:0044183 protein folding chaperone MF IDA (UniProtKB)
GO:0051082 unfolded protein binding MF IDA (EcoCyc)
GO:0006457 protein folding BP IDA (EcoCyc)
GO:0042803 protein homodimerization activity MF IDA
GO:0030288 outer membrane-bounded periplasmic space CC IDA

The keyword "Chaperone" is also present on the entry. Because the predicted term is already present with the strongest routinely used experimental evidence code (IDA), the GO-GPT prediction recovers established knowledge. This is the best-case outcome for validating a prediction method, but it means the prediction should not generate a new annotation or change the review. The appropriate disposition is "supported but redundant."

Finding 3 — Spy is the founding member of the CpxP/Spy (LTXXQ) chaperone family; no paralog-overannotation risk

A key failure mode for computational GO predictions is paralog overannotation — a term propagating across a family from a single characterized member — or frequency bias inflating a common term. This risk was checked directly via the InterPro API on P77754 and found to be absent. The query returns:

Resource ID Name
Pfam PF07813 LTXXQ motif family protein
InterPro IPR012899 LTXXQ motif family protein
NCBIfam NF007769 ATP-independent periplasmic protein-refolding chaperone Spy
PIRSF PIRSF034445 Periplasmic protein chaperone, CpxP/Spy type
CDD cd09916 CpxP-related
CATH-Gene3D G3DSA:1.20.120.1490 Spy cradle-shaped superfamily

The existence of an NCBIfam signature named after Spy and describing its exact function ("ATP-independent periplasmic protein-refolding chaperone") means the chaperone assignment is supported at the family level by curated HMM evidence, not inferred by transitive overannotation from a distant paralog. Spy is the eponymous, founding, and directly characterized member of this family. Consequently the prediction is anchored in the best-studied representative of its own signature, and there is no paralog-confusion or frequency-bias artifact to discount.


Mechanistic Model / Interpretation

Spy's molecular function fits GO:0044183 cleanly and can be summarized as an integrated holdase–foldase cycle operating without ATP in the periplasm:

   Envelope / spheroplast stress (ethanol, butanol, tannic acid, Zn, Cu, OMP stress)
       (sensed via Cpx and Bae two-component systems; CpxR/BaeR)
     
Strong transcriptional induction of spy
     
     ┌──────────────────────────────────────────────────┐
       Spy homodimer (flexible cradle-shape, ATP-free)   
     └──────────────────────────────────────────────────┘
     
Client capture (unfolded / aggregation-prone
periplasmic & outer-membrane proteins)
     
┌────────────┴─────────────┐
                          
     HOLDASE                    FOLDASE
   suppresses aggregation     client (e.g., Im7) folds to
   (GO:0051082 binding)       native state WHILE bound to
              Spy surface (GO:0006457 folding)
└────────────┬─────────────┘
     
   Client release  driven by the disordered N-terminus
   (D26 electrostatic competition), energy-independent
     
   Restored periplasmic proteostasis; functional backup
   for Skp / FkpA

The distinguishing mechanistic feature — folding while continuously chaperone-bound, governed by an evolutionary balance of interaction strength (PMID: 31645566) and completed by client release via an intrinsically disordered N-terminus (PMID: 35595811) — is precisely the kind of active folding assistance that GO:0044183 is meant to capture, going beyond passive "holdase"-only descriptions. The molecular function (ATP-independent holdase/foldase), cellular component (periplasm; GO:0030288), and biological process (protein folding; GO:0006457) are mutually consistent and independently supported.

Importantly, the chaperone activity is the primary, direct molecular function of Spy, not a downstream phenotype. Stress-induced expression is the regulatory context in which the function is deployed, but the aggregation-suppression and folding-promotion activities are intrinsic biochemical properties demonstrated with purified protein and defined clients.


Evidence Base

Citation Evidence type Supports/Refutes/Qualifies Claim tested Key finding Context Confidence & limitations
PMID: 21317898 Direct assay + genetic selection + structure Supports Spy is an ATP-independent chaperone Suppresses aggregation, aids refolding without ATP; novel cradle-shaped dimer E. coli, in vitro + in vivo High; foundational discovery paper
PMID: 26619265 Direct assay (kinetics) Supports Spy promotes folding (foldase) Im7 folds to native state while bound to Spy In vitro, model client Im7 High; single well-studied client
PMID: 33558474 Direct assay (mechanistic) Supports/Qualifies Holdase vs foldase Holdase that permits folding while bound; substrate-specific balance In vitro, multiple substrates High; clarifies dual mechanism
PMID: 34607455 In vivo / functional Supports In vivo client protection Protects OMPs from unfolding stress; compensates for Skp/FkpA E. coli periplasm, in vivo High; establishes physiological role
PMID: 31645566 Direct assay (biophysical) Qualifies Basis of fold-while-bound Weak interactions enable folding; too-tight binding inhibits In vitro, Im7 & SH3 clients High; refines mechanism
PMID: 35595811 Direct assay (NMR/MD) Qualifies Client release mechanism Disordered N-terminus (D26) competes with client to drive release In vitro, NMR + simulation High; completes ATP-free cycle
PMID: 24999585 Genetics / regulation Qualifies (context) spy is stress-induced BaeR primary regulator under ethanol; CpxR/BaeR under metals E. coli transcription Moderate; regulatory context, not MF
PMID: 31705934 Applied / functional Supports Chaperone activity is portable Spy fusion tag enhances soluble expression; chaperone-dependent folding E. coli recombinant expression Moderate; applied, corroborative
UniProtKB P77754 (IDA) Database / curated Supports (redundancy) GO:0044183 already annotated Term present with IDA plus related MF/BP/CC terms Curated record High for redundancy claim
InterPro P77754 (PF07813, NF007769, PIRSF034445) Structural / evolutionary Supports (no artifact) Family-level chaperone support Dedicated Spy-named HMM signature; founding family member Computed from InterPro API High; rules out paralog overannotation

