BenR is an AraC/XylS family transcriptional activator that regulates aromatic compound degradation in response to benzoate. It directly activates expression of the benABCD operon encoding benzoate 1,2-dioxygenase and related enzymes that catalyze the conversion of benzoate to catechol via the Ξ²-ketoadipate pathway. BenR exhibits effector-responsive regulation, requiring benzoate binding to its N-terminal domain for optimal transcriptional activation. It functions as a master regulator coordinating multiple aromatic degradation pathways and is essential for benzoate utilization.
| GO Term | Evidence | Action | Reason |
|---|---|---|---|
|
GO:0003677
DNA binding
|
IEA
GO_REF:0000043 |
ACCEPT |
Summary: This annotation is correct and supported by the HTH araC/xylS-type DNA-binding domain (residues 215-316) and DNase I footprinting evidence showing direct binding to benA promoter sequences. The annotation accurately reflects a core molecular function of BenR.
Supporting Evidence:
file:PSEPK/BenR/BenR-deep-research-claudecode.md
BenR contains HTH DNA-binding domain and directly binds to benA promoter sequences as demonstrated by DNase I footprinting
file:PSEPK/BenR/BenR-uniprot.txt
HTH araC/xylS-type domain at residues 215-316
file:PSEPK/BenR/BenR-deep-research-perplexity-lite.md
See deep research file for comprehensive analysis
|
|
GO:0003700
DNA-binding transcription factor activity
|
IEA
GO_REF:0000002 |
MODIFY |
Summary: This annotation correctly captures the core function of BenR as a transcription factor. However, a more specific child term 'DNA-binding transcription activator activity' (GO:0001216) or 'ligand-modulated transcription activator activity' (GO:0141097) would be more precise given that BenR is an activator (not repressor) and is regulated by benzoate binding.
Proposed replacements:
DNA-binding transcription activator activity
ligand-modulated transcription activator activity
Supporting Evidence:
file:PSEPK/BenR/BenR-deep-research-claudecode.md
BenR is a transcriptional activator that induces benA-lacZ expression 15-fold in response to benzoate
file:PSEPK/BenR/BenR-deep-research-perplexity.md
BenR requires benzoate as allosteric effector for efficient transcriptional activation
|
|
GO:0005737
cytoplasm
|
IEA
GO_REF:0000044 |
ACCEPT |
Summary: Correct localization for a bacterial transcriptional regulator. BenR functions in the cytoplasm where it interacts with chromosomal DNA and RNA polymerase. This is a core cellular component annotation.
Supporting Evidence:
file:PSEPK/BenR/BenR-uniprot.txt
Subcellular location - cytoplasm
file:PSEPK/BenR/BenR-deep-research-perplexity.md
BenR functions in cytoplasm interacting with chromosomal DNA and RNA polymerase
|
|
GO:0006355
regulation of DNA-templated transcription
|
IEA
GO_REF:0000120 |
KEEP AS NON CORE |
Summary: This annotation is technically correct but extremely general. While BenR does regulate transcription, this term doesn't capture the specific biological role in benzoate catabolism or aromatic compound degradation. This should be kept but marked as non-core, with more specific biological process terms added to capture the actual metabolic context.
Supporting Evidence:
file:PSEPK/BenR/BenR-deep-research-claudecode.md
BenR regulates transcription of benABCD operon
|
|
GO:0009893
positive regulation of metabolic process
|
IEA
GO_REF:0000117 |
KEEP AS NON CORE |
Summary: This annotation is correct (BenR activates metabolic genes) but very general. It doesn't specify which metabolic process. This is an appropriate high-level annotation but should be supplemented with more specific terms for aromatic/benzoate catabolism. The annotation is technically accurate but lacks biological specificity.
Supporting Evidence:
file:PSEPK/BenR/BenR-deep-research-claudecode.md
BenR activates benzoate degradation genes which are metabolic enzymes
|
|
GO:0043565
sequence-specific DNA binding
|
IEA
GO_REF:0000002 |
ACCEPT |
Summary: This annotation is correct and more specific than GO:0003677. BenR recognizes specific direct repeat sequences (TGCA-N6-GGNTA motifs) in the benA promoter and related promoters, as demonstrated by DNase I footprinting. This is a core molecular function.
Supporting Evidence:
file:PSEPK/BenR/BenR-deep-research-claudecode.md
BenR recognizes direct repeat sequences (TGCA-N6-GGNTA) in benA promoter by DNase I footprinting
file:PSEPK/BenR/BenR-deep-research-perplexity.md
DNase I footprinting shows direct binding to benA promoter protecting specific DNA sequences
|
|
GO:0043640
benzoate catabolic process via hydroxylation
|
IEA
file:PSEPK/BenR/BenR-deep-research-claudecode.md |
NEW |
Summary: This is the specific biological process regulated by BenR. The benABCD operon encodes benzoate 1,2-dioxygenase which hydroxylates benzoate to cis-1,2-dihydroxybenzoate followed by dehydrogenation to catechol. This annotation should be added as NEW to capture the core biological function.
Supporting Evidence:
file:PSEPK/BenR/BenR-deep-research-claudecode.md
BenR activates benABCD operon. BenABC is benzoate 1,2-dioxygenase converting benzoate to benzoate-cis-diol, BenD is cis-diol dehydrogenase converting to catechol
file:PSEPK/BenR/BenR-deep-research-perplexity.md
BenR directly activates benzoate degradation genes via the hydroxylation pathway
|
|
GO:0043639
benzoate catabolic process
|
IEA
file:PSEPK/BenR/BenR-deep-research-perplexity.md |
NEW |
Summary: BenR regulates benzoate catabolism - this is its primary biological role. BenR null mutants cannot grow on benzoate as sole carbon source. This should be added as a NEW core annotation.
Supporting Evidence:
file:PSEPK/BenR/BenR-deep-research-claudecode.md
BenR is essential for benzoate utilization - null mutants cannot grow on benzoate
file:PSEPK/BenR/BenR-deep-research-perplexity.md
BenR null mutants unable to grow on benzoate - essential for benzoate metabolism
|
Q: What is the precise mechanism by which BenR indirectly represses pcaK expression for 4-hydroxybenzoate transport?
Q: Are there additional transcriptional regulators beyond Crc that modulate BenR expression or activity?
Q: What is the crystal structure of BenR bound to benzoate and DNA, revealing the molecular details of effector-induced activation?
