BioReason Chat Export

Exported on March 22, 2026 at 02:54 AM

Organism: Escherichia coli

Sequence:

MRKLTALFVASTLALGAANLAHAADTTTAAPADAKPMMHHKGKFGPHQDMMFKDLNLTDAQKQQIREIMKGQRDQMKRPPLEERRAMHDIIASDTFDKVKAEAQIAKMEEQRKANMLAHMETQNKIYNILTPEQKKQFNANFEKRLTERPAAKGKMPATAE

Thinking Trace

I begin with the domain architecture. The polypeptide is fully encompassed by IPR052211 (Cpx two-component system auxiliary protein family, residues 1–161), establishing that the entire sequence is dedicated to supporting a membrane-proximal stress-signaling pathway rather than catalysis. Nested within this, residues 6–148 carry IPR012899 (LTXXQ motif family protein), a conserved structural motif class frequently associated with periplasmic or membrane-associated adaptors that stabilize stress-signaling assemblies. The absence of enzymatic signatures and the dominance of an auxiliary-system family signature together argue that this protein functions through binding and assembly rather than chemistry, steering me toward a binding-centric molecular role.

From this architecture, the molecular function resolves as protein binding (GO:0005515). Auxiliary modules in two-component systems typically tune signal flow by forming transient complexes with the cognate histidine kinase and downstream effectors. The LTXXQ motif family further supports a scaffold/adaptor role that organizes periplasmic or membrane-proximal assemblies. This binding-centric architecture causes regulatory control over pathway activity rather than direct substrate turnover.

Translating binding into process, auxiliary components in envelope-stress pathways modulate signal transduction cascades that govern proteostasis and stress adaptation. The Cpx system in particular monitors envelope and periplasmic stress; an auxiliary factor that stabilizes or targets the pathway naturally participates in signal relay and attenuation. Thus, the most parsimonious biological process is signal transduction (GO:0007165), where this protein shapes pathway throughput and timing rather than executing terminal reactions.

Cellular location follows from the system context and motif class. Cpx signaling operates at the envelope, and LTXXQ-bearing families are often peripherally associated with or resident in membrane-proximal compartments. In Escherichia coli, this places the protein at the cell envelope where sensory and adaptor modules concentrate. Therefore, I infer residence at the cell envelope (GO:0042657), consistent with an auxiliary assembly factor that needs to dock near membrane-embedded kinases and periplasmic substrates.

Mechanistically, I hypothesize that the LTXXQ-bearing core forms a stable adaptor that recruits or stabilizes the membrane-associated histidine kinase and its periplasmic partners, thereby biasing the pathway toward efficient envelope-stress surveillance. By binding the kinase and periplasmic targets, the protein likely enhances signal fidelity and spatial targeting. Expected partners include the cognate membrane histidine kinase and envelope-stress effectors; together they form a membrane-proximal signaling hub that routes information from the cell envelope to downstream transcriptional responses.

Functional Summary

An auxiliary component of a membrane-proximal stress-signaling pathway in Escherichia coli that operates at the cell envelope. It lacks catalytic motifs and instead functions through binding and assembly, stabilizing and tuning a two-component signaling module that monitors envelope and periplasmic stress. By organizing transient complexes near the membrane, it enhances signal relay and targeting within the stress-response network.

UniProt Summary

Auxiliary component of the Cpx stress protein system.

InterPro Domains

• Cpx two-component system auxiliary protein (IPR052211, family) — residues 1-161
• LTXXQ motif family protein (IPR012899, family) — residues 6-148

GO Terms

Molecular Function: molecular_function (GO:0003674), protein folding chaperone (GO:0044183), binding (GO:0005488), protein binding (GO:0005515), unfolded protein binding (GO:0051082)

Biological Process: biological_process (GO:0008150), response to stimulus (GO:0050896), cellular process (GO:0009987), cellular response to stimulus (GO:0051716), response to abiotic stimulus (GO:0009628), response to stress (GO:0006950), response to chemical (GO:0042221), response to hypoxia (GO:0001666), cellular response to chemical stimulus (GO:0070887), cellular response to stress (GO:0033554), response to oxygen levels (GO:0070482), cellular response to hypoxia (GO:0071456), cellular response to oxygen levels (GO:0071453), response to decreased oxygen levels (GO:0036293), cellular response to decreased oxygen levels (GO:0036294)

Cellular Component: cellular_component (GO:0005575), cellular anatomical entity (GO:0110165), intracellular anatomical structure (GO:0005622), organelle (GO:0043226), membrane (GO:0016020), envelope (GO:0031975), cytoplasm (GO:0005737), membrane-enclosed lumen (GO:0031974), organelle membrane (GO:0031090), organelle envelope (GO:0031967), intracellular organelle (GO:0043229), outer membrane (GO:0019867), plastid (GO:0009536), non-membrane-bounded organelle (GO:0043228), vacuole (GO:0005773), mitochondrion (GO:0005739), organelle lumen (GO:0043233), membrane-bounded organelle (GO:0043227), mitochondrial envelope (GO:0005740), intracellular membrane-bounded organelle (GO:0043231), bounding membrane of organelle (GO:0098588), intracellular non-membrane-bounded organelle (GO:0043232), plastid envelope (GO:0009526), plastid membrane (GO:0042170), organelle outer membrane (GO:0031968), intracellular organelle lumen (GO:0070013), mitochondrial membrane (GO:0031966), mitochondrial outer membrane (GO:0005741), ribosome (GO:0005840)

Generated by BioReason

BioReason Chat Export

Exported on March 22, 2026 at 02:54 AM

Organism: Escherichia coli

Sequence:

MRKLTALFVASTLALGAANLAHAADTTTAAPADAKPMMHHKGKFGPHQDMMFKDLNLTDAQKQQIREIMKGQRDQMKRPPLEERRAMHDIIASDTFDKVKAEAQIAKMEEQRKANMLAHMETQNKIYNILTPEQKKQFNANFEKRLTERPAAKGKMPATAE

Thinking Trace

I begin with the domain architecture. The polypeptide is fully encompassed by IPR052211 (Cpx two-component system auxiliary protein family, residues 1–161), establishing that the entire sequence is dedicated to supporting a membrane-proximal stress-signaling pathway rather than catalysis. Nested within this, residues 6–148 carry IPR012899 (LTXXQ motif family protein), a conserved structural motif class frequently associated with periplasmic or membrane-associated adaptors that stabilize stress-signaling assemblies. The absence of enzymatic signatures and the dominance of an auxiliary-system family signature together argue that this protein functions through binding and assembly rather than chemistry, steering me toward a binding-centric molecular role.

