Spy

UniProt ID: P77754
Organism: Escherichia coli (strain K12)
Review Status: DRAFT
📝 Provide Detailed Feedback

Gene Description

Spy (Spheroplast protein Y) is an ATP-independent periplasmic chaperone in E. coli that functions primarily as a holdase, preventing protein aggregation under stress conditions (tannins, butanol, ethanol). It forms a thin, cradle-shaped homodimer with a novel alpha-helical fold. Spy is massively upregulated (up to 25-50% of periplasmic protein) under envelope stress via the Bae and Cpx two-component systems. Remarkably, Spy can also allow substrate proteins to fold while remaining bound to its surface, making it unusual among ATP-independent chaperones. It binds unfolded, intermediate, and native conformations of its substrates with comparable micromolar affinities.

Existing Annotations Review

GO Term Evidence Action Reason
GO:0030288 outer membrane-bounded periplasmic space
IBA
GO_REF:0000033
ACCEPT
Summary: IBA annotation for periplasmic localization of Spy, inferred from phylogenetic analysis. Spy is well established as a periplasmic protein based on extensive experimental evidence from multiple studies (PMID:9068658, PMID:21317898, PMID:9694902).
Reason: Spy was originally identified as a periplasmic protein (PMID:9068658) and its periplasmic localization has been confirmed repeatedly. The IBA annotation is consistent with all available experimental evidence and the UniProt record. The IDA annotation (below) provides direct experimental support.
Supporting Evidence:
PMID:9068658
It encodes a precursor of a so far unknown 139-residue, rather basic periplasmic protein.
PMID:21317898
Spy overexpression leads to the accumulation of an otherwise highly unstable protein instead suggested that Spy might function as a chaperone that facilitates protein folding in the bacterial periplasm.
GO:0051082 unfolded protein binding
IBA
GO_REF:0000033
MODIFY
Summary: IBA annotation for unfolded protein binding, inferred by phylogeny. Spy is indeed one of the best-characterized unfolded protein binders, demonstrated by ITC, stopped-flow fluorescence, and crystallographic studies (PMID:26619265, PMID:27239796). However, GO:0051082 is proposed for obsoletion and Spy is primarily a holdase chaperone that prevents aggregation in the periplasm.
Reason: Spy is primarily a holdase -- an ATP-independent chaperone that binds unfolded/misfolded proteins to prevent aggregation in situ. It does not escort proteins between compartments, so GO:0140309 (unfolded protein carrier activity) does not apply. The ideal replacement is a proposed "holdase chaperone activity" NTR. Until that NTR exists, GO:0051082 should be retained. Spy also has some foldase-like activity (PMID:26619265), but its primary mechanism is holdase. GO:0044183 (protein folding chaperone, already annotated separately) captures the foldase aspect.
Supporting Evidence:
PMID:21317898
In vitro studies demonstrate that the Spy protein is an effective ATP-independent chaperone that suppresses protein aggregation and aids protein refolding.
PMID:26619265
It has previously been thought that only ATP dependent "foldase" chaperones can actively facilitate protein folding. The ATP independent "holdase" chaperones were thought to play a more passive role, holding onto aggregation-sensitive folding intermediates
GO:0042597 periplasmic space
IEA
GO_REF:0000120
ACCEPT
Summary: IEA annotation for periplasmic space based on InterPro and UniProt subcellular location mappings. This is a broader term than GO:0030288 (outer membrane-bounded periplasmic space), which is also annotated. Both are correct.
Reason: The IEA mapping to periplasmic space is consistent with all experimental evidence. While GO:0030288 is more specific, the broader GO:0042597 is not incorrect for an IEA annotation. Spy is unambiguously a periplasmic protein (PMID:9068658, PMID:21317898, PMID:9694902).
Supporting Evidence:
PMID:9068658
It encodes a precursor of a so far unknown 139-residue, rather basic periplasmic protein.
GO:0005515 protein binding
IPI
PMID:26619265
Substrate protein folds while it is bound to the ATP-indepen...
REMOVE
Summary: IPI annotation for protein binding based on physical interaction evidence from IntAct (Spy interacts with immunity protein Imm). The PMID:26619265 study used ITC and stopped-flow fluorescence to demonstrate direct binding of Spy to Im7 in multiple conformational states (Kd values of 3.5-20.5 uM).
Reason: GO:0005515 (protein binding) is uninformative for a protein whose core function is binding unfolded proteins as a chaperone. The chaperone-substrate interaction is already captured by GO:0051082 (unfolded protein binding) and GO:0044183 (protein folding chaperone). Per curation guidelines, protein binding should be avoided in favor of more specific MF terms.
Supporting Evidence:
PMID:26619265
We found that Spy binds to all three variants of Im7, with affinities of 10.4 ΞM, 3.5 ΞM, and 20.5 ΞM for Im7-L18A L19A L37A (Im7U), Im7-L53A I54A (Im7I), and Im7-WT (Im7N), respectively
GO:0006457 protein folding
IDA
PMID:21317898
Genetic selection designed to stabilize proteins uncovers a ...
ACCEPT
Summary: IDA annotation for involvement in protein folding, based on the discovery paper showing that Spy suppresses protein aggregation and aids protein refolding in vitro. Spy increased refolding yield of chemically and thermally unfolded substrates in the absence of ATP or cofactors (PMID:21317898). Subsequent work showed that substrates can actually fold while bound to Spy's surface (PMID:26619265).
Reason: Spy is directly involved in protein folding in the periplasm. The original discovery paper demonstrated that Spy suppresses aggregation of multiple substrates (MDH, aldolase, GAPDH) and significantly increases refolding yield (PMID:21317898). The follow-up study (PMID:26619265) provided the remarkable finding that Im7 folds while bound to Spy. This BP annotation accurately captures Spy's role.
Supporting Evidence:
PMID:21317898
To test if Spy can support protein folding, even though it is localized to the ATP-devoid environment of the bacterial periplasm, we analyzed its influence on the refolding yield of chemically and thermally unfolded proteins. We found that Spy significantly increased the refolding yield of a number of substrates
PMID:26619265
Spy then allows Im7 to fully fold into its native state while it remains bound to the surface of the chaperone.
GO:0044183 protein folding chaperone
IDA
PMID:26619265
Substrate protein folds while it is bound to the ATP-indepen...
ACCEPT
Summary: IDA annotation for protein folding chaperone activity, based on the landmark study demonstrating that Im7 substrate folds while bound to Spy (PMID:26619265). Global kinetic fitting showed that the only model consistent with the data requires Im7 to fold completely (U -> I -> N) while remaining associated with Spy. This is unusual for an ATP-independent chaperone.