Experiment: Determine the crystal structure of BenR in complex with benzoate and target DNA to reveal the molecular mechanism of effector-induced conformational change and DNA binding specificity
Hypothesis: Benzoate binding to the N-terminal domain causes a conformational change that releases intramolecular inhibition of the C-terminal DNA-binding domain
Type: X-ray crystallography or cryo-EM
Experiment: Use ChIP-seq to identify the complete BenR regulon - all genomic loci bound by BenR under benzoate-induced conditions to map direct vs indirect targets
Hypothesis: BenR directly binds additional promoters beyond benABCD that coordinate aromatic compound metabolism
Type: Chromatin immunoprecipitation followed by sequencing
Experiment: Perform in vitro transcription assays with purified BenR, RNA polymerase, and benA promoter DNA to measure the dose-response of benzoate on transcriptional activation
Hypothesis: Benzoate binding to BenR increases its affinity for DNA and/or RNA polymerase in a dose-dependent manner
Type: In vitro transcription assay with varying benzoate concentrations
Exported on March 22, 2026 at 02:57 AM
Organism: Pseudomonas putida
Sequence:
MESRLLSERSSVFHHADPYAVSDYVNQHVGQHCIGLSRTTHPQASLSHRKFAELDLCRISYGGSVRVTSPALETIYHLQVLLNGNCLWRGHKREQHLVPGELLLINPDDPVDLTYSEDCEKFILKVPTRLLDSICDEQRWQRPDGGVRFLRNHYRLDELDGFVNLLAMVCHEAEVSDSLPRVQGHYSQIVASKLLTLMSTNIRRESLSAPQAGLERILDYIERNLKLELSAEVLAEQACMSLRSLYALFDQHLGITPKHYVRQRKLERVHACLSDPTCGVRSVTELALDYGFLHLGRFSEIYRQQFGELPSQTFKRRA
I begin with the InterPro architecture. The N-terminal half carries IPR035418 (Transcription regulator HTH, AraC-type, ligand binding domain-like, residues 23β191), which is characteristic of AraC/XylS regulators where an N-terminal regulatory module senses small molecules and controls DNA-binding output. This sits within the broader family signature IPR050204 (AraC/XylS family transcriptional regulators, residues 31β316), indicating a full-length AraC-type transcription factor that often toggles between repressor and activator states. The C-terminal half is enriched for DNA-binding determinants: IPR018060 (AraC-like, DNA binding HTH domain, residues 215β316) and IPR018062 (HTH domain AraC-type, conserved site, residues 265β310) define the helix-turn-helix core that docks onto palindromic operators, while IPR009057 (Homeodomain-like superfamily, residues 214β263) supports this structural fold. The ordered layoutβan N-terminal ligand/regulatory module followed by a C-terminal HTH DNA-binding moduleβcauses sequence-specific promoter recognition and transcriptional regulation.
This domain architecture dictates the molecular function. The C-terminal AraC-type HTH domain binds DNA in a sequence-specific manner and recruits or occludes RNA polymerase via protein-protein contacts typical of AraC/XylS regulators. Thus, the primary molecular function is DNA-binding transcription factor activity with sequence-specific DNA binding. The N-terminal AraC-type ligand-binding module modulates oligomerization and operator occupancy, enabling context-dependent repression or activation.
From function to process, AraC/XylS regulators commonly gate operons in response to environmental cues. Here, the regulatory module upstream of the HTH domain provides the sensory switch that controls transcription initiation, placing the protein in regulation of transcription, DNA-templated. The specified biological themeβcontrol of a gene cluster for catabolizing carbon monoxide and formateβfollows naturally: by repressing (and potentially activating) target operons, this factor tunes pathway flux for CO/formate utilization during anaerobic or microaerophilic growth.
Cellular location follows from solubility and function. The absence of transmembrane segments and the soluble HTH-bearing architecture argue for a cytoplasmic protein that operates on chromosomal DNA. AraC-family regulators diffuse in the cytoplasm and bind promoter regions in the bacterial nucleoid; therefore, the cellular component is the cytoplasm.
Mechanistically, the N-terminal IPR035418 module likely binds an endogenous effector or reflects allosteric state, dictating oligomeric assembly and promoter occupancy. The C-terminal IPR018060/IPR018062 HTH engages operator sites upstream of the CO/formate catabolic operons, where occupancy represses transcription by sterically hindering RNA polymerase or by recruiting nucleoid-associated proteins that stabilize a closed complex. I therefore hypothesize that this regulator partners with RNA polymerase core and primary sigma factor during repression/activation, and associates with nucleoid-associated proteins (e.g., IHF, H-NS) that shape local DNA topology. Through these assemblies, it down-modulates expression of the CO/formate pathway under non-inducing conditions and relieves repression whenθ―±ε―Ό signals accumulate, thereby coupling environmental sensing to operon-level transcriptional control in the cytoplasm.
A soluble bacterial transcriptional regulator that uses an N-terminal regulatory module and a C-terminal helix-turn-helix DNA-binding domain to control operons involved in carbon monoxide and formate catabolism. By sensing intracellular cues and assembling into operator-bound complexes, it modulates promoter accessibility and RNA polymerase engagement to repress pathway genes under non-inducing conditions, operating within the cytoplasm and coordinating environmental responses with transcriptional output.
Involved in the regulation of carbon monoxide (CO) and formate catabolism.
IPR035418, domain) β residues 23-191IPR050204, family) β residues 31-316IPR009057, homologous_superfamily) β residues 214-263IPR018060, domain) β residues 215-316IPR018062, conserved_site) β residues 265-310Molecular Function: molecular_function (GO:0003674), binding (GO:0005488), transcription regulator activity (GO:0140110), organic cyclic compound binding (GO:0097159), heterocyclic compound binding (GO:1901363), DNA-binding transcription factor activity (GO:0003700), nucleic acid binding (GO:0003676), DNA-binding transcription activator activity (GO:0001216), DNA binding (GO:0003677), transcription regulatory region nucleic acid binding (GO:0001067), double-stranded DNA binding (GO:0003690), sequence-specific DNA binding (GO:0043565), transcription cis-regulatory region binding (GO:0000976), sequence-specific double-stranded DNA binding (GO:1990837)
Biological Process: biological_process (GO:0008150), biological regulation (GO:0065007), positive regulation of biological process (GO:0048518), regulation of biological process (GO:0050789), positive regulation of cellular process (GO:0048522), regulation of metabolic process (GO:0019222), regulation of cellular process (GO:0050794), positive regulation of metabolic process (GO:0009893), positive regulation of macromolecule metabolic process (GO:0010604), positive regulation of cellular metabolic process (GO:0031325), regulation of biosynthetic process (GO:0009889), regulation of nitrogen compound metabolic process (GO:0051171), regulation of macromolecule metabolic process (GO:0060255), regulation of cellular metabolic process (GO:0031323), regulation of primary metabolic process (GO:0080090), positive regulation of biosynthetic process (GO:0009891), positive regulation of nitrogen compound metabolic process (GO:0051173), positive regulation of macromolecule biosynthetic process (GO:0010557), positive regulation of nucleobase-containing compound metabolic process (GO:0045935), positive regulation of RNA metabolic process (GO:0051254), regulation of macromolecule biosynthetic process (GO:0010556), regulation of cellular biosynthetic process (GO:0031326), regulation of nucleobase-containing compound metabolic process (GO:0019219), regulation of RNA metabolic process (GO:0051252), positive regulation of cellular biosynthetic process (GO:0031328), regulation of gene expression (GO:0010468), positive regulation of RNA biosynthetic process (GO:1902680), regulation of RNA biosynthetic process (GO:2001141), regulation of transcription, DNA-templated (GO:0006355), positive regulation of DNA-templated transcription (GO:0045893), positive regulation of nucleic acid-templated transcription (GO:1903508), regulation of nucleic acid-templated transcription (GO:1903506)
Cellular Component: cellular_component (GO:0005575), protein-containing complex (GO:0032991), protein-DNA complex (GO:0032993)
Generated by BioReason
Exported on March 22, 2026 at 02:57 AM
Organism: Pseudomonas putida
Sequence:
MESRLLSERSSVFHHADPYAVSDYVNQHVGQHCIGLSRTTHPQASLSHRKFAELDLCRISYGGSVRVTSPALETIYHLQVLLNGNCLWRGHKREQHLVPGELLLINPDDPVDLTYSEDCEKFILKVPTRLLDSICDEQRWQRPDGGVRFLRNHYRLDELDGFVNLLAMVCHEAEVSDSLPRVQGHYSQIVASKLLTLMSTNIRRESLSAPQAGLERILDYIERNLKLELSAEVLAEQACMSLRSLYALFDQHLGITPKHYVRQRKLERVHACLSDPTCGVRSVTELALDYGFLHLGRFSEIYRQQFGELPSQTFKRRA
I begin with the InterPro architecture. The N-terminal half carries IPR035418 (Transcription regulator HTH, AraC-type, ligand binding domain-like, residues 23β191), which is characteristic of AraC/XylS regulators where an N-terminal regulatory module senses small molecules and controls DNA-binding output. This sits within the broader family signature IPR050204 (AraC/XylS family transcriptional regulators, residues 31β316), indicating a full-length AraC-type transcription factor that often toggles between repressor and activator states. The C-terminal half is enriched for DNA-binding determinants: IPR018060 (AraC-like, DNA binding HTH domain, residues 215β316) and IPR018062 (HTH domain AraC-type, conserved site, residues 265β310) define the helix-turn-helix core that docks onto palindromic operators, while IPR009057 (Homeodomain-like superfamily, residues 214β263) supports this structural fold. The ordered layoutβan N-terminal ligand/regulatory module followed by a C-terminal HTH DNA-binding moduleβcauses sequence-specific promoter recognition and transcriptional regulation.