From this architecture, the molecular function resolves as protein binding (GO:0005515). Auxiliary modules in two-component systems typically tune signal flow by forming transient complexes with the cognate histidine kinase and downstream effectors. The LTXXQ motif family further supports a scaffold/adaptor role that organizes periplasmic or membrane-proximal assemblies. This binding-centric architecture causes regulatory control over pathway activity rather than direct substrate turnover.

Translating binding into process, auxiliary components in envelope-stress pathways modulate signal transduction cascades that govern proteostasis and stress adaptation. The Cpx system in particular monitors envelope and periplasmic stress; an auxiliary factor that stabilizes or targets the pathway naturally participates in signal relay and attenuation. Thus, the most parsimonious biological process is signal transduction (GO:0007165), where this protein shapes pathway throughput and timing rather than executing terminal reactions.

Cellular location follows from the system context and motif class. Cpx signaling operates at the envelope, and LTXXQ-bearing families are often peripherally associated with or resident in membrane-proximal compartments. In Escherichia coli, this places the protein at the cell envelope where sensory and adaptor modules concentrate. Therefore, I infer residence at the cell envelope (GO:0042657), consistent with an auxiliary assembly factor that needs to dock near membrane-embedded kinases and periplasmic substrates.

Mechanistically, I hypothesize that the LTXXQ-bearing core forms a stable adaptor that recruits or stabilizes the membrane-associated histidine kinase and its periplasmic partners, thereby biasing the pathway toward efficient envelope-stress surveillance. By binding the kinase and periplasmic targets, the protein likely enhances signal fidelity and spatial targeting. Expected partners include the cognate membrane histidine kinase and envelope-stress effectors; together they form a membrane-proximal signaling hub that routes information from the cell envelope to downstream transcriptional responses.

Functional Summary

An auxiliary component of a membrane-proximal stress-signaling pathway in Escherichia coli that operates at the cell envelope. It lacks catalytic motifs and instead functions through binding and assembly, stabilizing and tuning a two-component signaling module that monitors envelope and periplasmic stress. By organizing transient complexes near the membrane, it enhances signal relay and targeting within the stress-response network.

UniProt Summary

Auxiliary component of the Cpx stress protein system.

InterPro Domains

• Cpx two-component system auxiliary protein (IPR052211, family) — residues 1-161
• LTXXQ motif family protein (IPR012899, family) — residues 6-148

GO Terms

Molecular Function: molecular_function (GO:0003674), protein folding chaperone (GO:0044183), binding (GO:0005488), protein binding (GO:0005515), unfolded protein binding (GO:0051082)

Biological Process: biological_process (GO:0008150), response to stimulus (GO:0050896), cellular process (GO:0009987), cellular response to stimulus (GO:0051716), response to abiotic stimulus (GO:0009628), response to stress (GO:0006950), response to chemical (GO:0042221), response to hypoxia (GO:0001666), cellular response to chemical stimulus (GO:0070887), cellular response to stress (GO:0033554), response to oxygen levels (GO:0070482), cellular response to hypoxia (GO:0071456), cellular response to oxygen levels (GO:0071453), response to decreased oxygen levels (GO:0036293), cellular response to decreased oxygen levels (GO:0036294)

Cellular Component: cellular_component (GO:0005575), cellular anatomical entity (GO:0110165), intracellular anatomical structure (GO:0005622), organelle (GO:0043226), membrane (GO:0016020), envelope (GO:0031975), cytoplasm (GO:0005737), membrane-enclosed lumen (GO:0031974), organelle membrane (GO:0031090), organelle envelope (GO:0031967), intracellular organelle (GO:0043229), outer membrane (GO:0019867), plastid (GO:0009536), non-membrane-bounded organelle (GO:0043228), vacuole (GO:0005773), mitochondrion (GO:0005739), organelle lumen (GO:0043233), membrane-bounded organelle (GO:0043227), mitochondrial envelope (GO:0005740), intracellular membrane-bounded organelle (GO:0043231), bounding membrane of organelle (GO:0098588), intracellular non-membrane-bounded organelle (GO:0043232), plastid envelope (GO:0009526), plastid membrane (GO:0042170), organelle outer membrane (GO:0031968), intracellular organelle lumen (GO:0070013), mitochondrial membrane (GO:0031966), mitochondrial outer membrane (GO:0005741), ribosome (GO:0005840)

Generated by BioReason

provider: falcon
model: Edison Scientific Literature
cached: false
start_time: '2026-03-22T17:57:47.954714'
end_time: '2026-03-22T18:10:05.827610'
duration_seconds: 737.87
template_file: templates/gene_research_go_focused.md
template_variables:
organism: ECOLI
gene_id: Spy
gene_symbol: spy
uniprot_accession: P77754
protein_description: 'RecName: Full=Periplasmic chaperone Spy {ECO:0000303|PubMed:21317898};
AltName: Full=Spheroplast protein Y {ECO:0000303|PubMed:9068658}; Flags: Precursor;'
gene_info: Name=spy {ECO:0000303|PubMed:9068658}; OrderedLocusNames=b1743, JW1732;
organism_full: Escherichia coli (strain K12).
protein_family: Belongs to the CpxP/Spy family. .
protein_domains: Cpx_auxiliary_protein. (IPR052211); LTXXQ. (IPR012899); LTXXQ (PF07813)
provider_config:
timeout: 600
max_retries: 3
parameters:
allowed_domains: []
temperature: 0.1
citation_count: 36

Question

Gene Research for Functional Annotation

⚠️ CRITICAL: Gene/Protein Identification Context

BEFORE YOU BEGIN RESEARCH: You MUST verify you are researching the CORRECT gene/protein. Gene symbols can be ambiguous, especially for less well-characterized genes from non-model organisms.