Narrative synthesis of the key papers:

  • Genetic selection designed to stabilize proteins uncovers a chaperone called Spy (PMID: 21317898) — Discovery paper establishing ATP-independent aggregation suppression and refolding. Foundational support.
  • Substrate protein folds while it is bound to the ATP-independent chaperone Spy (PMID: 26619265) — Direct demonstration of foldase activity (Im7 folds while bound). Core support.
  • Mechanism of the small ATP-independent chaperone Spy is substrate specific (PMID: 33558474) — Reconciles holdase and foldase mechanisms. Core support.
  • Chaperone Spy Protects Outer Membrane Proteins from Folding Stress via Dynamic Complex Formation (PMID: 34607455) — In vivo role; compensates for Skp/FkpA. Core support.
  • Protein folding while chaperone bound is dependent on weak interactions (PMID: 31645566) — Interaction-strength tuning of folding-while-bound. Mechanistic qualifier.
  • Insights into the client protein release mechanism of the ATP-independent chaperone Spy (PMID: 35595811) — Energy-independent release via disordered N-terminus. Mechanistic qualifier.
  • Genetic regulation of spy gene expression … in the presence of ethanol (PMID: 24999585) — BaeR/CpxR stress regulation. Regulatory context.
  • Conversion of the molecular chaperone Spy into a novel fusion tag (PMID: 31705934) — Applied folding enhancement. Corroborative.

GO Curation Implications

Lead (requires curator verification): RETAIN GO:0044183; do NOT add a new annotation from the prediction.

GO ID Aspect Term Current evidence Prediction status Lead action
GO:0044183 MF protein folding chaperone IDA (UniProtKB), already present Correct but redundant RETAIN
GO:0051082 MF unfolded protein binding IDA (EcoCyc) Complementary (holdase) RETAIN
GO:0006457 BP protein folding IDA (EcoCyc) Complementary RETAIN
GO:0042803 MF protein homodimerization activity IDA Functional dimer RETAIN
GO:0030288 CC outer membrane-bounded periplasmic space IDA Localization RETAIN
  • Aspect: GO:0044183 is a Molecular Function term, and the evidence supports it as such (holdase + foldase, ATP-independent).
  • Action: Retain the existing IDA-supported annotation. The GO-GPT prediction is concordant but redundant; it should be logged as "supported-but-redundant" and should not generate a new annotation line.
  • Specificity: The term is at an appropriate level. It is neither too broad (a bare "protein binding" GO:0005515 would be uninformative and is explicitly discouraged) nor too narrow. Companion terms give a complete, accurate picture.
  • Core vs. non-core: Chaperone/holdase-foldase activity is the core molecular function of Spy, not a peripheral or context-specific role.

No removal, generalization, or narrowing is warranted. If evaluating the prediction's added value, mark it redundant with existing IDA evidence (not novel).


Mechanistic Scope

Direct gene-product activity (in scope for GO:0044183):
- ATP-independent binding of unfolded/aggregation-prone clients over the convex surface of the flexible cradle-shaped homodimer (holdase; unfolded protein binding).
- Active promotion of client folding to the native state while the client remains chaperone-bound (foldase).
- Energy-independent client release via an intrinsically disordered N-terminus (D26).
- Homodimerization as the functional oligomeric state.

Regulatory / contextual (not the molecular function itself):
- Strong transcriptional induction under envelope/spheroplast and chemical denaturant stress (ethanol, butanol, tannic acid, Zn, Cu) via the Cpx (CpxR) and Bae (BaeR) two-component systems.

Downstream / applied phenotypes (consequences, not direct MF):
- Improved soluble expression of heterologous proteins when used as a fusion tag.
- Functional compensation for Skp/FkpA and protection of OMPs — a physiological consequence distinct from the biochemical MF.

The seed hypothesis targets the molecular function, and that is precisely what the direct assays establish. The stress-induction phenotype should not be mistaken for the function.


Conflicts and Alternatives

No credible evidence refutes the chaperone assignment. The alternative framing in the seed hypothesis — that "Spy's molecular function is unrelated to chaperone activity" — is not supported by any primary source. Potential confounders were considered and ruled out:

  • Paralog confusion / overannotation: Ruled out. Spy is the founding, eponymous member of the CpxP/Spy (LTXXQ) family, and the InterPro NCBIfam signature NF007769 is named for Spy and describes its exact function. The annotation flows from the characterized member itself.
  • In vitro-only artifact: Ruled out. In vivo work (PMID: 34607455) shows Spy protects OMPs and compensates for other periplasmic chaperones inside the cell.
  • Substrate-specificity caveat: PMID: 33558474 and PMID: 31645566 note the holdase/foldase balance is substrate specific and can be inhibited by overly tight binding. This qualifies the mechanism but does not undermine the GO:0044183 call, which is broad enough to encompass both behaviors.
  • Database carry-over: The GO:0044183 term carries IDA (direct assay), not IEA/ISS, so it is not a carry-over artifact.