This domain architecture dictates the molecular function. The C-terminal AraC-type HTH domain binds DNA in a sequence-specific manner and recruits or occludes RNA polymerase via protein-protein contacts typical of AraC/XylS regulators. Thus, the primary molecular function is DNA-binding transcription factor activity with sequence-specific DNA binding. The N-terminal AraC-type ligand-binding module modulates oligomerization and operator occupancy, enabling context-dependent repression or activation.
From function to process, AraC/XylS regulators commonly gate operons in response to environmental cues. Here, the regulatory module upstream of the HTH domain provides the sensory switch that controls transcription initiation, placing the protein in regulation of transcription, DNA-templated. The specified biological themeβcontrol of a gene cluster for catabolizing carbon monoxide and formateβfollows naturally: by repressing (and potentially activating) target operons, this factor tunes pathway flux for CO/formate utilization during anaerobic or microaerophilic growth.
Cellular location follows from solubility and function. The absence of transmembrane segments and the soluble HTH-bearing architecture argue for a cytoplasmic protein that operates on chromosomal DNA. AraC-family regulators diffuse in the cytoplasm and bind promoter regions in the bacterial nucleoid; therefore, the cellular component is the cytoplasm.
Mechanistically, the N-terminal IPR035418 module likely binds an endogenous effector or reflects allosteric state, dictating oligomeric assembly and promoter occupancy. The C-terminal IPR018060/IPR018062 HTH engages operator sites upstream of the CO/formate catabolic operons, where occupancy represses transcription by sterically hindering RNA polymerase or by recruiting nucleoid-associated proteins that stabilize a closed complex. I therefore hypothesize that this regulator partners with RNA polymerase core and primary sigma factor during repression/activation, and associates with nucleoid-associated proteins (e.g., IHF, H-NS) that shape local DNA topology. Through these assemblies, it down-modulates expression of the CO/formate pathway under non-inducing conditions and relieves repression whenθ―±ε―Ό signals accumulate, thereby coupling environmental sensing to operon-level transcriptional control in the cytoplasm.
A soluble bacterial transcriptional regulator that uses an N-terminal regulatory module and a C-terminal helix-turn-helix DNA-binding domain to control operons involved in carbon monoxide and formate catabolism. By sensing intracellular cues and assembling into operator-bound complexes, it modulates promoter accessibility and RNA polymerase engagement to repress pathway genes under non-inducing conditions, operating within the cytoplasm and coordinating environmental responses with transcriptional output.
Involved in the regulation of carbon monoxide (CO) and formate catabolism.
IPR035418, domain) β residues 23-191IPR050204, family) β residues 31-316IPR009057, homologous_superfamily) β residues 214-263IPR018060, domain) β residues 215-316IPR018062, conserved_site) β residues 265-310Molecular Function: molecular_function (GO:0003674), binding (GO:0005488), transcription regulator activity (GO:0140110), organic cyclic compound binding (GO:0097159), heterocyclic compound binding (GO:1901363), DNA-binding transcription factor activity (GO:0003700), nucleic acid binding (GO:0003676), DNA-binding transcription activator activity (GO:0001216), DNA binding (GO:0003677), transcription regulatory region nucleic acid binding (GO:0001067), double-stranded DNA binding (GO:0003690), sequence-specific DNA binding (GO:0043565), transcription cis-regulatory region binding (GO:0000976), sequence-specific double-stranded DNA binding (GO:1990837)
Biological Process: biological_process (GO:0008150), biological regulation (GO:0065007), positive regulation of biological process (GO:0048518), regulation of biological process (GO:0050789), positive regulation of cellular process (GO:0048522), regulation of metabolic process (GO:0019222), regulation of cellular process (GO:0050794), positive regulation of metabolic process (GO:0009893), positive regulation of macromolecule metabolic process (GO:0010604), positive regulation of cellular metabolic process (GO:0031325), regulation of biosynthetic process (GO:0009889), regulation of nitrogen compound metabolic process (GO:0051171), regulation of macromolecule metabolic process (GO:0060255), regulation of cellular metabolic process (GO:0031323), regulation of primary metabolic process (GO:0080090), positive regulation of biosynthetic process (GO:0009891), positive regulation of nitrogen compound metabolic process (GO:0051173), positive regulation of macromolecule biosynthetic process (GO:0010557), positive regulation of nucleobase-containing compound metabolic process (GO:0045935), positive regulation of RNA metabolic process (GO:0051254), regulation of macromolecule biosynthetic process (GO:0010556), regulation of cellular biosynthetic process (GO:0031326), regulation of nucleobase-containing compound metabolic process (GO:0019219), regulation of RNA metabolic process (GO:0051252), positive regulation of cellular biosynthetic process (GO:0031328), regulation of gene expression (GO:0010468), positive regulation of RNA biosynthetic process (GO:1902680), regulation of RNA biosynthetic process (GO:2001141), regulation of transcription, DNA-templated (GO:0006355), positive regulation of DNA-templated transcription (GO:0045893), positive regulation of nucleic acid-templated transcription (GO:1903508), regulation of nucleic acid-templated transcription (GO:1903506)
Cellular Component: cellular_component (GO:0005575), protein-containing complex (GO:0032991), protein-DNA complex (GO:0032993)
Generated by BioReason
BenR is a chromosomally-encoded transcriptional regulator in Pseudomonas putida that controls the expression of genes involved in aromatic compound degradation[collier-2000-benr-aromatic]. As a member of the AraC/XylS family of transcriptional regulators, BenR responds to benzoate as an inducing effector molecule to activate expression of the benABCD operon and related genes[collier-2000-benr-aromatic]. BenR is essential for benzoate utilization and plays a key role in hierarchical substrate utilization, enabling P. putida to preferentially degrade benzoate over other aromatic compounds[collier-2000-benr-aromatic].