Target Gene/Protein Identity (from UniProt):

• UniProt Accession: P77754
• Protein Description: RecName: Full=Periplasmic chaperone Spy {ECO:0000303|PubMed:21317898}; AltName: Full=Spheroplast protein Y {ECO:0000303|PubMed:9068658}; Flags: Precursor;
• Gene Information: Name=spy {ECO:0000303|PubMed:9068658}; OrderedLocusNames=b1743, JW1732;
• Organism (full): Escherichia coli (strain K12).
• Protein Family: Belongs to the CpxP/Spy family. .
• Key Domains: Cpx_auxiliary_protein. (IPR052211); LTXXQ. (IPR012899); LTXXQ (PF07813)

MANDATORY VERIFICATION STEPS:

1. Check if the gene symbol "spy" matches the protein description above
2. Verify the organism is correct: Escherichia coli (strain K12).
3. Check if protein family/domains align with what you find in literature
4. If you find literature for a DIFFERENT gene with the same or similar symbol, STOP

If Gene Symbol is Ambiguous or You Cannot Find Relevant Literature:

DO NOT PROCEED WITH RESEARCH ON A DIFFERENT GENE. Instead:
- State clearly: "The gene symbol 'spy' is ambiguous or literature is limited for this specific protein"
- Explain what you found (e.g., "Found extensive literature on a different gene with the same symbol in a different organism")
- Describe the protein based ONLY on the UniProt information provided above
- Suggest that the protein function can be inferred from domain/family information

Research Target:

Please provide a comprehensive research report on the gene spy (gene ID: Spy, UniProt: P77754) in ECOLI.

The research report should be a detailed narrative explaining the function, biological processes, and localization of the gene product. Citations should be given for all claims.

You should prioritize authoritative reviews and primary scientific literature when conducting research. You can supplement
this with annotations you find in gene/protein databases, but these can be outdated or inaccurate.

We are specifically interested in the primary function of the gene - for enzymes, what reaction is catalyzed, and what is the substrate specificity? For transporters, what is the substrate? For structural proteins or adapters, what is the broader structural role? For signaling molecules, what is the role in the pathway.

We are interested in where in or outside the cell the gene product carries out its function.

We are also interested in the signaling or biochemical pathways in which the gene functions. We are less interested in broad pleiotropic effects, except where these elucidate the precise role.

Include evidence where possible. We are interested in both experimental evidence as well as inference from structure, evolution, or bioinformatic analysis. Precise studies should be prioritized over high-throughput, where available.

Output

Question: You are an expert researcher providing comprehensive, well-cited information.

Provide detailed information focusing on:
1. Key concepts and definitions with current understanding
2. Recent developments and latest research (prioritize 2023-2024 sources)
3. Current applications and real-world implementations
4. Expert opinions and analysis from authoritative sources
5. Relevant statistics and data from recent studies

Format as a comprehensive research report with proper citations. Include URLs and publication dates where available.
Always prioritize recent, authoritative sources and provide specific citations for all major claims.

Gene Research for Functional Annotation

⚠️ CRITICAL: Gene/Protein Identification Context

BEFORE YOU BEGIN RESEARCH: You MUST verify you are researching the CORRECT gene/protein. Gene symbols can be ambiguous, especially for less well-characterized genes from non-model organisms.

Target Gene/Protein Identity (from UniProt):

• UniProt Accession: P77754
• Protein Description: RecName: Full=Periplasmic chaperone Spy {ECO:0000303|PubMed:21317898}; AltName: Full=Spheroplast protein Y {ECO:0000303|PubMed:9068658}; Flags: Precursor;
• Gene Information: Name=spy {ECO:0000303|PubMed:9068658}; OrderedLocusNames=b1743, JW1732;
• Organism (full): Escherichia coli (strain K12).
• Protein Family: Belongs to the CpxP/Spy family. .
• Key Domains: Cpx_auxiliary_protein. (IPR052211); LTXXQ. (IPR012899); LTXXQ (PF07813)

MANDATORY VERIFICATION STEPS:

1. Check if the gene symbol "spy" matches the protein description above
2. Verify the organism is correct: Escherichia coli (strain K12).
3. Check if protein family/domains align with what you find in literature
4. If you find literature for a DIFFERENT gene with the same or similar symbol, STOP

If Gene Symbol is Ambiguous or You Cannot Find Relevant Literature:

DO NOT PROCEED WITH RESEARCH ON A DIFFERENT GENE. Instead:
- State clearly: "The gene symbol 'spy' is ambiguous or literature is limited for this specific protein"
- Explain what you found (e.g., "Found extensive literature on a different gene with the same symbol in a different organism")
- Describe the protein based ONLY on the UniProt information provided above
- Suggest that the protein function can be inferred from domain/family information

Research Target:

Please provide a comprehensive research report on the gene spy (gene ID: Spy, UniProt: P77754) in ECOLI.

The research report should be a detailed narrative explaining the function, biological processes, and localization of the gene product. Citations should be given for all claims.

You should prioritize authoritative reviews and primary scientific literature when conducting research. You can supplement
this with annotations you find in gene/protein databases, but these can be outdated or inaccurate.

We are specifically interested in the primary function of the gene - for enzymes, what reaction is catalyzed, and what is the substrate specificity? For transporters, what is the substrate? For structural proteins or adapters, what is the broader structural role? For signaling molecules, what is the role in the pathway.

We are interested in where in or outside the cell the gene product carries out its function.

We are also interested in the signaling or biochemical pathways in which the gene functions. We are less interested in broad pleiotropic effects, except where these elucidate the precise role.

Include evidence where possible. We are interested in both experimental evidence as well as inference from structure, evolution, or bioinformatic analysis. Precise studies should be prioritized over high-throughput, where available.