Reason: Spy is demonstrated to function as a protein folding chaperone, as the substrate Im7 folds through all intermediates while continuously bound to Spy's surface (PMID:26619265). Although Spy is primarily considered a holdase (preventing aggregation), it clearly also promotes folding without ATP. GO:0044183 is appropriate for this experimentally demonstrated activity. The structural basis for this was further elucidated by READ crystallography (PMID:27239796).
Supporting Evidence:
PMID:26619265
A good fit was only achieved when we globally fit the data to the kinetic mechanism that allows both folding steps 4 and 5, i.e., complete folding of Im7 while bound to Spy, making this the simplest kinetic mechanism that can explain all of the experimental data
PMID:27239796
The ensemble shows that Spy-associated Im7 samples conformations ranging from unfolded to partially folded to native-like states and reveals how a substrate can explore its folding landscape while being bound to a chaperone.
GO:0051082 unfolded protein binding
IDA
PMID:26619265
Substrate protein folds while it is bound to the ATP-indepen...
MODIFY
Summary: IDA annotation for unfolded protein binding based on ITC and stopped-flow kinetics showing Spy binds unfolded, intermediate, and native Im7 with micromolar affinities (PMID:26619265). Spy bound Im7U with Kd of 10.4 uM and association rate constant of 1.3 x 10^7 M-1 s-1, indicating rapid capture of unfolded substrate.
Reason: The experimental evidence robustly supports Spy binding to unfolded proteins. However, GO:0051082 is proposed for obsoletion. Spy is primarily a holdase -- it prevents aggregation in situ in the periplasm, not a carrier that escorts proteins between compartments. GO:0140309 (unfolded protein carrier activity) does NOT fit because Spy acts in situ. The ideal replacement is a proposed "holdase chaperone activity" NTR. Until the NTR exists, retain GO:0051082.
Supporting Evidence:
PMID:26619265
We found that Spy binds to all three variants of Im7, with affinities of 10.4 ΞM, 3.5 ΞM, and 20.5 ΞM for Im7-L18A L19A L37A (Im7U), Im7-L53A I54A (Im7I), and Im7-WT (Im7N), respectively
PMID:26619265
At this concentration, association between Spy and Im7U would be very rapid (occurring with a half-time of 26 Ξs)
GO:0051082 unfolded protein binding
IDA
PMID:27239796
Visualizing chaperone-assisted protein folding.
MODIFY
Summary: IDA annotation for unfolded protein binding based on crystallographic visualization of Spy-Im7 complex using the READ (Residual Electron and Anomalous Density) technique (PMID:27239796). The structural ensemble captured Im7 in multiple conformations (unfolded, partially folded, native-like) bound within Spy's cradle-shaped concave surface.
Reason: Same rationale as the other GO:0051082 annotations. The READ structural study provides direct visualization of an unfolded substrate bound to Spy, confirming unfolded protein binding. However, GO:0051082 is proposed for obsoletion and Spy is an in-situ holdase, not a carrier. Retain GO:0051082 until the holdase NTR is created.
Supporting Evidence:
PMID:27239796
The ensemble shows that Spy-associated Im7 samples conformations ranging from unfolded to partially folded to native-like states and reveals how a substrate can explore its folding landscape while being bound to a chaperone.
PMID:27239796
we observed that Im76-45 takes on several different conformations while bound. We found these conformations to be highly heterogeneous and to include unfolded, partially folded, and native-like states
GO:0042803 protein homodimerization activity
IDA
PMID:20799348
The crystal structure Escherichia coli Spy.
ACCEPT
Summary: IDA annotation for protein homodimerization based on the crystal structure of Spy (PMID:20799348), which revealed an antiparallel homodimer with a curved oval shape. The dimer interface buries approximately 1850 A^2 per monomer, indicating a stable dimeric assembly.
Reason: The crystal structure unambiguously shows Spy as a homodimer (PMID:20799348), confirmed independently by a second crystal structure (PMID:21317898), size exclusion chromatography, and analytical ultracentrifugation. Homodimerization is functionally essential for forming the cradle-shaped substrate binding surface. This is a core structural feature of Spy.
Supporting Evidence:
PMID:20799348
which reveals a long kinked hairpin-like structure of four Îą-helices that form an antiparallel dimer
PMID:21317898
The crystal structure shows that Spy molecules associate into tightly bound dimers
GO:0030288 outer membrane-bounded periplasmic space
IDA
PMID:9068658
A new periplasmic protein of Escherichia coli which is synth...
ACCEPT
Summary: IDA annotation for periplasmic localization based on the original discovery of Spy (PMID:9068658). Spy was identified as a new periplasmic protein produced abundantly in spheroplasts but not in intact cells. The protein contains a signal peptide (residues 1-23) directing it to the periplasm.
Reason: The original identification of Spy as a periplasmic protein (PMID:9068658) is the foundational localization evidence. The signal peptide cleaves at position 23 to generate the mature periplasmic form. This has been confirmed by multiple subsequent studies (PMID:9694902, PMID:21317898). UniProt also annotates Spy to the periplasm with multiple experimental evidence codes.
Supporting Evidence:
PMID:9068658
It encodes a precursor of a so far unknown 139-residue, rather basic periplasmic protein. It was not detectable immunologically in intact cells but was produced abundantly in spheroplasts.
GO:0042803 protein homodimerization activity
IDA
PMID:21317898
Genetic selection designed to stabilize proteins uncovers a ...
ACCEPT
Summary: IDA annotation for protein homodimerization from the Spy chaperone discovery paper (PMID:21317898). The crystal structure, size exclusion chromatography, and analytical ultracentrifugation all confirmed that Spy is a homodimer with extensive monomer-monomer contacts burying ~1850 A^2 per monomer.
Reason: Independent confirmation of Spy homodimerization using multiple biophysical methods (crystallography, SEC, AUC) in the landmark chaperone discovery paper. This is a duplicate of the PMID:20799348 annotation (both correct) and reflects that two independent groups solved the Spy dimer structure. Homodimerization is essential for the cradle architecture that enables chaperone function.
Supporting Evidence:
PMID:21317898
The crystal structure shows that Spy molecules associate into tightly bound dimers
PMID:21317898
The contacts between the two monomers are extensive, burying a surface of ∞1850 Å2 per monomer upon dimerization and suggesting high dimeric stability