BenR belongs to the AraC/XylS family, a large group of over 100 prokaryotic positive transcriptional regulators widely distributed across proteobacteria and gram-positive bacteria[gallegos-1997-arac-family]. Members of this family are approximately 300 amino acids in length and feature a characteristic bipartite structure[gallegos-1997-arac-family]:
BenR shows 62% amino acid sequence identity to XylS, the prototypical member of this subfamily[collier-2000-benr-aromatic]. This high degree of similarity suggests that BenR and XylS share similar structural features and regulatory mechanisms.
The conserved C-terminal domain contains two predicted helix-turn-helix (HTH) DNA-binding motifs[gallegos-1997-arac-family]. Structural studies of related family members have shown that these motifs fold into seven Ξ±-helices, with recognition helices Ξ±3 and Ξ±6 making direct contact with DNA's major groove[marques-2008-xyls-effector].
BenR recognizes and binds to specific DNA sequences in target promoters. The benA promoter region contains a direct repeat sequence between nucleotides β68 and β34 that matches the XylS binding site (TGCA-Nβ-GGNTA)[collier-2000-benr-aromatic]. This binding site overlaps or is adjacent to the RNA polymerase β35 region, positioning BenR for direct interaction with RNA polymerase to activate transcription[gallegos-1997-arac-family][collier-2000-benr-aromatic].
Based on the homology to XylS and mechanistic studies of XylS, BenR likely employs an intramolecular domain derepression mechanism[marques-2008-xyls-effector]. In the absence of effector:
Upon binding of benzoate (the effector molecule):
This dual role of the effectorβboth promoting dimerization and releasing conformational constraintsβensures tight control of gene expression[marques-2008-xyls-effector].
BenR directly regulates a chromosomal cluster of eight genes involved in benzoate metabolism[collier-2000-benr-aromatic]:
Catabolic genes:
- benA, benB, benC: Encode the three components of benzoate 1,2-dioxygenase, a Rieske-type dioxygenase that converts benzoate to benzoate-cis-diol[wolfe-2002-benzoate-dioxygenase]
- benD: Encodes cis-diol dehydrogenase, which converts benzoate-cis-diol to catechol
Transport and structural genes:
- benK: Encodes benzoate permease, responsible for substrate uptake
- benF: Encodes a porin-like protein
- benE: Encodes a membrane protein of unknown function
Regulatory gene:
- benR: Encodes the BenR transcriptional regulator itself
Beyond the chromosomal ben genes, BenR regulates at least three distinct aromatic acid degradation pathways[collier-2000-benr-aromatic]:
This multi-pathway regulation demonstrates that BenR functions as a master regulator coordinating multiple aromatic compound degradation systems[collier-2000-benr-aromatic].
Expression studies using Ξ²-galactosidase reporter fusions demonstrate the regulatory effect of BenR[collier-2000-benr-aromatic]:
These findings confirm that BenR is both necessary and sufficient for benzoate-induced gene expression and is absolutely essential for benzoate utilization[collier-2000-benr-aromatic].
The genes regulated by BenR encode enzymes that catalyze the initial steps of the Ξ²-ketoadipate (ortho-cleavage) pathway[perez-pantoja-2018-benzoate-dynamics]:
Benzoate β Benzoate-cis-diol β Catechol β cis,cis-muconate β
Ξ²-ketoadipate β Acetyl-CoA + Succinyl-CoA
This pathway represents a two-step strategy for aromatic compound degradation:
1. Ring modification reactions prepare the aromatic ring for cleavage
2. Ring fission and subsequent reactions generate TCA cycle intermediates[perez-pantoja-2018-benzoate-dynamics]
Benzoate 1,2-dioxygenase (BenABC):
This Rieske-type dioxygenase is the first committed enzyme in benzoate degradation and the primary target of BenR regulation[wolfe-2002-benzoate-dioxygenase]. The enzyme has an (Ξ±Ξ²)β subunit architecture:
The enzyme catalyzes the incorporation of molecular oxygen into benzoate, producing benzoate-cis-diol. Mechanistic studies show that fully reduced enzyme can complete the catalytic cycle, with both metal centers contributing equally to catalysis[wolfe-2002-benzoate-dioxygenase].
Benzoate-cis-diol dehydrogenase (BenD):
Converts the cis-diol to catechol, completing the peripheral pathway that feeds into the central catechol branch of the Ξ²-ketoadipate pathway[collier-2000-benr-aromatic].
Systems-level analysis has identified three major flux control points in benzoate metabolism[perez-pantoja-2018-benzoate-dynamics]:
Benzoate transport: The permease (BenK) represents a significant bottleneck, with adaptive regulation increasing uptake capacity over successive generations
Benzoate-cis-diol dehydrogenase: Subject to feedback inhibition by its product catechol, providing metabolic control
Catechol 1,2-dioxygenase: Maintains low intracellular catechol concentrations to prevent toxicity, functioning as a "metabolic safety valve"[perez-pantoja-2018-benzoate-dynamics]
This multi-level regulationβtranscriptional control by BenR, coupled with enzymatic flux controlβensures efficient and safe metabolism of aromatic compounds[perez-pantoja-2018-benzoate-dynamics].
BenR itself is subject to regulation by Crc (catabolite repression control), a global regulator in P. putida[moreno-2008-crc-benr]. This regulation occurs through a novel mechanism:
The Crc-BenR regulatory cascade produces dramatic effects on gene expression:
This regulatory architecture enables hierarchical control of aromatic compound metabolism, allowing the cell to prioritize carbon sources based on global physiological state[moreno-2008-crc-benr].
While Crc directly targets only BenR, it indirectly affects downstream pathways. When benzoate-to-catechol conversion is blocked by reduced BenR levels, pathway intermediates (muconate, Ξ²-ketoadipate) are not produced, preventing activation of cat and pca genes by their respective regulators[moreno-2008-crc-benr]. This demonstrates how targeting a single master regulator can coordinate an entire metabolic network.
When P. putida is provided with a mixture of benzoate and 4-hydroxybenzoate (4-HBA), it preferentially degrades benzoate[collier-2000-benr-aromatic]. This preference is mediated by BenR through a dual mechanism:
Activation: BenR activates benzoate degradation genes (benABCD)
Repression: BenR-dependent conditions lead to repression of pcaK expression (encoding 4-HBA transport protein), resulting in ten-fold reduction in 4-HBA uptake rates[collier-2000-benr-aromatic]
The repression of 4-HBA uptake by BenR appears to be indirect rather than through direct DNA binding[collier-2000-benr-aromatic]. This suggests a regulatory network where:
This coordinated regulation enables efficient use of multiple aromatic substrates by preventing simultaneous induction of competing pathways[collier-2000-benr-aromatic].