Research Report: Escherichia coli K-12 spy (UniProt P77754) — Periplasmic chaperone Spy (Spheroplast protein Y)

Executive summary

The E. coli K-12 gene spy encodes Spy, a secreted/periplasmic, ATP-independent molecular chaperone (also called spheroplast protein Y) that is strongly induced by envelope stress and protects periplasmic proteostasis by suppressing protein aggregation and aiding refolding. Spy forms an elongated, cradle-shaped dimer with a strongly basic concave surface and conserved LTxxQ motifs, which together support binding of unfolded/negatively charged client proteins. Spy transcription is controlled primarily by the envelope-stress two-component systems BaeSR and CpxAR, with stressor-specific dominance (e.g., BaeSR for ethanol and chlorite; CpxAR for copper). Recent 2024 studies extend Spy biology to reactive chlorine stress (chlorite-specific induction and redox control of Spy methionines) and implicate spy in recovery from toxin-induced dormancy and aggregation; Spy (SPY) expression is also used as a marker of spheroplast-associated physiology in antimicrobial studies. (kwon2010thecrystalstructure pages 1-2, ruan2020conversionofthe pages 16-29, loiseau2024maintainingthemethionine pages 1-5, leinberger2024proteinaggregationis pages 1-2)

0) Mandatory gene/protein identity verification (avoid symbol ambiguity)

Target identity (matches UniProt P77754 context):
- Spy is explicitly described in the primary structural paper as Escherichia coli Spy (EcSpy) = spheroplast protein Y, and as a small periplasmic protein (precursor with signal peptide; mature region studied begins after signal peptide). (kwon2010thecrystalstructure pages 1-2)
- Spy’s mature construct used for structural work corresponds to residues 24–161 (with an internal ordered core), consistent with an N-terminal signal peptide being removed in the periplasm. (kwon2010thecrystalstructure pages 1-2)
- Spy belongs to a conserved family related to CpxP and contains LTxxQ motifs; the structure shows a conserved antiparallel dimeric fold that has been repeatedly used as the reference for E. coli Spy. (kwon2010thecrystalstructure pages 5-7, quan2011geneticselectiondesigned pages 9-11)

Conclusion: The retrieved literature is about the E. coli envelope-stress-induced periplasmic chaperone Spy/spheroplast protein Y, consistent with UniProt P77754 and the CpxP/Spy family. (kwon2010thecrystalstructure pages 1-2, kwon2010thecrystalstructure pages 5-7)

1) Key concepts and definitions (current understanding)

1.1 Periplasmic proteostasis and ATP-independent chaperones

The periplasm lacks ATP, so many periplasmic chaperones function as ATP-independent holdases or folding assistants. Spy is an experimentally validated example: it suppresses aggregation and supports refolding in vitro in buffers without ATP supplementation and functions in vivo as a periplasmic stress chaperone. (quan2011geneticselectiondesigned pages 19-22, ruan2020conversionofthe pages 16-29)

1.2 What Spy is (functional definition)

Spy is best defined as a stress-induced periplasmic chaperone that binds unfolded or unstable proteins, suppresses aggregation, and can promote refolding without ATP. This definition is supported by (i) its genetic discovery as a protein whose massive induction stabilizes an unstable periplasmic client, and (ii) direct in vitro anti-aggregation assays. (quan2011geneticselectiondesigned pages 1-5, ruan2020conversionofthe pages 16-29)

1.3 Relationship to envelope stress signaling (BaeSR/CpxAR)

Spy expression is controlled by envelope-stress sensing two-component systems BaeSR and CpxAR. Each can activate spy transcription via specific promoter binding regions/motifs, and the dominant regulator depends on the stressor (e.g., ethanol and chlorite strongly implicate BaeSR). (yamamoto2008involvementofmultiple pages 1-2, srivastava2014geneticregulationof pages 5-7, loiseau2024maintainingthemethionine pages 1-5)

2) Protein properties, localization, and structure

2.1 Subcellular localization

Spy is a periplasmic protein. Structural and functional studies note that Spy is synthesized with a signal sequence and is localized to/assayed from periplasmic extracts; structural constructs often omit the signal peptide for recombinant expression. (kwon2010thecrystalstructure pages 1-2, quan2011geneticselectiondesigned pages 16-19)

2.2 Oligomeric state and overall architecture

Spy behaves as an elongated dimer in solution (SEC and analytical ultracentrifugation), with an apparent MW of ~45 kDa over 0.1–50 μM monomer concentration, larger than expected for a compact dimer—consistent with an extended shape. (quan2011geneticselectiondesigned pages 9-11)

2.3 Crystal structure and key structural determinants

Kwon et al. solved the crystal structure of EcSpy (Protein Science; published Nov 2010) showing:
- Spy is a four-α-helix monomer forming a long kinked hairpin-like fold.
- Two monomers assemble into an antiparallel dimer forming a curved/concave “oval” cradle. (kwon2010thecrystalstructure pages 1-2)
- The concave surface is highly positively charged, proposed as a ligand/client interaction face; the protein is basic (pI ~9.45) with 25 basic vs 20 acidic residues in 137 aa. (kwon2010thecrystalstructure pages 2-5)
- Conserved LTxxQ motifs (shared with CpxP) help stabilize the fold. (kwon2010thecrystalstructure pages 5-7)

Crystallographic statistics (Table I):
- Native diffraction to 2.7 Å, MAD data to 3.0 Å; Rwork/Rfree 0.252/0.300. (kwon2010thecrystalstructure pages 1-2, kwon2010thecrystalstructure media 501f4ace)
- Structure deposited as PDB 3OEO. (kwon2010thecrystalstructure pages 5-7, kwon2010thecrystalstructure pages 7-8)

Visual evidence: Kwon et al. Figure 2 shows the Spy dimer and its electrostatic surface, including the strongly basic concave region. (kwon2010thecrystalstructure media 159283c6)

3) Biological function: mechanistic and experimental evidence

3.1 Discovery as an in vivo periplasmic stabilizer

Spy was discovered by a genetic selection linking protein stability to antibiotic resistance: when bacteria were forced to fold a very unstable periplasmic protein, they “massively overproduced” Spy, and Spy overproduction increased steady-state levels of unstable mutants by up to 700-fold. (quan2011geneticselectiondesigned pages 1-5)

3.2 Anti-aggregation and refolding in vitro (client scope)

Spy suppresses aggregation and can support refolding across diverse substrates. Quan et al. describe aggregation/refolding assays using enzymes including malate dehydrogenase (MDH), aldolase, GAPDH, LDH, and alkaline phosphatase, monitoring aggregation via light scattering and refolding via enzymatic recovery, with Spy titrated in ATP-free assay buffers. (quan2011geneticselectiondesigned pages 19-22)

A direct quantitative anti-aggregation result is provided by Ruan et al. (Journal of Biotechnology; published Jan 2020):
- Using reduced α-lactalbumin, wild-type Spy decreased aggregation by >80% at 120 min at a 1:2.5 Spy:α-LA molar ratio, whereas an engineered covalent Spy dimer reduced aggregation by ~50% under the same conditions. (ruan2020conversionofthe pages 16-29)