Core Functions

Spy is an ATP-independent periplasmic chaperone that suppresses protein aggregation and aids protein refolding (PMID:21317898). Remarkably, substrate Im7 folds completely while remaining bound to Spy's cradle-shaped surface (PMID:26619265). Global kinetic fitting demonstrated that the only consistent model requires folding while bound. Structural ensembles captured substrates in unfolded, intermediate, and native-like conformations on Spy (PMID:27239796). Spy is primarily a holdase (preventing aggregation in situ without ATP), but also has foldase-like activity as substrates can fold while bound. The ideal MF annotation would be the proposed holdase chaperone activity NTR in addition to GO:0044183. GO:0140309 (carrier-holdase) does NOT fit because Spy acts in situ in the periplasm, not as an inter-compartment carrier.

Molecular Function:
protein folding chaperone
Directly Involved In:
Supporting Evidence:
  • PMID:21317898
    In vitro studies demonstrate that the Spy protein is an effective ATP-independent chaperone that suppresses protein aggregation and aids protein refolding.
  • PMID:26619265
    Spy then allows Im7 to fully fold into its native state while it remains bound to the surface of the chaperone.
  • PMID:27239796
    The ensemble shows that Spy-associated Im7 samples conformations ranging from unfolded to partially folded to native-like states and reveals how a substrate can explore its folding landscape while being bound to a chaperone.

References

Annotation inferences using phylogenetic trees
Combined Automated Annotation using Multiple IEA Methods
A new periplasmic protein of Escherichia coli which is synthesized in spheroplasts but not in intact cells.
The crystal structure Escherichia coli Spy.
Genetic selection designed to stabilize proteins uncovers a chaperone called Spy.
Super Spy variants implicate flexibility in chaperone action.
Substrate protein folds while it is bound to the ATP-independent chaperone Spy.
Visualizing chaperone-assisted protein folding.

📚 Additional Documentation

Deep Research Bioreason

(Spy-deep-research-bioreason.md)

BioReason Chat Export

Exported on March 22, 2026 at 02:54 AM


Organism: Escherichia coli

Sequence:

MRKLTALFVASTLALGAANLAHAADTTTAAPADAKPMMHHKGKFGPHQDMMFKDLNLTDAQKQQIREIMKGQRDQMKRPPLEERRAMHDIIASDTFDKVKAEAQIAKMEEQRKANMLAHMETQNKIYNILTPEQKKQFNANFEKRLTERPAAKGKMPATAE

Thinking Trace

I begin with the domain architecture. The polypeptide is fully encompassed by IPR052211 (Cpx two-component system auxiliary protein family, residues 1–161), establishing that the entire sequence is dedicated to supporting a membrane-proximal stress-signaling pathway rather than catalysis. Nested within this, residues 6–148 carry IPR012899 (LTXXQ motif family protein), a conserved structural motif class frequently associated with periplasmic or membrane-associated adaptors that stabilize stress-signaling assemblies. The absence of enzymatic signatures and the dominance of an auxiliary-system family signature together argue that this protein functions through binding and assembly rather than chemistry, steering me toward a binding-centric molecular role.

From this architecture, the molecular function resolves as protein binding (GO:0005515). Auxiliary modules in two-component systems typically tune signal flow by forming transient complexes with the cognate histidine kinase and downstream effectors. The LTXXQ motif family further supports a scaffold/adaptor role that organizes periplasmic or membrane-proximal assemblies. This binding-centric architecture causes regulatory control over pathway activity rather than direct substrate turnover.

Translating binding into process, auxiliary components in envelope-stress pathways modulate signal transduction cascades that govern proteostasis and stress adaptation. The Cpx system in particular monitors envelope and periplasmic stress; an auxiliary factor that stabilizes or targets the pathway naturally participates in signal relay and attenuation. Thus, the most parsimonious biological process is signal transduction (GO:0007165), where this protein shapes pathway throughput and timing rather than executing terminal reactions.

Cellular location follows from the system context and motif class. Cpx signaling operates at the envelope, and LTXXQ-bearing families are often peripherally associated with or resident in membrane-proximal compartments. In Escherichia coli, this places the protein at the cell envelope where sensory and adaptor modules concentrate. Therefore, I infer residence at the cell envelope (GO:0042657), consistent with an auxiliary assembly factor that needs to dock near membrane-embedded kinases and periplasmic substrates.

