OLFML2A

UniProt ID: A0A9L0SKW1
Organism: Equus caballus
Review Status: IN PROGRESS
📝 Provide Detailed Feedback

Gene Description

OLFML2A belongs to the photomedin family of olfactomedin-domain glycoproteins. Characterized mammalian photomedin-1 is a secreted, homodimeric protein that binds sulfated extracellular glycosaminoglycans. The selected horse protein retains the olfactomedin domain but lacks the N-terminal segment corresponding to the human secretion signal, leaving the localization and maturation of this particular protein model unresolved.

Existing Annotations Review

GO Term Evidence Action Reason
GO:0005576 extracellular region
IEA
GO_REF:0000044
UNDECIDED
Summary: The OLFML2A family is extracellular, but this horse sequence lacks the canonical leader.
Reason: The selected horse record is highly similar to photomedin-1 but lacks the segment corresponding to the experimentally supported human signal peptide. Conserved family biology supports an extracellular full-length gene product; it does not resolve whether this selected isoform/model is secreted. Verify the transcript model and alternative N-termini before accepting the location for this sequence.
Supporting Evidence:
file:HORSE/OLFML2A/OLFML2A-bioinformatics/RESULTS.md
Human UniProt annotates residues 1–27 as the signal peptide; the horse sequence starts `MDSQVFGDMDQVRMTSEGSDCRCKCIMRPLSKDA`, without the hydrophobic human leader.
file:human/OLFML2A/OLFML2A-uniprot.txt
FT SIGNAL 1..27

References

Loading supporting content…

Download this section (compressed HTML)

External Prediction Reviews

These computational predictions are reviewed separately from the GOA annotation set used for this review. The assessments below are from this project and do not constitute official GO annotations or endorsement by GO/UniProt. They are not included in the existing annotation review above.

ProtNLM2 External predictions

View prediction review YAML · OLFML2A-protnlm-predictions-review.yaml · Review status: COMPLETE

The conserved photomedin family supports extracellular glycosaminoglycan binding and dimerization, but the selected horse model lacks the canonical signal-peptide segment. All four sequence-specific predictions remain unresolved; matrix organization additionally lacks direct mechanistic support.

Source documents: projects/PROTNLM_EVALUATION/mammal-benchmark/horse40-predictions.csv · projects/PROTNLM_EVALUATION/mammal-benchmark/predictions.jsonl.gz · projects/PROTNLM_EVALUATION/mammal-benchmark/paired-sequences/OLFML2A.json · genes/HORSE/OLFML2A/OLFML2A-hypotheses/horse40-extracellular-matrix-localization/openscientist.md

Review score: 2 = concordant with evidence; 1 = uncertain; 0 = discordant with evidence. This is an assessment score, not a model probability.

GO:0030198 extracellular matrix organization GO_BP
UNC — Uncertain Review score: 1/2
Prediction method: ProtNLM2 · Version: UniProt API snapshot 2026-09-08
Review rationale: Secretion, ECM residence, glycosaminoglycan binding and self-association are supported by mouse photomedin experiments and conserved horse sequence. These properties make a role in ECM organization plausible but do not demonstrate creation, rearrangement or disassembly of matrix, so a perturbation or reconstitution result linking OLFML2A to matrix organization is still needed. The OpenScientist report resolved the missing signal peptide as a caveat on the selected N-terminally truncated accession, not evidence for loss of secretion by the horse OLFML2A locus.
Supporting Evidence:
GO:0042802 identical protein binding GO_MF
UNC — Uncertain Review score: 1/2
Prediction method: ProtNLM2 · Version: UniProt API snapshot 2026-09-08
Review rationale: Mouse photomedin-1 experiments support disulfide-linked homodimerization. The selected horse protein retains strong OLFML2A family similarity, and the OpenScientist report resolved its missing signal peptide as a caveat on this N-terminally truncated product rather than a loss from the horse locus. Because A0A9L0SKW1 itself still lacks the leader, secretory maturation and access to extracellular homodimerization partners remain unresolved for this exact model.
Supporting Evidence:
GO:0031012 extracellular matrix GO_CC
UNC — Uncertain Review score: 1/2
Prediction method: ProtNLM2 · Version: UniProt API snapshot 2026-09-08
Review rationale: Mouse photomedin-1 experiments support extracellular-matrix association. The OpenScientist report resolved the missing signal peptide at the locus level by identifying secretion-competent horse OLFML2A isoforms, but the selected A0A9L0SKW1 accession remains N-terminally truncated and should carry an accession-specific secretion caveat. GO:0031012 is therefore plausible by ISS/ISO for the locus while unresolved for direct assignment to this exact protein product.
Supporting Evidence:
GO:0050840 extracellular matrix binding GO_MF
UNC — Uncertain Review score: 1/2
Prediction method: ProtNLM2 · Version: UniProt API snapshot 2026-09-08
Review rationale: Mouse photomedin-1 experiments support binding to sulfated extracellular glycosaminoglycans, and conserved horse OLFML2A isoforms can plausibly reach extracellular partners. The OpenScientist report resolved the signal-peptide gap as specific to the selected N-terminally truncated accession rather than to the locus, but that leaves access to extracellular binding partners unresolved for the A0A9L0SKW1 product itself.
Supporting Evidence:

Deep Research

OpenScientist

(OLFML2A-hypotheses/horse40-extracellular-matrix-localization/openscientist.md)

Loading supporting content…

Download this section (compressed HTML)

📚 Additional Documentation

Notes

(OLFML2A-notes.md)

Loading supporting content…

Download this section (compressed HTML)

Bioinformatics Results

(RESULTS.md)

Loading supporting content…

Download this section (compressed HTML)

đź“„ View Raw YAML

Loading supporting content…

Download this section (compressed HTML)