3.3 Physiological role: protecting periplasmic proteins under stress

Spy protects periplasmic enzyme function during chemical stress: under tannic acid treatment, wild-type cells retained ~100% alkaline phosphatase activity, whereas a Δspy strain showed decreased activity—supporting Spy’s functional role in maintaining periplasmic protein function under envelope stress. (quan2011geneticselectiondesigned pages 1-5)

3.4 Redox sensitivity and methionine-dependent activity (2024 development)

A 2024 preprint (bioRxiv; posted Dec 2024) reports that chlorite stress induces an oxidized form of Spy (Spyox) and that oxidation is reversible and controlled by the periplasmic methionine sulfoxide reductase MsrP. Spy’s methionine residues are highlighted as functional hotspots (e.g., core Met69/Met87/Met108), and methionine oxidation/state is implicated as crucial for chaperone function under reactive chlorine stress. (loiseau2024maintainingthemethionine pages 19-22)

4) Regulation and pathway context

4.1 Core regulators: BaeSR and CpxAR

Multiple studies support two-component regulation of spy:
- CpxAR activates spy as part of the Cpx regulon and is linked to envelope stresses (including copper). BaeSR regulates spy under zinc and other stresses, with promoter binding sites mapped by DNase I footprinting. (yamamoto2008involvementofmultiple pages 1-2)
- Reporter dissection (Gene; published Sep 2014) indicates spy promoter contains two BaeR and one CpxR motifs, and supports BaeR as the primary regulator for ethanol induction; CpxR contributes for copper induction. (srivastava2014geneticregulationof pages 1-2, srivastava2014geneticregulationof pages 5-7)

4.2 Inducing stressors (experimentally supported examples)

Spy is induced by multiple envelope/protein-unfolding stresses including ethanol, butanol, tannins, and metal stresses (Cu, Zn), among others. (quan2011geneticselectiondesigned pages 1-5, srivastava2014geneticregulationof pages 1-2, yamamoto2008involvementofmultiple pages 1-2)

A strong mechanistic link between Bae activation and Spy induction comes from the discovery study: independent resistant strains commonly carried baeS mutations; one allele (baeS R416C) was necessary and sufficient to drive very strong spy induction. (quan2011geneticselectiondesigned pages 28-32)

4.3 Quantitative induction magnitudes

• In selected envelope-stress backgrounds, spy induction reached 279-fold (EMS4/WT) and 253-fold (baeS R416C/WT). (quan2011geneticselectiondesigned pages 28-32)
• Under strong induction/overexpression conditions, Spy can comprise ~40–48% of total periplasmic protein in periplasmic fractions. (quan2011geneticselectiondesigned pages 28-32)
• Under chlorite stress (2024), Spy was the top overproduced protein by proteomics (15.3-fold) and showed ~30-fold induction by a spy-lacZ transcriptional fusion; BaeSR was required for this chlorite response. (loiseau2024maintainingthemethionine pages 1-5)

5) Recent developments (prioritized 2023–2024)

5.1 Reactive chlorine/chlorite stress and Spy redox cycling (2024)

Loiseau et al. (bioRxiv; Dec 2024) extends Spy biology to reactive chlorine stress by showing:
- Chlorite-specific induction across multiple tested oxidants.
- Spy oxidation (Spyox) and reversal via MsrP, linking Spy’s chaperone function to periplasmic redox maintenance. (loiseau2024maintainingthemethionine pages 19-22)

5.2 Spy in dormancy/aggregation and recovery programs (2024)

Leinberger et al. (mSystems; published Nov 2024) found by RNA-seq that chaperone genes including spy were implicated in recovery from TisB-induced dormancy, and interpret chaperone involvement as evidence that TisB causes protein aggregation (validated by an in vivo aggregation reporter). (leinberger2024proteinaggregationis pages 1-2)

5.3 Spy (SPY) as a marker in antimicrobial physiology (2024)

Kaur et al. (Scientific Reports; published Feb 2024) report that imipenem-containing antibiotic combinations against pan-drug resistant Klebsiella pneumoniae drove upregulation of SPY (spheroplast protein Y) alongside PBPs, in a context where imipenem promoted formation of metabolically active spheroplasts and suppressed filamentous persisters; this study reports imipenem permeability 17,200 nm/s, 207-fold higher than aztreonam. (kaur2024nextgenerationantibiotic pages 1-2)

6) Current applications and real-world implementations

6.1 Spy as a protein-expression/folding tool (biotechnology)

Spy has been repurposed as a fusion/solubility tag to enhance recombinant protein expression. In the 2020 study, a cytoplasmic signal-peptide–deleted Spy (Δss-Spy) and N-terminal Spy fusions increased steady-state levels of destabilized Im7 variants by 1.2- to 31-fold, and enhanced soluble expression of several model proteins; tandem Spy–Spy fusions were engineered for larger targets. (ruan2020conversionofthe pages 8-11, ruan2020conversionofthe pages 16-29)

6.2 Spy promoter reporters as envelope-stress biosensors

Although many biosensor papers are outside E. coli K-12, the foundational concept is directly supported in E. coli: spy is strongly and specifically inducible by envelope stress regulators BaeSR/CpxAR and by defined stressors; thus spy promoter fusions (e.g., spy::GFP; spy-lacZ) are practical envelope stress readouts. (srivastava2014geneticregulationof pages 5-7, loiseau2024maintainingthemethionine pages 1-5)

7) Expert opinions and analysis (synthesis grounded in authoritative sources)

7.1 Mechanistic model (evidence-based)

Structural and biochemical data support a model in which Spy’s extended, concave, positively charged cradle-shaped dimer binds unfolded/negatively charged polypeptides, preventing aggregation and enabling productive folding/refolding. The large dimeric interface (>1400 Ų buried) and strongly basic concave surface are consistent with stable cradle formation and client interaction via electrostatics. (kwon2010thecrystalstructure pages 2-5, kwon2010thecrystalstructure media 159283c6)

7.2 Regulatory logic (envelope stress integration)

spy is best interpreted as part of an extracytoplasmic protein quality control module that is deployed when envelope perturbations increase the burden of misfolded periplasmic and envelope proteins. The exceptionally large induction levels driven by BaeS mutations (hundreds-fold) and the chlorite-specific BaeR dependence argue that spy is positioned as a “high-gain” effector in stress response. (quan2011geneticselectiondesigned pages 28-32, loiseau2024maintainingthemethionine pages 1-5)

8) Key statistics and data summary

The following table consolidates quantitative findings across core and recent studies.