Mechanistically, I hypothesize that the LTXXQ-bearing core forms a stable adaptor that recruits or stabilizes the membrane-associated histidine kinase and its periplasmic partners, thereby biasing the pathway toward efficient envelope-stress surveillance. By binding the kinase and periplasmic targets, the protein likely enhances signal fidelity and spatial targeting. Expected partners include the cognate membrane histidine kinase and envelope-stress effectors; together they form a membrane-proximal signaling hub that routes information from the cell envelope to downstream transcriptional responses.

Functional Summary

An auxiliary component of a membrane-proximal stress-signaling pathway in Escherichia coli that operates at the cell envelope. It lacks catalytic motifs and instead functions through binding and assembly, stabilizing and tuning a two-component signaling module that monitors envelope and periplasmic stress. By organizing transient complexes near the membrane, it enhances signal relay and targeting within the stress-response network.

UniProt Summary

Auxiliary component of the Cpx stress protein system.

InterPro Domains

  • Cpx two-component system auxiliary protein (IPR052211, family) — residues 1-161
  • LTXXQ motif family protein (IPR012899, family) — residues 6-148

GO Terms

Molecular Function: molecular_function (GO:0003674), protein folding chaperone (GO:0044183), binding (GO:0005488), protein binding (GO:0005515), unfolded protein binding (GO:0051082)

Biological Process: biological_process (GO:0008150), response to stimulus (GO:0050896), cellular process (GO:0009987), cellular response to stimulus (GO:0051716), response to abiotic stimulus (GO:0009628), response to stress (GO:0006950), response to chemical (GO:0042221), response to hypoxia (GO:0001666), cellular response to chemical stimulus (GO:0070887), cellular response to stress (GO:0033554), response to oxygen levels (GO:0070482), cellular response to hypoxia (GO:0071456), cellular response to oxygen levels (GO:0071453), response to decreased oxygen levels (GO:0036293), cellular response to decreased oxygen levels (GO:0036294)

Cellular Component: cellular_component (GO:0005575), cellular anatomical entity (GO:0110165), intracellular anatomical structure (GO:0005622), organelle (GO:0043226), membrane (GO:0016020), envelope (GO:0031975), cytoplasm (GO:0005737), membrane-enclosed lumen (GO:0031974), organelle membrane (GO:0031090), organelle envelope (GO:0031967), intracellular organelle (GO:0043229), outer membrane (GO:0019867), plastid (GO:0009536), non-membrane-bounded organelle (GO:0043228), vacuole (GO:0005773), mitochondrion (GO:0005739), organelle lumen (GO:0043233), membrane-bounded organelle (GO:0043227), mitochondrial envelope (GO:0005740), intracellular membrane-bounded organelle (GO:0043231), bounding membrane of organelle (GO:0098588), intracellular non-membrane-bounded organelle (GO:0043232), plastid envelope (GO:0009526), plastid membrane (GO:0042170), organelle outer membrane (GO:0031968), intracellular organelle lumen (GO:0070013), mitochondrial membrane (GO:0031966), mitochondrial outer membrane (GO:0005741), ribosome (GO:0005840)


Generated by BioReason

Deep Research Bioreason Rl

(Spy-deep-research-bioreason-rl.md)

BioReason Chat Export

Exported on March 22, 2026 at 02:54 AM


Organism: Escherichia coli

Sequence:

MRKLTALFVASTLALGAANLAHAADTTTAAPADAKPMMHHKGKFGPHQDMMFKDLNLTDAQKQQIREIMKGQRDQMKRPPLEERRAMHDIIASDTFDKVKAEAQIAKMEEQRKANMLAHMETQNKIYNILTPEQKKQFNANFEKRLTERPAAKGKMPATAE

Thinking Trace

I begin with the domain architecture. The polypeptide is fully encompassed by IPR052211 (Cpx two-component system auxiliary protein family, residues 1–161), establishing that the entire sequence is dedicated to supporting a membrane-proximal stress-signaling pathway rather than catalysis. Nested within this, residues 6–148 carry IPR012899 (LTXXQ motif family protein), a conserved structural motif class frequently associated with periplasmic or membrane-associated adaptors that stabilize stress-signaling assemblies. The absence of enzymatic signatures and the dominance of an auxiliary-system family signature together argue that this protein functions through binding and assembly rather than chemistry, steering me toward a binding-centric molecular role.

From this architecture, the molecular function resolves as protein binding (GO:0005515). Auxiliary modules in two-component systems typically tune signal flow by forming transient complexes with the cognate histidine kinase and downstream effectors. The LTXXQ motif family further supports a scaffold/adaptor role that organizes periplasmic or membrane-proximal assemblies. This binding-centric architecture causes regulatory control over pathway activity rather than direct substrate turnover.

Translating binding into process, auxiliary components in envelope-stress pathways modulate signal transduction cascades that govern proteostasis and stress adaptation. The Cpx system in particular monitors envelope and periplasmic stress; an auxiliary factor that stabilizes or targets the pathway naturally participates in signal relay and attenuation. Thus, the most parsimonious biological process is signal transduction (GO:0007165), where this protein shapes pathway throughput and timing rather than executing terminal reactions.

Cellular location follows from the system context and motif class. Cpx signaling operates at the envelope, and LTXXQ-bearing families are often peripherally associated with or resident in membrane-proximal compartments. In Escherichia coli, this places the protein at the cell envelope where sensory and adaptor modules concentrate. Therefore, I infer residence at the cell envelope (GO:0042657), consistent with an auxiliary assembly factor that needs to dock near membrane-embedded kinases and periplasmic substrates.