The AraC/XylS family is widely distributed across bacteria, with members found in diverse ecological niches[gallegos-1997-arac-family]. The conservation of this regulatory architecture suggests strong selective pressure to maintain tight, effector-responsive control of metabolic pathways.
AraC/XylS family members participate in three major regulatory functions[gallegos-1997-arac-family]:
The recruitment of diverse N-terminal effector-binding domains onto a conserved C-terminal DNA-binding scaffold represents a successful evolutionary strategy for creating responsive regulatory systems[gallegos-1997-arac-family].
P. putida is a soil bacterium frequently found in environments rich in aromatic compounds from plant material and industrial contamination. The sophisticated regulatory system controlled by BenR enables:
These capabilities contribute to P. putida's success as a versatile degrader of aromatic pollutants and its potential for bioremediation applications.
Based on the available research, we can construct a detailed model of BenR function:
While no crystal structure exists for BenR itself (PP_3159), the Protein Data Bank contains structure 3GRA, an AraC family transcriptional regulator from P. putida KT2440 (gene PP_3526)[pdb-3gra-arac-structure]. This structure provides important context:
This related structure demonstrates the characteristic dimer formation of AraC family members in P. putida and could serve as a template for homology modeling of BenR[pdb-3gra-arac-structure]. However, it lacks an effector molecule and represents a different protein, limiting direct insights into BenR's benzoate-binding mechanism.
BenR is not unique to P. putida. A functional homolog exists in Pseudomonas fluorescens MB214, where it similarly regulates the benABCD operon[vandergeize-2006-benr-fluorescens]. Key findings include:
The conservation of BenR function across Pseudomonas species suggests strong selective pressure to maintain this regulatory architecture for aromatic compound metabolism[vandergeize-2006-benr-fluorescens].
The presence of BenR homologs in multiple Pseudomonas species (P. putida, P. fluorescens, P. aeruginosa) indicates:
Despite 62% amino acid identity between BenR and XylS, the Pben promoter has evolved remarkable specificity. Research on P. putida mt-2 reveals that the Pben promoter responds strongly to BenR but not to XylS, even when XylS is present at high concentrations[durant-2014-pben-differential].
The biological problem: P. putida mt-2 contains two benzoate degradation pathways:
- Ortho pathway (chromosomal): BenR activates Pben
- Meta pathway (plasmid pWW0): XylS activates Pm
During m-xylene degradation, the intermediate 3-methylbenzoate could theoretically activate the wrong pathway, generating toxic dead-end metabolites[durant-2014-pben-differential].
The evolutionary solution: The Pben promoter operator sequences evolved to avoid strong interaction with XylS protein. This selective binding prevents cross-activation and metabolic conflicts, demonstrating coevolution of regulator and promoter sequences to maintain pathway segregation[durant-2014-pben-differential].
Mechanistic basis: While both BenR and XylS recognize similar DNA motifs (TGCA-Nβ-GGNTA direct repeats), subtle sequence differences in the Pben operator create differential binding affinity. The natural expression ranges of XylS are insufficient to cause significant Pben cross-regulation[durant-2014-pben-differential].
This represents an elegant regulatory solution where promoter architecture itself prevents dangerous pathway crosstalk between highly similar transcription factors.
Understanding BenR regulation has enabled diverse practical applications, from metabolic engineering to sophisticated biosensors.
Shaw et al. (2012) demonstrated that the BenR-Pben system can be engineered for broadened effector specificity through cis-regulatory element modification rather than protein engineering[shaw-2012-promoter-engineering]:
Approach: Modified the Pb promoter to contain two complete BenR operator binding sites instead of one.
Results:
- 4-5Γ higher transcriptional response to 3-methylbenzoate compared to wild-type promoter
- Enhanced sensitivity to benzoate as well
- Shifted regulatory logic from amplifier-like (benzoate-only) to OR-gate behavior (both benzoate and 3-methylbenzoate activate)
Implications: This demonstrates that inducer specificity can be tuned through promoter DNA modification without altering the transcription factor, offering a modular approach for synthetic biology[shaw-2012-promoter-engineering]. Multiple operator sites increase cooperative binding and overall system sensitivity.
Voyvodic et al. (2019) successfully repurposed BenR as a sensing element in cell-free biosensor systems with remarkable performance[voyvodic-2019-cellfree-biosensor]:
System Architecture:
- Sensor module: BenR expressed from OR2-OR1-Pr promoter (30 nM DNA)
- Reporter module: Pben promoter driving sfGFP or luciferase (100 nM DNA)
- Metabolic transducers: Enzymes converting target compounds to benzoic acid
Performance Characteristics:
- Dynamic range: >200-fold (vs ~10-fold in vivo)
- Response time: 4 hours to maximum signal
- Sensitivity: Detection at 1 Β΅M concentrations
- Range: Three orders of magnitude quantification
Metabolic Transducer Integration:
The modular "plug-and-play" design enables detection of diverse compounds:
Both transduced sensors maintained performance comparable to the original BenR sensor[voyvodic-2019-cellfree-biosensor].
Real-World Applications Demonstrated:
Key Advantages:
- Cell-free approach allows precise DNA concentration control
- Minimal background signal
- Functions in complex matrices (beverages, urine) without cellular constraints
- 20Γ better fold change than in vivo systems
- Computational analysis identified 64 metabolites connectable via transducers[voyvodic-2019-cellfree-biosensor]
This work demonstrates that BenR functions robustly outside its natural cellular context and validates the mechanistic understanding while proving practical utility for diagnostics and environmental monitoring.
Despite substantial progress in understanding BenR function, several questions remain:
BenR is a well-characterized member of the AraC/XylS family of transcriptional regulators that serves as a master regulator of aromatic compound degradation in Pseudomonas putida[collier-2000-benr-aromatic]. Through its dual function in activating benzoate degradation genes and coordinating hierarchical substrate utilization, BenR enables P. putida to efficiently metabolize complex mixtures of aromatic compounds[collier-2000-benr-aromatic].
The protein employs a sophisticated regulatory mechanism involving effector-induced conformational changes that release intramolecular inhibition, allowing DNA binding and transcription activation[marques-2008-xyls-effector]. BenR itself is subject to translational control by the global regulator Crc, integrating aromatic compound metabolism with cellular carbon catabolite control[moreno-2008-crc-benr].
Recent research has dramatically expanded our understanding of BenR's versatility and practical utility:
Conservation and Specificity: BenR homologs exist across Pseudomonas species[vandergeize-2006-benr-fluorescens], and the Pben promoter has evolved exquisite specificity to prevent cross-activation by the highly similar XylS regulator[durant-2014-pben-differential]. This coevolution of regulator and promoter sequences maintains metabolic logic and prevents toxic pathway conflicts.
Engineering and Synthetic Biology: The BenR-Pben system proves highly amenable to rational engineering. Promoter modification can broaden effector specificity without protein changes[shaw-2012-promoter-engineering], while BenR functions remarkably well in cell-free biosensor systems with >200-fold dynamic range[voyvodic-2019-cellfree-biosensor]. Real-world applications span from food safety testing to clinical diagnostics for drugs of abuse.
Mechanistic Insights: While no BenR crystal structure yet exists, related AraC family structures from P. putida provide templates for understanding[pdb-3gra-arac-structure]. Systems-level analysis reveals integration of transcriptional regulation with metabolic flux control at multiple levels[perez-pantoja-2018-benzoate-dynamics].