Table: This table compiles the main quantitative findings for the E. coli periplasmic chaperone Spy, including its structural parameters, induction under envelope stress, and functional effects on client protein stabilization and anti-aggregation. It is useful as a compact evidence summary linking Spy’s regulation, mechanism, and experimental phenotypes.

9) Notes on limitations and evidence gaps

• Several mechanistic Spy papers cited in later reviews (e.g., post-2016 kinetic/mechanistic studies of folding-while-bound) were not directly retrievable in the current tool session, so detailed kinetic rate constants and binding affinities are not included here; the report therefore emphasizes experimentally documented qualitative mechanisms and the quantitative values accessible in the retrieved sources. (huang2025catalyzingproteinfolding pages 12-13)

Reference URLs (with publication/posting dates where available)

• Kwon E. et al. 2010-11. Protein Science. “The crystal structure Escherichia coli Spy.” https://doi.org/10.1002/pro.489 (kwon2010thecrystalstructure pages 1-2)
• Quan S. et al. 2011-02. Nat Struct Mol Biol. “Genetic selection designed to stabilize proteins uncovers a chaperone called Spy.” https://doi.org/10.1038/nsmb.2016 (quan2011geneticselectiondesigned pages 1-5)
• Yamamoto K. et al. 2008-01. J Biotechnol. “Involvement of multiple transcription factors for metal-induced spy gene expression in E. coli.” https://doi.org/10.1016/j.jbiotec.2007.08.002 (yamamoto2008involvementofmultiple pages 1-2)
• Srivastava S.K. et al. 2014-09. Gene. “Genetic regulation of spy gene expression in E. coli in the presence of protein unfolding agent ethanol.” https://doi.org/10.1016/j.gene.2014.07.003 (srivastava2014geneticregulationof pages 1-2)
• Ruan A. et al. 2020-01. Journal of Biotechnology. “Conversion of the molecular chaperone Spy into a novel fusion tag to enhance recombinant protein expression.” https://doi.org/10.1016/j.jbiotec.2019.11.006 (ruan2020conversionofthe pages 16-29)
• Kaur J.N. et al. 2024-02. Scientific Reports. “Next generation antibiotic combinations to combat pan-drug resistant Klebsiella pneumoniae.” https://doi.org/10.1038/s41598-024-53130-z (kaur2024nextgenerationantibiotic pages 1-2)
• Leinberger F.H. et al. 2024-11. mSystems. “Protein aggregation is a consequence of the dormancy-inducing membrane toxin TisB in E. coli.” https://doi.org/10.1128/msystems.01060-24 (leinberger2024proteinaggregationis pages 1-2)
• Loiseau L. et al. 2024-12-12 (posted). bioRxiv. “Maintaining the methionine residues of the chaperone Spy in a reduced state is crucial for periplasmic proteostasis.” https://doi.org/10.1101/2024.12.12.628106 (loiseau2024maintainingthemethionine pages 1-5)

References

1. (kwon2010thecrystalstructure pages 1-2): Eunju Kwon, Dong Young Kim, Carol A. Gross, John D. Gross, and Kyeong Kyu Kim. The crystal structure escherichia coli spy. Protein Science, 19:2252-2259, Nov 2010. URL: https://doi.org/10.1002/pro.489, doi:10.1002/pro.489. This article has 53 citations and is from a peer-reviewed journal.

2. (ruan2020conversionofthe pages 16-29): Alessandro Ruan, Chang Ren, and Shu Quan. Conversion of the molecular chaperone spy into a novel fusion tag to enhance recombinant protein expression. Jan 2020. URL: https://doi.org/10.1016/j.jbiotec.2019.11.006, doi:10.1016/j.jbiotec.2019.11.006. This article has 23 citations and is from a peer-reviewed journal.

3. (loiseau2024maintainingthemethionine pages 1-5): Laurent Loiseau, Nathan De Visch, Alexandra Vergnes, Jean Armengaud, Maxence S. Vincent, and Benjamin Ezraty. Maintaining the methionine residues of the chaperone spy in a reduced state is crucial for periplasmic proteostasis. bioRxiv, Dec 2024. URL: https://doi.org/10.1101/2024.12.12.628106, doi:10.1101/2024.12.12.628106. This article has 0 citations.

4. (leinberger2024proteinaggregationis pages 1-2): Florian H. Leinberger, Liam Cassidy, Daniel Edelmann, Nicole E. Schmid, Markus Oberpaul, Patrick Blumenkamp, Sebastian Schmidt, Ana Natriashvili, Maximilian H. Ulbrich, Andreas Tholey, Hans-Georg Koch, and Bork A. Berghoff. Protein aggregation is a consequence of the dormancy-inducing membrane toxin tisb in escherichia coli. Nov 2024. URL: https://doi.org/10.1128/msystems.01060-24, doi:10.1128/msystems.01060-24. This article has 9 citations and is from a peer-reviewed journal.

5. (kwon2010thecrystalstructure pages 5-7): Eunju Kwon, Dong Young Kim, Carol A. Gross, John D. Gross, and Kyeong Kyu Kim. The crystal structure escherichia coli spy. Protein Science, 19:2252-2259, Nov 2010. URL: https://doi.org/10.1002/pro.489, doi:10.1002/pro.489. This article has 53 citations and is from a peer-reviewed journal.

6. (quan2011geneticselectiondesigned pages 9-11): Shu Quan, Philipp Koldewey, Tim Tapley, Nadine Kirsch, Karen M Ruane, Jennifer Pfizenmaier, Rong Shi, Stephan Hofmann, Linda Foit, Guoping Ren, Ursula Jakob, Zhaohui Xu, Miroslaw Cygler, and James C A Bardwell. Genetic selection designed to stabilize proteins uncovers a chaperone called spy. Nature Structural & Molecular Biology, 18:262-269, Feb 2011. URL: https://doi.org/10.1038/nsmb.2016, doi:10.1038/nsmb.2016. This article has 223 citations and is from a highest quality peer-reviewed journal.