Mechanistically, I hypothesize that the LTXXQ-bearing core forms a stable adaptor that recruits or stabilizes the membrane-associated histidine kinase and its periplasmic partners, thereby biasing the pathway toward efficient envelope-stress surveillance. By binding the kinase and periplasmic targets, the protein likely enhances signal fidelity and spatial targeting. Expected partners include the cognate membrane histidine kinase and envelope-stress effectors; together they form a membrane-proximal signaling hub that routes information from the cell envelope to downstream transcriptional responses.

Functional Summary

An auxiliary component of a membrane-proximal stress-signaling pathway in Escherichia coli that operates at the cell envelope. It lacks catalytic motifs and instead functions through binding and assembly, stabilizing and tuning a two-component signaling module that monitors envelope and periplasmic stress. By organizing transient complexes near the membrane, it enhances signal relay and targeting within the stress-response network.

UniProt Summary

Auxiliary component of the Cpx stress protein system.

InterPro Domains

  • Cpx two-component system auxiliary protein (IPR052211, family) — residues 1-161
  • LTXXQ motif family protein (IPR012899, family) — residues 6-148

GO Terms

Molecular Function: molecular_function (GO:0003674), protein folding chaperone (GO:0044183), binding (GO:0005488), protein binding (GO:0005515), unfolded protein binding (GO:0051082)

Biological Process: biological_process (GO:0008150), response to stimulus (GO:0050896), cellular process (GO:0009987), cellular response to stimulus (GO:0051716), response to abiotic stimulus (GO:0009628), response to stress (GO:0006950), response to chemical (GO:0042221), response to hypoxia (GO:0001666), cellular response to chemical stimulus (GO:0070887), cellular response to stress (GO:0033554), response to oxygen levels (GO:0070482), cellular response to hypoxia (GO:0071456), cellular response to oxygen levels (GO:0071453), response to decreased oxygen levels (GO:0036293), cellular response to decreased oxygen levels (GO:0036294)

Cellular Component: cellular_component (GO:0005575), cellular anatomical entity (GO:0110165), intracellular anatomical structure (GO:0005622), organelle (GO:0043226), membrane (GO:0016020), envelope (GO:0031975), cytoplasm (GO:0005737), membrane-enclosed lumen (GO:0031974), organelle membrane (GO:0031090), organelle envelope (GO:0031967), intracellular organelle (GO:0043229), outer membrane (GO:0019867), plastid (GO:0009536), non-membrane-bounded organelle (GO:0043228), vacuole (GO:0005773), mitochondrion (GO:0005739), organelle lumen (GO:0043233), membrane-bounded organelle (GO:0043227), mitochondrial envelope (GO:0005740), intracellular membrane-bounded organelle (GO:0043231), bounding membrane of organelle (GO:0098588), intracellular non-membrane-bounded organelle (GO:0043232), plastid envelope (GO:0009526), plastid membrane (GO:0042170), organelle outer membrane (GO:0031968), intracellular organelle lumen (GO:0070013), mitochondrial membrane (GO:0031966), mitochondrial outer membrane (GO:0005741), ribosome (GO:0005840)


Generated by BioReason

Bioreason Rl Review

(Spy-bioreason-rl-review.md)

BioReason-Pro RL Review: Spy (E. coli)

Source: Spy-deep-research-bioreason-rl.md

  • Correctness: 2/5
  • Completeness: 2/5

Functional Summary Review

The BioReason functional summary describes Spy as:

An auxiliary component of a membrane-proximal stress-signaling pathway in Escherichia coli that operates at the cell envelope. It lacks catalytic motifs and instead functions through binding and assembly, stabilizing and tuning a two-component signaling module that monitors envelope and periplasmic stress. By organizing transient complexes near the membrane, it enhances signal relay and targeting within the stress-response network.

This summary is fundamentally wrong about Spy's function. Spy (Spheroplast protein Y) is an ATP-independent periplasmic chaperone, not a signaling pathway component. The curated review establishes that Spy:
- Functions primarily as a holdase, preventing protein aggregation under stress conditions
- Forms a thin, cradle-shaped homodimer with a novel alpha-helical fold
- Is massively upregulated under envelope stress via the Bae and Cpx two-component systems
- Remarkably allows substrate proteins to fold while remaining bound to its surface (PMID:26619265)

BioReason misidentified Spy as a Cpx pathway auxiliary protein (IPR052211), treating it as analogous to CpxP. The InterPro domains listed are "Cpx two-component system auxiliary protein" (IPR052211) and "LTXXQ motif family protein" (IPR012899). While Spy is regulated by the Cpx system, it is not a signaling component of that system -- it is an effector/chaperone induced by the system.

The GO term predictions include many inappropriate terms: mitochondrial outer membrane, plastid envelope, ribosome, thylakoid -- all nonsensical for a bacterial periplasmic chaperone. The predictions also include protein folding chaperone (GO:0044183) and unfolded protein binding (GO:0051082), which are correct but contradict the narrative.

Comparison with interpro2go:

Spy has no GO_REF:0000002 annotations in the curated review. BioReason's classification of Spy under IPR052211 (Cpx auxiliary protein) appears to be the root cause of the misidentification. If the InterPro family assignment is incorrect or overly broad, BioReason would propagate that error. The curated review identifies Spy's core function as protein folding chaperone (GO:0044183) with periplasmic localization -- a very different picture from what BioReason produces.

Notes on thinking trace

The trace builds its entire functional model on IPR052211 (Cpx auxiliary protein) and IPR012899 (LTXXQ motif), leading it to describe Spy as a signaling adaptor rather than a chaperone. This is a case where incorrect or misleading InterPro family assignment leads to a fundamentally wrong functional prediction. The mention of "response to hypoxia" and "cellular response to decreased oxygen levels" in the GO predictions is baffling for Spy.