The only genuine "conflict" is the novelty claim implicit in a prediction task: the prediction is correct but not new. This is a curation-workflow consideration, not a biological conflict.


Limitations and Knowledge Gaps

  1. Database snapshot dependency. The redundancy finding rests on the current UniProtKB/EcoCyc annotation state (P77754 already carrying GO:0044183 IDA). If a curator is working from a blinded or older annotation set in which the term is absent, the disposition would shift from "redundant" to "add with IDA." Resolution: verify the live GO annotation set for P77754 at review time (e.g., QuickGO).
  2. Reference doi:10.64898/2026.03.19.712954 not resolvable. The supplied reference (non-standard prefix, future-dated AIGR-internal identifier) could not be resolved programmatically and was treated as the prediction under evaluation, not as independent evidence. Resolution: curator should confirm what synthesized claim this identifier anchors.
  3. Native physiological client repertoire only partially defined. Most mechanistic data derive from a small set of model clients (Im7, SH3, apoflavodoxin) plus OMPs. Resolution: proteome-wide interactome/aggregation-protection screens. This gap does not affect the GO:0044183 call but limits BP granularity.
  4. No independent structural computation was run beyond InterPro signature retrieval; the cradle-shaped dimer fold is well established in the literature, so this was not limiting.

Discriminating Tests

Because the hypothesis is already supported and the term already annotated, discriminating experiments are chiefly confirmatory and scope-refining:

  1. Annotation-state audit (fastest, decisive for curation): Query QuickGO/UniProt for P77754 to confirm GO:0044183 IDA is present and correctly referenced — directly settles retain-vs-add.
  2. Provenance audit of the prediction: Determine whether GO-GPT derived GO:0044183 from Spy-specific evidence or from LTXXQ-family generalization — distinguishes an informed prediction from a family-frequency inference.
  3. Substrate-resolved holdase/foldase assay panel: Systematic in vitro folding assays across diverse clients to map the holdase↔foldase continuum (extends PMID: 33558474, PMID: 31645566).
  4. In vivo client capture: Crosslinking/MS or genetic suppression screens under envelope stress to enumerate physiological clients at proteome scale.

The classic assays that distinguish chaperone from non-chaperone (aggregation-suppression/refolding ± ATP, fold-while-bound kinetics, in vivo client stabilization) are all already published and positive for Spy.


Proposed Follow-up Experiments / Actions

For the curator (immediate):
- Retain GO:0044183 (IDA) on P77754; mark the GO-GPT prediction as supported-but-redundant / not novel in the review log.
- Confirm the IDA annotation is backed by strong primary references — recommend PMID: 21317898, PMID: 33558474, and PMID: 34607455.
- Ensure companion terms GO:0051082, GO:0006457, and CC GO:0030288 remain, as they collectively describe the function accurately.
- Do not promote generic "protein binding" (GO:0005515) as a summary term — a more informative chaperone term is fully supported.
- Confirm the intent/source of doi:10.64898/2026.03.19.712954 since it is unresolvable.

For method evaluation (AIGR / GO-GPT benchmarking):
- Record this case as a true-positive but non-novel prediction. It validates GO-GPT recall on a well-characterized gene but contributes no new curation value. Weight such cases when scoring prediction utility (recall vs. novelty).

For biology (lower priority, scope refinement):
- Proteome-wide mapping of Spy's periplasmic client repertoire under envelope stress.
- Systematic substrate-dependence characterization of the holdase/foldase switch.


Curation Leads (require curator verification)

Lead Detail
Action Retain GO:0044183 (IDA); flag prediction as supported-but-redundant; no new annotation
Candidate references to verify PMID: 21317898 — "effective ATP-independent chaperone that suppresses protein aggregation and aids protein refolding"; PMID: 26619265 — "allows Im7 to fully fold into its native state while it remains bound"; PMID: 33558474 — "holdase … acting as a foldase as well"; PMID: 34607455 — "protects certain OMPs … can functionally compensate for Skp and FkpA"
Candidate GO terms GO:0044183 (retain, MF); GO:0051082, GO:0006457, GO:0042803, GO:0030288 (retain)
No change recommended to Existing MF/BP/CC cluster — internally consistent and experimentally supported
Suggested question Is the prediction derived from Spy-specific evidence or LTXXQ-family generalization? Confirm the source of the unresolvable DOI.
Suggested experiment Proteome-scale in vivo client capture under envelope stress to refine BP granularity

Conclusion

The GO-GPT prediction of protein folding chaperone (GO:0044183) for E. coli Spy is correct and well supported by direct in vitro and in vivo evidence describing an ATP-independent periplasmic holdase-foldase that lets clients fold while remaining bound. It is not novel: the term is already an IDA-supported annotation on P77754, and there is no paralog-overannotation risk because Spy is the founding, eponymously named member of its chaperone family. The recommended curator action is to retain the existing annotation and record the prediction as supported-but-redundant.