7. (quan2011geneticselectiondesigned pages 19-22): Shu Quan, Philipp Koldewey, Tim Tapley, Nadine Kirsch, Karen M Ruane, Jennifer Pfizenmaier, Rong Shi, Stephan Hofmann, Linda Foit, Guoping Ren, Ursula Jakob, Zhaohui Xu, Miroslaw Cygler, and James C A Bardwell. Genetic selection designed to stabilize proteins uncovers a chaperone called spy. Nature Structural & Molecular Biology, 18:262-269, Feb 2011. URL: https://doi.org/10.1038/nsmb.2016, doi:10.1038/nsmb.2016. This article has 223 citations and is from a highest quality peer-reviewed journal.

8. (quan2011geneticselectiondesigned pages 1-5): Shu Quan, Philipp Koldewey, Tim Tapley, Nadine Kirsch, Karen M Ruane, Jennifer Pfizenmaier, Rong Shi, Stephan Hofmann, Linda Foit, Guoping Ren, Ursula Jakob, Zhaohui Xu, Miroslaw Cygler, and James C A Bardwell. Genetic selection designed to stabilize proteins uncovers a chaperone called spy. Nature Structural & Molecular Biology, 18:262-269, Feb 2011. URL: https://doi.org/10.1038/nsmb.2016, doi:10.1038/nsmb.2016. This article has 223 citations and is from a highest quality peer-reviewed journal.

9. (yamamoto2008involvementofmultiple pages 1-2): Kaneyoshi Yamamoto, Hiroshi Ogasawara, and Akira Ishihama. Involvement of multiple transcription factors for metal-induced spy gene expression in escherichia coli. Journal of biotechnology, 133 2:196-200, Jan 2008. URL: https://doi.org/10.1016/j.jbiotec.2007.08.002, doi:10.1016/j.jbiotec.2007.08.002. This article has 47 citations and is from a peer-reviewed journal.

10. (srivastava2014geneticregulationof pages 5-7): Santosh Kumar Srivastava, Paramesh Ramulu Lambadi, Tamoghna Ghosh, Ranjana Pathania, and Naveen Kumar Navani. Genetic regulation of spy gene expression in escherichia coli in the presence of protein unfolding agent ethanol. Gene, 548 1:142-8, Sep 2014. URL: https://doi.org/10.1016/j.gene.2014.07.003, doi:10.1016/j.gene.2014.07.003. This article has 41 citations and is from a peer-reviewed journal.

11. (quan2011geneticselectiondesigned pages 16-19): Shu Quan, Philipp Koldewey, Tim Tapley, Nadine Kirsch, Karen M Ruane, Jennifer Pfizenmaier, Rong Shi, Stephan Hofmann, Linda Foit, Guoping Ren, Ursula Jakob, Zhaohui Xu, Miroslaw Cygler, and James C A Bardwell. Genetic selection designed to stabilize proteins uncovers a chaperone called spy. Nature Structural & Molecular Biology, 18:262-269, Feb 2011. URL: https://doi.org/10.1038/nsmb.2016, doi:10.1038/nsmb.2016. This article has 223 citations and is from a highest quality peer-reviewed journal.

12. (kwon2010thecrystalstructure pages 2-5): Eunju Kwon, Dong Young Kim, Carol A. Gross, John D. Gross, and Kyeong Kyu Kim. The crystal structure escherichia coli spy. Protein Science, 19:2252-2259, Nov 2010. URL: https://doi.org/10.1002/pro.489, doi:10.1002/pro.489. This article has 53 citations and is from a peer-reviewed journal.

13. (kwon2010thecrystalstructure media 501f4ace): Eunju Kwon, Dong Young Kim, Carol A. Gross, John D. Gross, and Kyeong Kyu Kim. The crystal structure escherichia coli spy. Protein Science, 19:2252-2259, Nov 2010. URL: https://doi.org/10.1002/pro.489, doi:10.1002/pro.489. This article has 53 citations and is from a peer-reviewed journal.

14. (kwon2010thecrystalstructure pages 7-8): Eunju Kwon, Dong Young Kim, Carol A. Gross, John D. Gross, and Kyeong Kyu Kim. The crystal structure escherichia coli spy. Protein Science, 19:2252-2259, Nov 2010. URL: https://doi.org/10.1002/pro.489, doi:10.1002/pro.489. This article has 53 citations and is from a peer-reviewed journal.

15. (kwon2010thecrystalstructure media 159283c6): Eunju Kwon, Dong Young Kim, Carol A. Gross, John D. Gross, and Kyeong Kyu Kim. The crystal structure escherichia coli spy. Protein Science, 19:2252-2259, Nov 2010. URL: https://doi.org/10.1002/pro.489, doi:10.1002/pro.489. This article has 53 citations and is from a peer-reviewed journal.

16. (loiseau2024maintainingthemethionine pages 19-22): Laurent Loiseau, Nathan De Visch, Alexandra Vergnes, Jean Armengaud, Maxence S. Vincent, and Benjamin Ezraty. Maintaining the methionine residues of the chaperone spy in a reduced state is crucial for periplasmic proteostasis. bioRxiv, Dec 2024. URL: https://doi.org/10.1101/2024.12.12.628106, doi:10.1101/2024.12.12.628106. This article has 0 citations.

17. (srivastava2014geneticregulationof pages 1-2): Santosh Kumar Srivastava, Paramesh Ramulu Lambadi, Tamoghna Ghosh, Ranjana Pathania, and Naveen Kumar Navani. Genetic regulation of spy gene expression in escherichia coli in the presence of protein unfolding agent ethanol. Gene, 548 1:142-8, Sep 2014. URL: https://doi.org/10.1016/j.gene.2014.07.003, doi:10.1016/j.gene.2014.07.003. This article has 41 citations and is from a peer-reviewed journal.

18. (quan2011geneticselectiondesigned pages 28-32): Shu Quan, Philipp Koldewey, Tim Tapley, Nadine Kirsch, Karen M Ruane, Jennifer Pfizenmaier, Rong Shi, Stephan Hofmann, Linda Foit, Guoping Ren, Ursula Jakob, Zhaohui Xu, Miroslaw Cygler, and James C A Bardwell. Genetic selection designed to stabilize proteins uncovers a chaperone called spy. Nature Structural & Molecular Biology, 18:262-269, Feb 2011. URL: https://doi.org/10.1038/nsmb.2016, doi:10.1038/nsmb.2016. This article has 223 citations and is from a highest quality peer-reviewed journal.