📄 View Raw YAML

id: P77754
gene_symbol: Spy
product_type: PROTEIN
status: DRAFT
taxon:
  id: NCBITaxon:83333
  label: Escherichia coli (strain K12)
description: Spy (Spheroplast protein Y) is an ATP-independent periplasmic chaperone
  in E. coli that functions primarily as a holdase, preventing protein aggregation
  under stress conditions (tannins, butanol, ethanol). It forms a thin, cradle-shaped
  homodimer with a novel alpha-helical fold. Spy is massively upregulated (up to 25-50%
  of periplasmic protein) under envelope stress via the Bae and Cpx two-component
  systems. Remarkably, Spy can also allow substrate proteins to fold while remaining
  bound to its surface, making it unusual among ATP-independent chaperones. It binds
  unfolded, intermediate, and native conformations of its substrates with comparable
  micromolar affinities.
existing_annotations:
- term:
    id: GO:0030288
    label: outer membrane-bounded periplasmic space
  evidence_type: IBA
  original_reference_id: GO_REF:0000033
  review:
    summary: IBA annotation for periplasmic localization of Spy, inferred from phylogenetic
      analysis. Spy is well established as a periplasmic protein based on extensive
      experimental evidence from multiple studies (PMID:9068658, PMID:21317898, PMID:9694902).
    action: ACCEPT
    reason: Spy was originally identified as a periplasmic protein (PMID:9068658)
      and its periplasmic localization has been confirmed repeatedly. The IBA annotation
      is consistent with all available experimental evidence and the UniProt record.
      The IDA annotation (below) provides direct experimental support.
    supported_by:
    - reference_id: PMID:9068658
      supporting_text: It encodes a precursor of a so far unknown 139-residue, rather
        basic periplasmic protein.
    - reference_id: PMID:21317898
      supporting_text: Spy overexpression leads to the accumulation of an otherwise
        highly unstable protein instead suggested that Spy might function as a chaperone
        that facilitates protein folding in the bacterial periplasm.
- term:
    id: GO:0051082
    label: unfolded protein binding
  evidence_type: IBA
  original_reference_id: GO_REF:0000033
  review:
    summary: IBA annotation for unfolded protein binding, inferred by phylogeny. Spy
      is indeed one of the best-characterized unfolded protein binders, demonstrated
      by ITC, stopped-flow fluorescence, and crystallographic studies (PMID:26619265,
      PMID:27239796). However, GO:0051082 is proposed for obsoletion and Spy is primarily
      a holdase chaperone that prevents aggregation in the periplasm.
    action: MODIFY
    reason: Spy is primarily a holdase -- an ATP-independent chaperone that binds
      unfolded/misfolded proteins to prevent aggregation in situ. It does not escort
      proteins between compartments, so GO:0140309 (unfolded protein carrier activity)
      does not apply. The ideal replacement is a proposed "holdase chaperone activity"
      NTR. Until that NTR exists, GO:0051082 should be retained. Spy also has some
      foldase-like activity (PMID:26619265), but its primary mechanism is holdase.
      GO:0044183 (protein folding chaperone, already annotated separately) captures
      the foldase aspect.
    proposed_replacement_terms:
    - id: GO:0051082
      label: unfolded protein binding (retain until holdase NTR created)
    supported_by:
    - reference_id: PMID:21317898
      supporting_text: In vitro studies demonstrate that the Spy protein is an effective
        ATP-independent chaperone that suppresses protein aggregation and aids protein
        refolding.
    - reference_id: PMID:26619265
      supporting_text: It has previously been thought that only ATP dependent "foldase"
        chaperones can actively facilitate protein folding. The ATP independent "holdase"
        chaperones were thought to play a more passive role, holding onto aggregation-sensitive
        folding intermediates
- term:
    id: GO:0042597
    label: periplasmic space
  evidence_type: IEA
  original_reference_id: GO_REF:0000120
  review:
    summary: IEA annotation for periplasmic space based on InterPro and UniProt subcellular
      location mappings. This is a broader term than GO:0030288 (outer membrane-bounded
      periplasmic space), which is also annotated. Both are correct.
    action: ACCEPT
    reason: The IEA mapping to periplasmic space is consistent with all experimental
      evidence. While GO:0030288 is more specific, the broader GO:0042597 is not incorrect
      for an IEA annotation. Spy is unambiguously a periplasmic protein (PMID:9068658,
      PMID:21317898, PMID:9694902).
    supported_by:
    - reference_id: PMID:9068658
      supporting_text: It encodes a precursor of a so far unknown 139-residue, rather
        basic periplasmic protein.
- term:
    id: GO:0005515
    label: protein binding
  evidence_type: IPI
  original_reference_id: PMID:26619265
  review:
    summary: IPI annotation for protein binding based on physical interaction evidence
      from IntAct (Spy interacts with immunity protein Imm). The PMID:26619265 study
      used ITC and stopped-flow fluorescence to demonstrate direct binding of Spy
      to Im7 in multiple conformational states (Kd values of 3.5-20.5 uM).
    action: REMOVE
    reason: GO:0005515 (protein binding) is uninformative for a protein whose core
      function is binding unfolded proteins as a chaperone. The chaperone-substrate
      interaction is already captured by GO:0051082 (unfolded protein binding) and
      GO:0044183 (protein folding chaperone). Per curation guidelines, protein binding
      should be avoided in favor of more specific MF terms.
    supported_by:
    - reference_id: PMID:26619265
      supporting_text: We found that Spy binds to all three variants of Im7, with
        affinities of 10.4 ΞM, 3.5 ΞM, and 20.5 ΞM for Im7-L18A L19A L37A (Im7U),
        Im7-L53A I54A (Im7I), and Im7-WT (Im7N), respectively
- term:
    id: GO:0006457
    label: protein folding
  evidence_type: IDA
  original_reference_id: PMID:21317898
  review:
    summary: IDA annotation for involvement in protein folding, based on the discovery
      paper showing that Spy suppresses protein aggregation and aids protein refolding