Artifacts

📚 Additional Documentation

Bioreason Rl Predictions

(Spy-bioreason-rl-predictions.md)

BioReason Chat Export

Exported on March 22, 2026 at 02:54 AM


Organism: Escherichia coli

Sequence:

MRKLTALFVASTLALGAANLAHAADTTTAAPADAKPMMHHKGKFGPHQDMMFKDLNLTDAQKQQIREIMKGQRDQMKRPPLEERRAMHDIIASDTFDKVKAEAQIAKMEEQRKANMLAHMETQNKIYNILTPEQKKQFNANFEKRLTERPAAKGKMPATAE

Thinking Trace

I begin with the domain architecture. The polypeptide is fully encompassed by IPR052211 (Cpx two-component system auxiliary protein family, residues 1–161), establishing that the entire sequence is dedicated to supporting a membrane-proximal stress-signaling pathway rather than catalysis. Nested within this, residues 6–148 carry IPR012899 (LTXXQ motif family protein), a conserved structural motif class frequently associated with periplasmic or membrane-associated adaptors that stabilize stress-signaling assemblies. The absence of enzymatic signatures and the dominance of an auxiliary-system family signature together argue that this protein functions through binding and assembly rather than chemistry, steering me toward a binding-centric molecular role.

From this architecture, the molecular function resolves as protein binding (GO:0005515). Auxiliary modules in two-component systems typically tune signal flow by forming transient complexes with the cognate histidine kinase and downstream effectors. The LTXXQ motif family further supports a scaffold/adaptor role that organizes periplasmic or membrane-proximal assemblies. This binding-centric architecture causes regulatory control over pathway activity rather than direct substrate turnover.

Translating binding into process, auxiliary components in envelope-stress pathways modulate signal transduction cascades that govern proteostasis and stress adaptation. The Cpx system in particular monitors envelope and periplasmic stress; an auxiliary factor that stabilizes or targets the pathway naturally participates in signal relay and attenuation. Thus, the most parsimonious biological process is signal transduction (GO:0007165), where this protein shapes pathway throughput and timing rather than executing terminal reactions.

Cellular location follows from the system context and motif class. Cpx signaling operates at the envelope, and LTXXQ-bearing families are often peripherally associated with or resident in membrane-proximal compartments. In Escherichia coli, this places the protein at the cell envelope where sensory and adaptor modules concentrate. Therefore, I infer residence at the cell envelope (GO:0042657), consistent with an auxiliary assembly factor that needs to dock near membrane-embedded kinases and periplasmic substrates.

Mechanistically, I hypothesize that the LTXXQ-bearing core forms a stable adaptor that recruits or stabilizes the membrane-associated histidine kinase and its periplasmic partners, thereby biasing the pathway toward efficient envelope-stress surveillance. By binding the kinase and periplasmic targets, the protein likely enhances signal fidelity and spatial targeting. Expected partners include the cognate membrane histidine kinase and envelope-stress effectors; together they form a membrane-proximal signaling hub that routes information from the cell envelope to downstream transcriptional responses.

Functional Summary

An auxiliary component of a membrane-proximal stress-signaling pathway in Escherichia coli that operates at the cell envelope. It lacks catalytic motifs and instead functions through binding and assembly, stabilizing and tuning a two-component signaling module that monitors envelope and periplasmic stress. By organizing transient complexes near the membrane, it enhances signal relay and targeting within the stress-response network.

UniProt Summary

Auxiliary component of the Cpx stress protein system.

InterPro Domains

  • Cpx two-component system auxiliary protein (IPR052211, family) — residues 1-161
  • LTXXQ motif family protein (IPR012899, family) — residues 6-148

GO Terms

Molecular Function: molecular_function (GO:0003674), protein folding chaperone (GO:0044183), binding (GO:0005488), protein binding (GO:0005515), unfolded protein binding (GO:0051082)

Biological Process: biological_process (GO:0008150), response to stimulus (GO:0050896), cellular process (GO:0009987), cellular response to stimulus (GO:0051716), response to abiotic stimulus (GO:0009628), response to stress (GO:0006950), response to chemical (GO:0042221), response to hypoxia (GO:0001666), cellular response to chemical stimulus (GO:0070887), cellular response to stress (GO:0033554), response to oxygen levels (GO:0070482), cellular response to hypoxia (GO:0071456), cellular response to oxygen levels (GO:0071453), response to decreased oxygen levels (GO:0036293), cellular response to decreased oxygen levels (GO:0036294)

Cellular Component: cellular_component (GO:0005575), cellular anatomical entity (GO:0110165), intracellular anatomical structure (GO:0005622), organelle (GO:0043226), membrane (GO:0016020), envelope (GO:0031975), cytoplasm (GO:0005737), membrane-enclosed lumen (GO:0031974), organelle membrane (GO:0031090), organelle envelope (GO:0031967), intracellular organelle (GO:0043229), outer membrane (GO:0019867), plastid (GO:0009536), non-membrane-bounded organelle (GO:0043228), vacuole (GO:0005773), mitochondrion (GO:0005739), organelle lumen (GO:0043233), membrane-bounded organelle (GO:0043227), mitochondrial envelope (GO:0005740), intracellular membrane-bounded organelle (GO:0043231), bounding membrane of organelle (GO:0098588), intracellular non-membrane-bounded organelle (GO:0043232), plastid envelope (GO:0009526), plastid membrane (GO:0042170), organelle outer membrane (GO:0031968), intracellular organelle lumen (GO:0070013), mitochondrial membrane (GO:0031966), mitochondrial outer membrane (GO:0005741), ribosome (GO:0005840)