The ben system continues to serve as an exemplary model for studying regulated biodegradation of aromatic compounds. Understanding BenR function has revealed fundamental principles of transcriptional regulation, metabolic pathway organization, and hierarchical substrate utilization that extend far beyond this single system. The successful demonstration of practical applicationsβfrom biosensors detecting cocaine in urine to logic gates for synthetic circuitsβvalidates both our mechanistic understanding and the system's biotechnology potential.
Future research addressing the open questions identified aboveβparticularly high-resolution structural studies of BenR with bound effector, detailed mechanistic investigations of protein-DNA interactions, and expanded engineering for novel specificitiesβwill further advance both fundamental understanding and practical applications of this important regulatory system.
Report prepared: 2025-11-05 (Updated)
Papers reviewed: 11 primary research articles, reviews, and structural studies
Citations folder: Contains full-text/abstract and summary files for each reference
New findings: Added homolog studies, promoter evolution, structural context, and synthetic biology applications
1997: Gallegos et al. - AraC/XylS family review (foundational)
2000: Collier et al. - BenR identification and characterization
2002: Wolfe et al. - Benzoate dioxygenase mechanism
2006: van der Geize et al. - BenR in P. fluorescens
2008: Marques et al. - XylS effector mechanism
2008: Moreno & Rojo - Crc regulation of BenR
2009: PDB 3GRA - AraC family structure from P. putida
2012: Shaw et al. - Promoter engineering for signal specificity
2014: DurΓ‘nt et al. - Differential Pben promoter response
2018: Perez-Pantoja et al. - Systems-level benzoate metabolism
2019: Voyvodic et al. - BenR in cell-free biosensors
provider: openai
model: o3-deep-research-2025-06-26
cached: false
start_time: '2025-11-05T14:25:41.516816'
end_time: '2025-11-05T14:45:06.227110'
duration_seconds: 1164.71
template_file: templates/gene_research_go_focused.md
template_variables:
organism: PSEPK
gene_id: BenR
gene_symbol: benR
provider_config:
timeout: 600
max_retries: 3
parameters:
allowed_domains: []
temperature: 0.1
top_p: 1.0
citation_count: 100
Please provide a comprehensive research report on the gene benR (BenR) in PSEPK.
The research report should be a detailed narrative explaining the function, biological processes, and localization of the gene product. Citations should be given for all claims.
You should prioritize authoritative reviews and primary scientific literature when conducting research. You can supplement
this with annotations you find in gene/protein databases, but these can be outdated or inaccurate.
We are specifically interested in the primary function of the gene - for enzymes, what reaction is catalyzed, and what is the substrate specificity? For transporters, what is the substrate? For structural proteins or adapters, what is the broader structural role? For signaling molecules, what is the role in the pathway.
We are interested in where in or outside the cell the gene product carries out its function.
We are also interested in the signaling or biochemical pathways in which the gene functions. We are less interested in broad pleiotropic effects, except where these elucidate the precise role.
Include evidence where possible. We are interested in both experimental evidence as well as inference from structure, evolution, or bioinformatic analysis. Precise studies should be prioritized over high-throughput, where available.
The benR gene in Pseudomonas (strain βPSEPKβ) encodes BenR, a transcriptional regulator that controls benzoate catabolism. BenR is a member of the AraC/XylS family of regulators, sharing ~62% amino acid identity with XylS from the TOL plasmid of Pseudomonas putida (pmc.ncbi.nlm.nih.gov) (pmc.ncbi.nlm.nih.gov). Like XylS, BenR functions as a DNA-binding activator that responds to aromatic effectors. It is a positive regulator required for the induction of benzoate degradation genes in the presence of benzoate. Sequence analyses identified BenR (318 amino acids, ~36 kDa) as having the conserved two-domain architecture of AraC-family proteins: an N-terminal effector-binding domain and a C-terminal helix-turn-helix DNA-binding domain (pmc.ncbi.nlm.nih.gov). This places BenR in the XylS subfamily of AraC regulators, distinct from LysR-type regulators (like BenM or CatR in other bacteria) that also control aromatic catabolic pathways (bmcmicrobiol.biomedcentral.com).
Localization and mechanism: As a transcription factor, BenR operates intracellularly in the cytoplasm/nucleoid, binding to promoter regions of target genes. A direct-repeat DNA motif has been identified upstream of the benzoate catabolic genes matching the consensus AraC/XylS binding site (pmc.ncbi.nlm.nih.gov). BenR likely binds this site as a dimer and, upon binding its effector (benzoate or a derivative), it recruits RNA polymerase to activate transcription of the catabolic operon. Overexpression of BenR in E. coli or providing benzoate as an inducer strongly elevates transcription from the benzoate-degradative promoters, confirming BenRβs role as a ligand-dependent activator (pmc.ncbi.nlm.nih.gov). In P. putida, for example, BenR overproduction led to a ~25-fold increase in benA promoter activity, and wild-type cells showed ~15-fold induction of benA-lacZ reporter expression when benzoate was added (pmc.ncbi.nlm.nih.gov). This effector-responsive DNA-binding mechanism underlies BenRβs control of downstream genes.
BenRβs primary function is to activate the expression of the benzoate degradation (ben) operon when benzoate is present. Genomic analysis of P. putida revealed that benR is clustered with benzoate catabolic genes (pmc.ncbi.nlm.nih.gov). Immediately downstream of benR are at least seven genes (designated benA, benB, benC, benD, benE, benK, and benF) inferred to encode the enzymes and transporters for benzoate utilization (pmc.ncbi.nlm.nih.gov). Specifically, BenA, BenB, and BenC form a multicomponent benzoate 1,2-dioxygenase (terminal oxygenase and reductase components) that catalyzes the conversion of benzoate to cis-1,2-dihydro-1,2-dihydroxybenzoate (pmc.ncbi.nlm.nih.gov). BenD is a NAD^+^-dependent cis-diol dehydrogenase that further oxidizes this dihydrodiol to catechol (pmc.ncbi.nlm.nih.gov). Thus, under BenR control, benzoate is channeled into catechol, a central intermediate of aromatic catabolism. Additional cluster genes provide uptake functions: BenK is a benzoate permease (inner membrane transporter) and BenF is an outer-membrane porin, facilitating benzoate entry into the cell (pmc.ncbi.nlm.nih.gov). Another gene, BenE, is present in the cluster with an unclear function (pmc.ncbi.nlm.nih.gov). All these ben genes are induced in the presence of benzoate, but only if BenR is functional (pmc.ncbi.nlm.nih.gov) (pmc.ncbi.nlm.nih.gov).