      in vitro. Spy increased refolding yield of chemically and thermally unfolded
      substrates in the absence of ATP or cofactors (PMID:21317898). Subsequent work
      showed that substrates can actually fold while bound to Spy's surface (PMID:26619265).
    action: ACCEPT
    reason: Spy is directly involved in protein folding in the periplasm. The original
      discovery paper demonstrated that Spy suppresses aggregation of multiple substrates
      (MDH, aldolase, GAPDH) and significantly increases refolding yield (PMID:21317898).
      The follow-up study (PMID:26619265) provided the remarkable finding that Im7
      folds while bound to Spy. This BP annotation accurately captures Spy's role.
    supported_by:
    - reference_id: PMID:21317898
      supporting_text: To test if Spy can support protein folding, even though it
        is localized to the ATP-devoid environment of the bacterial periplasm, we
        analyzed its influence on the refolding yield of chemically and thermally
        unfolded proteins. We found that Spy significantly increased the refolding
        yield of a number of substrates
    - reference_id: PMID:26619265
      supporting_text: Spy then allows Im7 to fully fold into its native state while
        it remains bound to the surface of the chaperone.
- term:
    id: GO:0044183
    label: protein folding chaperone
  evidence_type: IDA
  original_reference_id: PMID:26619265
  review:
    summary: IDA annotation for protein folding chaperone activity, based on the landmark
      study demonstrating that Im7 substrate folds while bound to Spy (PMID:26619265).
      Global kinetic fitting showed that the only model consistent with the data requires
      Im7 to fold completely (U -> I -> N) while remaining associated with Spy. This
      is unusual for an ATP-independent chaperone.
    action: ACCEPT
    reason: Spy is demonstrated to function as a protein folding chaperone, as the
      substrate Im7 folds through all intermediates while continuously bound to Spy's
      surface (PMID:26619265). Although Spy is primarily considered a holdase (preventing
      aggregation), it clearly also promotes folding without ATP. GO:0044183 is appropriate
      for this experimentally demonstrated activity. The structural basis for this
      was further elucidated by READ crystallography (PMID:27239796).
    supported_by:
    - reference_id: PMID:26619265
      supporting_text: A good fit was only achieved when we globally fit the data
        to the kinetic mechanism that allows both folding steps 4 and 5, i.e., complete
        folding of Im7 while bound to Spy, making this the simplest kinetic mechanism
        that can explain all of the experimental data
    - reference_id: PMID:27239796
      supporting_text: The ensemble shows that Spy-associated Im7 samples conformations
        ranging from unfolded to partially folded to native-like states and reveals
        how a substrate can explore its folding landscape while being bound to a chaperone.
- term:
    id: GO:0051082
    label: unfolded protein binding
  evidence_type: IDA
  original_reference_id: PMID:26619265
  review:
    summary: IDA annotation for unfolded protein binding based on ITC and stopped-flow
      kinetics showing Spy binds unfolded, intermediate, and native Im7 with micromolar
      affinities (PMID:26619265). Spy bound Im7U with Kd of 10.4 uM and association
      rate constant of 1.3 x 10^7 M-1 s-1, indicating rapid capture of unfolded substrate.
    action: MODIFY
    reason: The experimental evidence robustly supports Spy binding to unfolded proteins.
      However, GO:0051082 is proposed for obsoletion. Spy is primarily a holdase --
      it prevents aggregation in situ in the periplasm, not a carrier that escorts
      proteins between compartments. GO:0140309 (unfolded protein carrier activity)
      does NOT fit because Spy acts in situ. The ideal replacement is a proposed "holdase
      chaperone activity" NTR. Until the NTR exists, retain GO:0051082.
    proposed_replacement_terms:
    - id: GO:0051082
      label: unfolded protein binding (retain until holdase NTR created)
    supported_by:
    - reference_id: PMID:26619265
      supporting_text: We found that Spy binds to all three variants of Im7, with
        affinities of 10.4 ΞM, 3.5 ΞM, and 20.5 ΞM for Im7-L18A L19A L37A (Im7U),
        Im7-L53A I54A (Im7I), and Im7-WT (Im7N), respectively
    - reference_id: PMID:26619265
      supporting_text: At this concentration, association between Spy and Im7U would
        be very rapid (occurring with a half-time of 26 Ξs)
- term:
    id: GO:0051082
    label: unfolded protein binding
  evidence_type: IDA
  original_reference_id: PMID:27239796
  review:
    summary: IDA annotation for unfolded protein binding based on crystallographic
      visualization of Spy-Im7 complex using the READ (Residual Electron and Anomalous
      Density) technique (PMID:27239796). The structural ensemble captured Im7 in
      multiple conformations (unfolded, partially folded, native-like) bound within
      Spy's cradle-shaped concave surface.
    action: MODIFY
    reason: Same rationale as the other GO:0051082 annotations. The READ structural
      study provides direct visualization of an unfolded substrate bound to Spy, confirming
      unfolded protein binding. However, GO:0051082 is proposed for obsoletion and
      Spy is an in-situ holdase, not a carrier. Retain GO:0051082 until the holdase
      NTR is created.
    proposed_replacement_terms:
    - id: GO:0051082
      label: unfolded protein binding (retain until holdase NTR created)
    supported_by:
    - reference_id: PMID:27239796
      supporting_text: The ensemble shows that Spy-associated Im7 samples conformations
        ranging from unfolded to partially folded to native-like states and reveals
        how a substrate can explore its folding landscape while being bound to a chaperone.
    - reference_id: PMID:27239796
      supporting_text: we observed that Im76-45 takes on several different conformations
        while bound. We found these conformations to be highly heterogeneous and to
        include unfolded, partially folded, and native-like states
- term:
    id: GO:0042803
    label: protein homodimerization activity
  evidence_type: IDA