Generated by BioReason

Bioreason Rl Review

(Spy-bioreason-rl-review.md)

BioReason-Pro RL Review: Spy (E. coli)

Source: Spy-bioreason-rl-predictions.md

  • Correctness: 2/5
  • Completeness: 2/5

Functional Summary Review

The BioReason functional summary describes Spy as:

An auxiliary component of a membrane-proximal stress-signaling pathway in Escherichia coli that operates at the cell envelope. It lacks catalytic motifs and instead functions through binding and assembly, stabilizing and tuning a two-component signaling module that monitors envelope and periplasmic stress. By organizing transient complexes near the membrane, it enhances signal relay and targeting within the stress-response network.

This summary is fundamentally wrong about Spy's function. Spy (Spheroplast protein Y) is an ATP-independent periplasmic chaperone, not a signaling pathway component. The curated review establishes that Spy:
- Functions primarily as a holdase, preventing protein aggregation under stress conditions
- Forms a thin, cradle-shaped homodimer with a novel alpha-helical fold
- Is massively upregulated under envelope stress via the Bae and Cpx two-component systems
- Remarkably allows substrate proteins to fold while remaining bound to its surface (PMID:26619265)

BioReason misidentified Spy as a Cpx pathway auxiliary protein (IPR052211), treating it as analogous to CpxP. The InterPro domains listed are "Cpx two-component system auxiliary protein" (IPR052211) and "LTXXQ motif family protein" (IPR012899). While Spy is regulated by the Cpx system, it is not a signaling component of that system -- it is an effector/chaperone induced by the system.

The GO term predictions include many inappropriate terms: mitochondrial outer membrane, plastid envelope, ribosome, thylakoid -- all nonsensical for a bacterial periplasmic chaperone. The predictions also include protein folding chaperone (GO:0044183) and unfolded protein binding (GO:0051082), which are correct but contradict the narrative.

Comparison with interpro2go:

Spy has no GO_REF:0000002 annotations in the curated review. BioReason's classification of Spy under IPR052211 (Cpx auxiliary protein) appears to be the root cause of the misidentification. If the InterPro family assignment is incorrect or overly broad, BioReason would propagate that error. The curated review identifies Spy's core function as protein folding chaperone (GO:0044183) with periplasmic localization -- a very different picture from what BioReason produces.

Notes on thinking trace

The trace builds its entire functional model on IPR052211 (Cpx auxiliary protein) and IPR012899 (LTXXQ motif), leading it to describe Spy as a signaling adaptor rather than a chaperone. This is a case where incorrect or misleading InterPro family assignment leads to a fundamentally wrong functional prediction. The mention of "response to hypoxia" and "cellular response to decreased oxygen levels" in the GO predictions is baffling for Spy.