Biological pathway: The BenR-regulated operon initiates the Ξ²-ketoadipate pathwayβs catechol branch, which is a major route for aromatic compound degradation in soil bacteria (pmc.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov). When benzoate is available, BenR triggers its conversion to catechol. Catechol is then cleaved by downstream enzymes (e.g., catechol 1,2-dioxygenase CatA and others of the ortho-cleavage route) into Ξ²-ketoadipate, which enters central metabolism (pubmed.ncbi.nlm.nih.gov). P. putida can degrade catechol via an ortho-cleavage pathway to TCA cycle intermediates; if the TOL plasmid is present, it can also use a meta-cleavage pathway for methylbenzoates (pmc.ncbi.nlm.nih.gov) (pmc.ncbi.nlm.nih.gov). BenR specifically governs the peripheral (benzoate to catechol) steps and works in concert with other regulators that control downstream steps. In Pseudomonas, the catechol-cleavage operon (cat genes) is regulated by the LysR-type activator CatR responding to cis,cis-muconate (the product of catechol cleavage), and the protocatechuate branch (pca genes) is regulated by PcaR responding to Ξ²-ketoadipate (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov). This division of labor means that BenR is necessary and sufficient for the initial benzoate oxidation steps, while further metabolism of catechol requires additional inducible systems. Indeed, BenR is required for growth on benzoate as a sole carbon source, but mutants lacking benR can still grow on catechol, since the downstream catabolic enzymes are intact and governed independently (bmcmicrobiol.biomedcentral.com). In P. stutzeri A1501, for example, a ΞbenR strain lost the ability to utilize benzoate but remained capable of using catechol, demonstrating that BenR is the sole activator of the benABCD operon (benzoate dioxygenase/dehydrogenase genes) in that organism (bmcmicrobiol.biomedcentral.com). Complementation with a functional benR gene restores benzoate utilization, confirming its central role (bmcmicrobiol.biomedcentral.com).
Notably, in Pseudomonas strains where the ben and cat genes are genetically linked, BenR can have a broader influence. P. stutzeri A1501 lacks a CatR homolog; intriguingly, benzoate addition in this strain still activates transcription of catechol degradation genes (catBCA) to some extent (bmcmicrobiol.biomedcentral.com) (bmcmicrobiol.biomedcentral.com). Comparative sequence analysis showed a conserved BenR-binding site in the promoter of the benA gene across pseudomonads (bmcmicrobiol.biomedcentral.com), and there is evidence that BenR (or an unknown regulator) may cross-activate the catechol pathway in the absence of CatR. In most Pseudomonas, however, BenR and CatR work together to ensure a coordinated degradation: BenR triggers catechol formation, and CatR (triggered by catecholβs product muconate) induces the enzymes to process catechol (bmcmicrobiol.biomedcentral.com) (bmcmicrobiol.biomedcentral.com). This two-tier regulatory scheme is viewed as a model of complex transcriptional control in aromatic catabolism, allowing precise tuning of each pathway segment (bmcmicrobiol.biomedcentral.com). As one review noted, the BenRβCatR dual system βmay serve as a practical model for complex regulatory circuitsβ in biodegradation networks (bmcmicrobiol.biomedcentral.com).
BenR acts primarily as a transcriptional activator. In the absence of benzoate, expression of the benzoate-catabolic enzymes is basal. When benzoate is present (or a structural analog capable of acting as effector), BenR binds the ligand and activates transcription of its target operon. Reporter fusion experiments have demonstrated that BenR is both necessary and sufficient for induction of the ben genes. For example, a benAβlacZ fusion in wild-type Pseudomonas showed strong induction (Ξ²-galactosidase activity increased an order of magnitude) upon adding benzoate, whereas an isogenic benR mutant showed no such induction (pmc.ncbi.nlm.nih.gov). Introducing a plasmid-encoded benR into the mutant restored benA expression and benzoate utilization (pmc.ncbi.nlm.nih.gov). These results provide direct evidence that BenR positively regulates the ben operon in response to benzoate (pmc.ncbi.nlm.nih.gov). BenRβs effector specificity appears tuned to benzoate and closely related aromatics β notably, benzoate itself is a known effector that also triggers the analogous XylS regulator on the TOL plasmid (pmc.ncbi.nlm.nih.gov). Methyl-substituted benzoates (e.g. 3-methylbenzoate) can likely serve as effectors as well, since benR was identified in mutants selected on 3-methylbenzoate (pmc.ncbi.nlm.nih.gov) and BenR was shown to activate the TOL meta-cleavage pathway (which XylS normally controls) in response to methylbenzoate (pmc.ncbi.nlm.nih.gov) (pmc.ncbi.nlm.nih.gov). This indicates that BenRβs ligand-binding pocket accommodates benzoate and certain analogues, allowing it to regulate multiple aromatic acid degradation routes.
Regulon scope: Besides the chromosomal benzoate dioxygenase genes (benABCD), BenR has been implicated in controlling at least two other sets of genes in P. putida, highlighting a broader regulatory role. First, BenR can activate the meta-cleavage pathway operon (on the TOL plasmid) for methylbenzoate and benzoate degradation (pmc.ncbi.nlm.nih.gov) (pmc.ncbi.nlm.nih.gov). The TOL plasmidβs meta operon (xyL genes) is normally activated by XylS when it senses benzoate or 3-methylbenzoate. BenR is a XylS homolog and recognizes a similar DNA sequence motif, and experiments showed that BenR can bind and activate the plasmid meta-operon promoter (Pm) in an E. coli reporter system (pmc.ncbi.nlm.nih.gov). This cross-talk means a chromosomal regulator (BenR) can induce plasmid-encoded pathways, potentially providing redundancy or additional control when both plasmid and chromosome pathways are present (pmc.ncbi.nlm.nih.gov). Second, BenR is required for benzoate-mediated repression of the pcaK gene, which encodes a 4-hydroxybenzoate (4-HBA) transporter (pmc.ncbi.nlm.nih.gov) (pmc.ncbi.nlm.nih.gov). In P. putida, the presence of benzoate prevents uptake of 4-HBA by downregulating pcaK transcription β an example of prioritizing one substrate over another. A benR mutant abolishes this catabolite repression effect (pmc.ncbi.nlm.nih.gov), suggesting BenR somehow links benzoate sensing to reduced expression of the 4-HBA transport system. The mechanism appears indirect (possibly via accumulation of a metabolic intermediate or interplay with other regulators) (pmc.ncbi.nlm.nih.gov), but functionally it ensures that when benzoate is present, the cell preferentially metabolizes it rather than 4-HBA (pmc.ncbi.nlm.nih.gov) (pmc.ncbi.nlm.nih.gov). In summary, BenR has a multifaceted regulatory role: it activates genes for benzoate ortho-cleavage (ben operon), activates genes for toluate/benzoate meta-cleavage (when the TOL plasmid is present), and contributes to repression of the 4-HBA (protocatechuate) pathway uptake during growth on benzoate (pmc.ncbi.nlm.nih.gov) (pmc.ncbi.nlm.nih.gov). This coordination helps optimize aromatic substrate utilization based on availability.