19. (kaur2024nextgenerationantibiotic pages 1-2): Jan Naseer Kaur, Navaldeep Singh, Nicholas M. Smith, Jack F. Klem, Raymond Cha, Yinzhi Lang, Liang Chen, Barry Kreiswirth, Patricia N. Holden, Jürgen B. Bulitta, and Brian T. Tsuji. Next generation antibiotic combinations to combat pan-drug resistant klebsiella pneumoniae. Scientific Reports, Feb 2024. URL: https://doi.org/10.1038/s41598-024-53130-z, doi:10.1038/s41598-024-53130-z. This article has 23 citations and is from a peer-reviewed journal.

20. (ruan2020conversionofthe pages 8-11): Alessandro Ruan, Chang Ren, and Shu Quan. Conversion of the molecular chaperone spy into a novel fusion tag to enhance recombinant protein expression. Jan 2020. URL: https://doi.org/10.1016/j.jbiotec.2019.11.006, doi:10.1016/j.jbiotec.2019.11.006. This article has 23 citations and is from a peer-reviewed journal.

21. (huang2025catalyzingproteinfolding pages 12-13): Zijue Huang and Scott Horowitz. Catalyzing protein folding by chaperones. Biology, 14(10):1450, Oct 2025. URL: https://doi.org/10.3390/biology14101450, doi:10.3390/biology14101450. This article has 0 citations.

Citations

1. kwon2010thecrystalstructure pages 1-2
2. quan2011geneticselectiondesigned pages 9-11
3. kwon2010thecrystalstructure pages 2-5
4. kwon2010thecrystalstructure pages 5-7
5. quan2011geneticselectiondesigned pages 1-5
6. quan2011geneticselectiondesigned pages 19-22
7. ruan2020conversionofthe pages 16-29
8. loiseau2024maintainingthemethionine pages 19-22
9. yamamoto2008involvementofmultiple pages 1-2
10. quan2011geneticselectiondesigned pages 28-32
11. loiseau2024maintainingthemethionine pages 1-5
12. leinberger2024proteinaggregationis pages 1-2
13. kaur2024nextgenerationantibiotic pages 1-2
14. ruan2020conversionofthe pages 8-11
15. srivastava2014geneticregulationof pages 5-7
16. huang2025catalyzingproteinfolding pages 12-13
17. srivastava2014geneticregulationof pages 1-2
18. quan2011geneticselectiondesigned pages 16-19
19. kwon2010thecrystalstructure pages 7-8
20. https://doi.org/10.1038/nsmb.2016
21. https://doi.org/10.1002/pro.489
22. https://doi.org/10.1016/j.jbiotec.2019.11.006
23. https://doi.org/10.1101/2024.12.12.628106
24. https://doi.org/10.1016/j.gene.2014.07.003
25. https://doi.org/10.1016/j.jbiotec.2007.08.002
26. https://doi.org/10.1038/s41598-024-53130-z
27. https://doi.org/10.1128/msystems.01060-24
28. https://doi.org/10.1002/pro.489,
29. https://doi.org/10.1016/j.jbiotec.2019.11.006,
30. https://doi.org/10.1101/2024.12.12.628106,
31. https://doi.org/10.1128/msystems.01060-24,
32. https://doi.org/10.1038/nsmb.2016,
33. https://doi.org/10.1016/j.jbiotec.2007.08.002,
34. https://doi.org/10.1016/j.gene.2014.07.003,
35. https://doi.org/10.1038/s41598-024-53130-z,
36. https://doi.org/10.3390/biology14101450,

BioReason-Pro RL Review: Spy (E. coli)

Source: Spy-deep-research-bioreason-rl.md

• Correctness: 2/5
• Completeness: 2/5

Functional Summary Review

The BioReason functional summary describes Spy as:

An auxiliary component of a membrane-proximal stress-signaling pathway in Escherichia coli that operates at the cell envelope. It lacks catalytic motifs and instead functions through binding and assembly, stabilizing and tuning a two-component signaling module that monitors envelope and periplasmic stress. By organizing transient complexes near the membrane, it enhances signal relay and targeting within the stress-response network.

This summary is fundamentally wrong about Spy's function. Spy (Spheroplast protein Y) is an ATP-independent periplasmic chaperone, not a signaling pathway component. The curated review establishes that Spy:
- Functions primarily as a holdase, preventing protein aggregation under stress conditions
- Forms a thin, cradle-shaped homodimer with a novel alpha-helical fold
- Is massively upregulated under envelope stress via the Bae and Cpx two-component systems
- Remarkably allows substrate proteins to fold while remaining bound to its surface (PMID:26619265)

BioReason misidentified Spy as a Cpx pathway auxiliary protein (IPR052211), treating it as analogous to CpxP. The InterPro domains listed are "Cpx two-component system auxiliary protein" (IPR052211) and "LTXXQ motif family protein" (IPR012899). While Spy is regulated by the Cpx system, it is not a signaling component of that system -- it is an effector/chaperone induced by the system.

The GO term predictions include many inappropriate terms: mitochondrial outer membrane, plastid envelope, ribosome, thylakoid -- all nonsensical for a bacterial periplasmic chaperone. The predictions also include protein folding chaperone (GO:0044183) and unfolded protein binding (GO:0051082), which are correct but contradict the narrative.

Comparison with interpro2go:

Spy has no GO_REF:0000002 annotations in the curated review. BioReason's classification of Spy under IPR052211 (Cpx auxiliary protein) appears to be the root cause of the misidentification. If the InterPro family assignment is incorrect or overly broad, BioReason would propagate that error. The curated review identifies Spy's core function as protein folding chaperone (GO:0044183) with periplasmic localization -- a very different picture from what BioReason produces.

Notes on thinking trace

The trace builds its entire functional model on IPR052211 (Cpx auxiliary protein) and IPR012899 (LTXXQ motif), leading it to describe Spy as a signaling adaptor rather than a chaperone. This is a case where incorrect or misleading InterPro family assignment leads to a fundamentally wrong functional prediction. The mention of "response to hypoxia" and "cellular response to decreased oxygen levels" in the GO predictions is baffling for Spy.