📄 View Raw YAML

id: P77754
gene_symbol: Spy
product_type: PROTEIN
status: DRAFT
taxon:
  id: NCBITaxon:83333
  label: Escherichia coli (strain K12)
description: Spy (Spheroplast protein Y) is an ATP-independent periplasmic chaperone
  in E. coli that functions primarily as a holdase, preventing protein aggregation
  under stress conditions (tannins, butanol, ethanol). It forms a thin, cradle-shaped
  homodimer with a novel alpha-helical fold. Spy is massively upregulated (up to 25-50%
  of periplasmic protein) under envelope stress via the Bae and Cpx two-component
  systems. Remarkably, Spy can also allow substrate proteins to fold while remaining
  bound to its surface, making it unusual among ATP-independent chaperones. It binds
  unfolded, intermediate, and native conformations of its substrates with comparable
  micromolar affinities.
existing_annotations:
- term:
    id: GO:0030288
    label: outer membrane-bounded periplasmic space
  evidence_type: IBA
  original_reference_id: GO_REF:0000033
  review:
    summary: IBA annotation for periplasmic localization of Spy, inferred from phylogenetic
      analysis. Spy is well established as a periplasmic protein based on extensive
      experimental evidence from multiple studies (PMID:9068658, PMID:21317898, PMID:9694902).
    action: ACCEPT
    reason: Spy was originally identified as a periplasmic protein (PMID:9068658)
      and its periplasmic localization has been confirmed repeatedly. The IBA annotation
      is consistent with all available experimental evidence and the UniProt record.
      The IDA annotation (below) provides direct experimental support.
    supported_by:
    - reference_id: PMID:9068658
      supporting_text: It encodes a precursor of a so far unknown 139-residue, rather
        basic periplasmic protein.
    - reference_id: PMID:21317898
      supporting_text: Spy overexpression leads to the accumulation of an otherwise
        highly unstable protein instead suggested that Spy might function as a chaperone
        that facilitates protein folding in the bacterial periplasm.
- term:
    id: GO:0051082
    label: unfolded protein binding
  evidence_type: IBA
  original_reference_id: GO_REF:0000033
  review:
    summary: IBA annotation for unfolded protein binding, inferred by phylogeny. Spy
      is indeed one of the best-characterized unfolded protein binders, demonstrated
      by ITC, stopped-flow fluorescence, and crystallographic studies (PMID:26619265,
      PMID:27239796). However, GO:0051082 is proposed for obsoletion and Spy is primarily
      a holdase chaperone that prevents aggregation in the periplasm.
    action: MODIFY
    reason: Spy is primarily a holdase -- an ATP-independent chaperone that binds
      unfolded/misfolded proteins to prevent aggregation in situ. It does not escort
      proteins between compartments, so GO:0140309 (unfolded protein carrier activity)
      does not apply. The ideal replacement is a proposed "holdase chaperone activity"
      NTR. Until that NTR exists, GO:0051082 should be retained. Spy also has some
      foldase-like activity (PMID:26619265), but its primary mechanism is holdase.
      GO:0044183 (protein folding chaperone, already annotated separately) captures
      the foldase aspect.
    proposed_replacement_terms:
    - id: GO:0051082
      label: unfolded protein binding (retain until holdase NTR created)
    supported_by:
    - reference_id: PMID:21317898
      supporting_text: In vitro studies demonstrate that the Spy protein is an effective
        ATP-independent chaperone that suppresses protein aggregation and aids protein
        refolding.
    - reference_id: PMID:26619265
      supporting_text: It has previously been thought that only ATP dependent "foldase"
        chaperones can actively facilitate protein folding. The ATP independent "holdase"
        chaperones were thought to play a more passive role, holding onto aggregation-sensitive
        folding intermediates
- term:
    id: GO:0042597
    label: periplasmic space
  evidence_type: IEA
  original_reference_id: GO_REF:0000120
  review:
    summary: IEA annotation for periplasmic space based on InterPro and UniProt subcellular
      location mappings. This is a broader term than GO:0030288 (outer membrane-bounded
      periplasmic space), which is also annotated. Both are correct.
    action: ACCEPT
    reason: The IEA mapping to periplasmic space is consistent with all experimental
      evidence. While GO:0030288 is more specific, the broader GO:0042597 is not incorrect
      for an IEA annotation. Spy is unambiguously a periplasmic protein (PMID:9068658,
      PMID:21317898, PMID:9694902).
    supported_by:
    - reference_id: PMID:9068658
      supporting_text: It encodes a precursor of a so far unknown 139-residue, rather
        basic periplasmic protein.
- term:
    id: GO:0005515
    label: protein binding
  evidence_type: IPI
  original_reference_id: PMID:26619265
  review:
    summary: IPI annotation for protein binding based on physical interaction evidence
      from IntAct (Spy interacts with immunity protein Imm). The PMID:26619265 study
      used ITC and stopped-flow fluorescence to demonstrate direct binding of Spy
      to Im7 in multiple conformational states (Kd values of 3.5-20.5 uM).
    action: REMOVE
    reason: GO:0005515 (protein binding) is uninformative for a protein whose core
      function is binding unfolded proteins as a chaperone. The chaperone-substrate
      interaction is already captured by GO:0051082 (unfolded protein binding) and
      GO:0044183 (protein folding chaperone). Per curation guidelines, protein binding
      should be avoided in favor of more specific MF terms.
    supported_by:
    - reference_id: PMID:26619265
      supporting_text: We found that Spy binds to all three variants of Im7, with
        affinities of 10.4 μM, 3.5 μM, and 20.5 μM for Im7-L18A L19A L37A (Im7U),
        Im7-L53A I54A (Im7I), and Im7-WT (Im7N), respectively
- term:
    id: GO:0006457
    label: protein folding
  evidence_type: IDA
  original_reference_id: PMID:21317898
  review:
    summary: IDA annotation for involvement in protein folding, based on the discovery
      paper showing that Spy suppresses protein aggregation and aids protein refolding