  original_reference_id: PMID:20799348
  review:
    summary: IDA annotation for protein homodimerization based on the crystal structure
      of Spy (PMID:20799348), which revealed an antiparallel homodimer with a curved
      oval shape. The dimer interface buries approximately 1850 A^2 per monomer, indicating
      a stable dimeric assembly.
    action: ACCEPT
    reason: The crystal structure unambiguously shows Spy as a homodimer (PMID:20799348),
      confirmed independently by a second crystal structure (PMID:21317898), size
      exclusion chromatography, and analytical ultracentrifugation. Homodimerization
      is functionally essential for forming the cradle-shaped substrate binding surface.
      This is a core structural feature of Spy.
    supported_by:
    - reference_id: PMID:20799348
      supporting_text: which reveals a long kinked hairpin-like structure of four
        Îą-helices that form an antiparallel dimer
    - reference_id: PMID:21317898
      supporting_text: The crystal structure shows that Spy molecules associate into
        tightly bound dimers
- term:
    id: GO:0030288
    label: outer membrane-bounded periplasmic space
  evidence_type: IDA
  original_reference_id: PMID:9068658
  review:
    summary: IDA annotation for periplasmic localization based on the original discovery
      of Spy (PMID:9068658). Spy was identified as a new periplasmic protein produced
      abundantly in spheroplasts but not in intact cells. The protein contains a signal
      peptide (residues 1-23) directing it to the periplasm.
    action: ACCEPT
    reason: The original identification of Spy as a periplasmic protein (PMID:9068658)
      is the foundational localization evidence. The signal peptide cleaves at position
      23 to generate the mature periplasmic form. This has been confirmed by multiple
      subsequent studies (PMID:9694902, PMID:21317898). UniProt also annotates Spy
      to the periplasm with multiple experimental evidence codes.
    supported_by:
    - reference_id: PMID:9068658
      supporting_text: It encodes a precursor of a so far unknown 139-residue, rather
        basic periplasmic protein. It was not detectable immunologically in intact
        cells but was produced abundantly in spheroplasts.
- term:
    id: GO:0042803
    label: protein homodimerization activity
  evidence_type: IDA
  original_reference_id: PMID:21317898
  review:
    summary: IDA annotation for protein homodimerization from the Spy chaperone discovery
      paper (PMID:21317898). The crystal structure, size exclusion chromatography,
      and analytical ultracentrifugation all confirmed that Spy is a homodimer with
      extensive monomer-monomer contacts burying ~1850 A^2 per monomer.
    action: ACCEPT
    reason: Independent confirmation of Spy homodimerization using multiple biophysical
      methods (crystallography, SEC, AUC) in the landmark chaperone discovery paper.
      This is a duplicate of the PMID:20799348 annotation (both correct) and reflects
      that two independent groups solved the Spy dimer structure. Homodimerization
      is essential for the cradle architecture that enables chaperone function.
    supported_by:
    - reference_id: PMID:21317898
      supporting_text: The crystal structure shows that Spy molecules associate into
        tightly bound dimers
    - reference_id: PMID:21317898
      supporting_text: The contacts between the two monomers are extensive, burying
        a surface of ∞1850 Å2 per monomer upon dimerization and suggesting high dimeric
        stability
references:
- id: GO_REF:0000033
  title: Annotation inferences using phylogenetic trees
  findings: []
- id: GO_REF:0000120
  title: Combined Automated Annotation using Multiple IEA Methods
  findings: []
- id: PMID:9068658
  title: A new periplasmic protein of Escherichia coli which is synthesized in spheroplasts
    but not in intact cells.
  findings: []
- id: PMID:20799348
  title: The crystal structure Escherichia coli Spy.
  findings: []
- id: PMID:21317898
  title: Genetic selection designed to stabilize proteins uncovers a chaperone called
    Spy.
  findings: []
- id: PMID:24497545
  title: Super Spy variants implicate flexibility in chaperone action.
  findings: []
- id: PMID:26619265
  title: Substrate protein folds while it is bound to the ATP-independent chaperone
    Spy.
  findings: []
- id: PMID:27239796
  title: Visualizing chaperone-assisted protein folding.
  findings: []
core_functions:
- molecular_function:
    id: GO:0044183
    label: protein folding chaperone
  description: Spy is an ATP-independent periplasmic chaperone that suppresses protein
    aggregation and aids protein refolding (PMID:21317898). Remarkably, substrate
    Im7 folds completely while remaining bound to Spy's cradle-shaped surface (PMID:26619265).
    Global kinetic fitting demonstrated that the only consistent model requires folding
    while bound. Structural ensembles captured substrates in unfolded, intermediate,
    and native-like conformations on Spy (PMID:27239796). Spy is primarily a holdase
    (preventing aggregation in situ without ATP), but also has foldase-like activity
    as substrates can fold while bound. The ideal MF annotation would be the proposed
    holdase chaperone activity NTR in addition to GO:0044183. GO:0140309 (carrier-holdase)
    does NOT fit because Spy acts in situ in the periplasm, not as an inter-compartment
    carrier.
  directly_involved_in:
  - id: GO:0006457
    label: protein folding
  locations:
  - id: GO:0030288
    label: outer membrane-bounded periplasmic space
  supported_by:
  - reference_id: PMID:21317898
    supporting_text: In vitro studies demonstrate that the Spy protein is an effective
      ATP-independent chaperone that suppresses protein aggregation and aids protein
      refolding.
  - reference_id: PMID:26619265
    supporting_text: Spy then allows Im7 to fully fold into its native state while
      it remains bound to the surface of the chaperone.
  - reference_id: PMID:27239796
    supporting_text: The ensemble shows that Spy-associated Im7 samples conformations
      ranging from unfolded to partially folded to native-like states and reveals
      how a substrate can explore its folding landscape while being bound to a chaperone.