      in vitro. Spy increased refolding yield of chemically and thermally unfolded
      substrates in the absence of ATP or cofactors (PMID:21317898). Subsequent work
      showed that substrates can actually fold while bound to Spy's surface (PMID:26619265).
    action: ACCEPT
    reason: Spy is directly involved in protein folding in the periplasm. The original
      discovery paper demonstrated that Spy suppresses aggregation of multiple substrates
      (MDH, aldolase, GAPDH) and significantly increases refolding yield (PMID:21317898).
      The follow-up study (PMID:26619265) provided the remarkable finding that Im7
      folds while bound to Spy. This BP annotation accurately captures Spy's role.
    supported_by:
    - reference_id: PMID:21317898
      supporting_text: To test if Spy can support protein folding, even though it
        is localized to the ATP-devoid environment of the bacterial periplasm, we
        analyzed its influence on the refolding yield of chemically and thermally
        unfolded proteins. We found that Spy significantly increased the refolding
        yield of a number of substrates
    - reference_id: PMID:26619265
      supporting_text: Spy then allows Im7 to fully fold into its native state while
        it remains bound to the surface of the chaperone.
- term:
    id: GO:0044183
    label: protein folding chaperone
  evidence_type: IDA
  original_reference_id: PMID:26619265
  review:
    summary: IDA annotation for protein folding chaperone activity, based on the landmark
      study demonstrating that Im7 substrate folds while bound to Spy (PMID:26619265).
      Global kinetic fitting showed that the only model consistent with the data requires
      Im7 to fold completely (U -> I -> N) while remaining associated with Spy. This
      is unusual for an ATP-independent chaperone.
    action: ACCEPT
    reason: Spy is demonstrated to function as a protein folding chaperone, as the
      substrate Im7 folds through all intermediates while continuously bound to Spy's
      surface (PMID:26619265). Although Spy is primarily considered a holdase (preventing
      aggregation), it clearly also promotes folding without ATP. GO:0044183 is appropriate
      for this experimentally demonstrated activity. The structural basis for this
      was further elucidated by READ crystallography (PMID:27239796).
    supported_by:
    - reference_id: PMID:26619265
      supporting_text: A good fit was only achieved when we globally fit the data
        to the kinetic mechanism that allows both folding steps 4 and 5, i.e., complete
        folding of Im7 while bound to Spy, making this the simplest kinetic mechanism
        that can explain all of the experimental data
    - reference_id: PMID:27239796
      supporting_text: The ensemble shows that Spy-associated Im7 samples conformations
        ranging from unfolded to partially folded to native-like states and reveals
        how a substrate can explore its folding landscape while being bound to a chaperone.
- term:
    id: GO:0051082
    label: unfolded protein binding
  evidence_type: IDA
  original_reference_id: PMID:26619265
  review:
    summary: IDA annotation for unfolded protein binding based on ITC and stopped-flow
      kinetics showing Spy binds unfolded, intermediate, and native Im7 with micromolar
      affinities (PMID:26619265). Spy bound Im7U with Kd of 10.4 uM and association
      rate constant of 1.3 x 10^7 M-1 s-1, indicating rapid capture of unfolded substrate.
    action: MODIFY
    reason: The experimental evidence robustly supports Spy binding to unfolded proteins.
      However, GO:0051082 is proposed for obsoletion. Spy is primarily a holdase --
      it prevents aggregation in situ in the periplasm, not a carrier that escorts
      proteins between compartments. GO:0140309 (unfolded protein carrier activity)
      does NOT fit because Spy acts in situ. The ideal replacement is a proposed "holdase
      chaperone activity" NTR. Until the NTR exists, retain GO:0051082.
    proposed_replacement_terms:
    - id: GO:0051082
      label: unfolded protein binding (retain until holdase NTR created)
    supported_by:
    - reference_id: PMID:26619265
      supporting_text: We found that Spy binds to all three variants of Im7, with
        affinities of 10.4 μM, 3.5 μM, and 20.5 μM for Im7-L18A L19A L37A (Im7U),
        Im7-L53A I54A (Im7I), and Im7-WT (Im7N), respectively
    - reference_id: PMID:26619265
      supporting_text: At this concentration, association between Spy and Im7U would
        be very rapid (occurring with a half-time of 26 μs)
- term:
    id: GO:0051082
    label: unfolded protein binding
  evidence_type: IDA
  original_reference_id: PMID:27239796
  review:
    summary: IDA annotation for unfolded protein binding based on crystallographic
      visualization of Spy-Im7 complex using the READ (Residual Electron and Anomalous
      Density) technique (PMID:27239796). The structural ensemble captured Im7 in
      multiple conformations (unfolded, partially folded, native-like) bound within
      Spy's cradle-shaped concave surface.
    action: MODIFY
    reason: Same rationale as the other GO:0051082 annotations. The READ structural
      study provides direct visualization of an unfolded substrate bound to Spy, confirming
      unfolded protein binding. However, GO:0051082 is proposed for obsoletion and
      Spy is an in-situ holdase, not a carrier. Retain GO:0051082 until the holdase
      NTR is created.
    proposed_replacement_terms:
    - id: GO:0051082
      label: unfolded protein binding (retain until holdase NTR created)
    supported_by:
    - reference_id: PMID:27239796
      supporting_text: The ensemble shows that Spy-associated Im7 samples conformations
        ranging from unfolded to partially folded to native-like states and reveals
        how a substrate can explore its folding landscape while being bound to a chaperone.
    - reference_id: PMID:27239796
      supporting_text: we observed that Im76-45 takes on several different conformations
        while bound. We found these conformations to be highly heterogeneous and to
        include unfolded, partially folded, and native-like states
- term:
    id: GO:0042803
    label: protein homodimerization activity
  evidence_type: IDA
  original_reference_id: PMID:20799348
  review:
    summary: IDA annotation for protein homodimerization based on the crystal structure
      of Spy (PMID:20799348), which revealed an antiparallel homodimer with a curved
      oval shape. The dimer interface buries approximately 1850 A^2 per monomer, indicating
      a stable dimeric assembly.
    action: ACCEPT
    reason: The crystal structure unambiguously shows Spy as a homodimer (PMID:20799348),
      confirmed independently by a second crystal structure (PMID:21317898), size
      exclusion chromatography, and analytical ultracentrifugation. Homodimerization
      is functionally essential for forming the cradle-shaped substrate binding surface.
      This is a core structural feature of Spy.
    supported_by:
    - reference_id: PMID:20799348
      supporting_text: which reveals a long kinked hairpin-like structure of four
        α-helices that form an antiparallel dimer
    - reference_id: PMID:21317898
      supporting_text: The crystal structure shows that Spy molecules associate into
        tightly bound dimers
- term:
    id: GO:0030288
    label: outer membrane-bounded periplasmic space
  evidence_type: IDA
  original_reference_id: PMID:9068658
  review:
    summary: IDA annotation for periplasmic localization based on the original discovery
      of Spy (PMID:9068658). Spy was identified as a new periplasmic protein produced
      abundantly in spheroplasts but not in intact cells. The protein contains a signal
      peptide (residues 1-23) directing it to the periplasm.
    action: ACCEPT
    reason: The original identification of Spy as a periplasmic protein (PMID:9068658)
      is the foundational localization evidence. The signal peptide cleaves at position
      23 to generate the mature periplasmic form. This has been confirmed by multiple
      subsequent studies (PMID:9694902, PMID:21317898). UniProt also annotates Spy
      to the periplasm with multiple experimental evidence codes.
    supported_by:
    - reference_id: PMID:9068658
      supporting_text: It encodes a precursor of a so far unknown 139-residue, rather
        basic periplasmic protein. It was not detectable immunologically in intact
        cells but was produced abundantly in spheroplasts.
- term:
    id: GO:0042803
    label: protein homodimerization activity
  evidence_type: IDA
  original_reference_id: PMID:21317898
  review:
    summary: IDA annotation for protein homodimerization from the Spy chaperone discovery
      paper (PMID:21317898). The crystal structure, size exclusion chromatography,
      and analytical ultracentrifugation all confirmed that Spy is a homodimer with
      extensive monomer-monomer contacts burying ~1850 A^2 per monomer.
    action: ACCEPT
    reason: Independent confirmation of Spy homodimerization using multiple biophysical
      methods (crystallography, SEC, AUC) in the landmark chaperone discovery paper.
      This is a duplicate of the PMID:20799348 annotation (both correct) and reflects
      that two independent groups solved the Spy dimer structure. Homodimerization
      is essential for the cradle architecture that enables chaperone function.
    supported_by:
    - reference_id: PMID:21317898
      supporting_text: The crystal structure shows that Spy molecules associate into
        tightly bound dimers
    - reference_id: PMID:21317898
      supporting_text: The contacts between the two monomers are extensive, burying
        a surface of ∼1850 Å2 per monomer upon dimerization and suggesting high dimeric
        stability
references:
- id: GO_REF:0000033
  title: Annotation inferences using phylogenetic trees
  findings: []
- id: GO_REF:0000120
  title: Combined Automated Annotation using Multiple IEA Methods
  findings: []
- id: PMID:9068658
  title: A new periplasmic protein of Escherichia coli which is synthesized in spheroplasts
    but not in intact cells.
  findings: []
- id: PMID:20799348
  title: The crystal structure Escherichia coli Spy.
  findings: []
- id: PMID:21317898
  title: Genetic selection designed to stabilize proteins uncovers a chaperone called
    Spy.
  findings: []
- id: PMID:24497545
  title: Super Spy variants implicate flexibility in chaperone action.
  findings: []
- id: PMID:26619265
  title: Substrate protein folds while it is bound to the ATP-independent chaperone
    Spy.
  findings: []
- id: PMID:27239796
  title: Visualizing chaperone-assisted protein folding.
  findings: []
core_functions:
- molecular_function:
    id: GO:0044183
    label: protein folding chaperone
  description: Spy is an ATP-independent periplasmic chaperone that suppresses protein
    aggregation and aids protein refolding (PMID:21317898). Remarkably, substrate
    Im7 folds completely while remaining bound to Spy's cradle-shaped surface (PMID:26619265).
    Global kinetic fitting demonstrated that the only consistent model requires folding
    while bound. Structural ensembles captured substrates in unfolded, intermediate,
    and native-like conformations on Spy (PMID:27239796). Spy is primarily a holdase
    (preventing aggregation in situ without ATP), but also has foldase-like activity
    as substrates can fold while bound. The ideal MF annotation would be the proposed
    holdase chaperone activity NTR in addition to GO:0044183. GO:0140309 (carrier-holdase)
    does NOT fit because Spy acts in situ in the periplasm, not as an inter-compartment
    carrier.
  directly_involved_in:
  - id: GO:0006457
    label: protein folding
  locations:
  - id: GO:0030288
    label: outer membrane-bounded periplasmic space
  supported_by:
  - reference_id: PMID:21317898
    supporting_text: In vitro studies demonstrate that the Spy protein is an effective
      ATP-independent chaperone that suppresses protein aggregation and aids protein
      refolding.
  - reference_id: PMID:26619265
    supporting_text: Spy then allows Im7 to fully fold into its native state while
      it remains bound to the surface of the chaperone.
  - reference_id: PMID:27239796
    supporting_text: The ensemble shows that Spy-associated Im7 samples conformations
      ranging from unfolded to partially folded to native-like states and reveals
      how a substrate can explore its folding landscape while being bound to a chaperone.