Global regulation: The expression and activity of BenR itself are integrated into broader cellular regulatory networks. Pseudomonas species are known to exhibit carbon catabolite repression (CCR), ensuring preferred carbon sources are used first (bmcmicrobiol.biomedcentral.com). In P. putida, CCR is mediated by the Crc protein (Catabolite repression control), which can directly target benR. Crc binds to the 5β² end of benR mRNA and inhibits its translation, thereby lowering BenR protein levels when a preferred substrate (like succinate or a rich medium) is present (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov). This creates a hierarchy: if a readily metabolizable carbon source is available, BenR remains low and the benzoate catabolic genes are not expressed (even if benzoate is present) (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov). Studies showed that in a Crc-deficient strain, benA expression was de-repressed in the presence of benzoate, confirming that Crcβs effect on the benzoate pathway is exerted at the level of BenR translation (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov). Once preferred nutrients are exhausted, Crc repression lifts, BenR can be synthesized, and the ben operon gets induced by benzoate. This multilayer control underscores that BenR is part of a tightly regulated network. It responds to specific aromatic compounds, but its action is gated by global carbon status, allowing Pseudomonas to balance efficient growth with opportunistic degradation of aromatics (pubmed.ncbi.nlm.nih.gov) (bmcmicrobiol.biomedcentral.com).
Biological significance: The BenR-controlled benzoate degradation pathway is a key adaptive trait for soil and water bacteria like P. putida, P. fluorescens, P. stutzeri and others. Aromatic acids such as benzoate are common in soil (from plant phenolics, lignin breakdown, or pollutants), and the ability to use them as carbon sources gives these bacteria a competitive edge (bmcmicrobiol.biomedcentral.com) (bmcmicrobiol.biomedcentral.com). The Ξ²-ketoadipate pathway, to which BenRβs regulon feeds, is a central route for biodegradation of aromatics and is widely distributed in bacteria (bmcmicrobiol.biomedcentral.com) (bmcmicrobiol.biomedcentral.com). By regulating the first step that commits benzoate to this pathway, BenR plays an important role in environmental pollutant degradation. For example, P. putida can degrade toluene and xylenes via benzoate intermediates; BenR (chromosomal) works in tandem with plasmid-encoded systems to ensure these compounds are funneled into harmless end products (pmc.ncbi.nlm.nih.gov) (pmc.ncbi.nlm.nih.gov). In P. stutzeri (a nitrogen-fixing rhizobacterium), the benR regulon likely helps the bacterium colonize plant roots by utilizing aromatic root exudates or soil humic substances as nutrients (bmcmicrobiol.biomedcentral.com). The importance of BenR is evident from the fact that knocking it out disables the utilization of benzoate in these bacteria (bmcmicrobiol.biomedcentral.com), which would impair their ability to exploit many aromatic compounds.
Biotechnological and research applications: The BenR-benzonate regulatory module has been harnessed as a useful tool in recombinant protein expression and synthetic biology. Because benzoate is an inexpensive, readily available inducer that is not a common carbon source in most lab media, the Pseudomonas benA promoter (activated by BenR) provides a tightly regulated expression system. Researchers identified the benABCD operon of P. fluorescens and its regulator BenR as a convenient inducible promoter system for heterologous gene expression (microbialcellfactories.biomedcentral.com) (microbialcellfactories.biomedcentral.com). By placing target genes under control of the benzoate-inducible promoter and co-expressing BenR, one can achieve strong, dose-dependent expression in Pseudomonas hosts upon addition of benzoate. In P. fluorescens MB214, for instance, the benzoate operon promoter showed very low background and high induction, allowing controlled protein production from shake-flask scale up to 20 L fermenters (microbialcellfactories.biomedcentral.com) (microbialcellfactories.biomedcentral.com). This system has been successfully applied to produce mammalian proteins in Pseudomonas and even adapted to other bacteria: for example, elements of the P. fluorescens BenR/Pben promoter have been engineered into Methylococcus (a methanotroph) to create a benzoate-inducible genetic switch (pseudoluge.pseudomonas.com) (academic.oup.com). The tight on/off control and inexpensive inducer make BenR-based regulators attractive for industrial biotechnology.
From a biodegradation standpoint, understanding BenR also allows scientists to manipulate pathways for bioremediation. By overexpressing or mutating regulators like BenR, it may be possible to enhance degradation capabilities of bacteria for environmental cleanup. Conversely, BenRβs sensitivity to global regulation (via Crc) makes it a target for optimizing metabolic flux: relieving Crc repression (for example, via an antagonist protein or regulatory RNA) could lead to higher expression of benzoate-catabolic enzymes even in mixed-substrate environments (pubmed.ncbi.nlm.nih.gov) (bmcmicrobiol.biomedcentral.com). These insights, drawn from recent molecular studies, demonstrate how BenR connects environmental sensing with metabolic response, and how it can be leveraged in practice.
Over two decades of research have solidified BenRβs role as the benzoate gatekeeper in pseudomonads. Early work in 2000 by Cowles et al. first characterized BenR in P. putida, showing that it controls three aspects of aromatic metabolism (benzoate ortho-cleavage, plasmid-encoded meta-cleavage, and 4-HBA uptake) (pmc.ncbi.nlm.nih.gov). They noted that βBenR thus has roles as an activator of benzoate degradation via ortho ring fission, as an activator of benzoate and methylbenzoate degradation via meta ring fission, and in repression of 4-HBA degradationβ (pmc.ncbi.nlm.nih.gov). Subsequent genomic studies extended these findings across species. Huang et al. (2010) observed that P. stutzeri A1501 relies on an AraC-type BenR (61% identical to P. fluorescens BenR) for benzoate utilization, in the absence of the usual CatR regulator (bmcmicrobiol.biomedcentral.com) (bmcmicrobiol.biomedcentral.com). This highlights some evolutionary divergence β Pseudomonas uses an AraC/XylS strategy (BenR) for the ben operon, whereas other bacteria like Acinetobacter use a LysR-type activator (BenM) for a similar operon (bmcmicrobiol.biomedcentral.com). Despite different protein families, the functional outcome is the same: the benzoate-catabolic genes are transcriptionally silent until a specific regulator-effector complex (BenRβbenzoate or BenMβbenzoate) triggers their expression. In Pseudomonas, BenRβs interplay with CatR forms a clever circuit to sense both the substrate and its downstream product (bmcmicrobiol.biomedcentral.com). Experts consider this a prime example of coordinated regulation in biodegradation pathways (bmcmicrobiol.biomedcentral.com).
Current understanding: By 2023, the consensus is that BenR acts as the master switch for benzoate degradation in Pseudomonas. Its regulatory network has been mapped in detail, from DNA-binding sites to effector specificity and higher-level regulation. Ongoing research has focused on structural and systems-biology aspects: e.g. solving AraC-family regulator structures to understand ligand recognition, or modeling the catabolite repression system involving BenR. While no crystal structure of BenR has been reported yet (to our knowledge), homology to XylS and other AraC proteins provides a basis for predicting its ligand-binding pocket and dimerization interface (pmc.ncbi.nlm.nih.gov) (pmc.ncbi.nlm.nih.gov). On the systems side, recent analyses of global regulatory mutants (Crc, Hfq, etc.) illuminated how BenR-controlled pathways can be modulated for metabolic engineering (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov). There is also interest in bioresource applications: for instance, using BenR-regulated promoters to construct benzoate-inducible biosensors or kill-switches in synthetic biology. Given that benzoate is a benign chemical, inducible systems based on BenR are being tested in E. coli and other chassis for tight gene circuit control (microbialcellfactories.biomedcentral.com) (microbialcellfactories.biomedcentral.com).
In summary, BenR is a key transcriptional activator that links the presence of benzoate to the expression of enzymes that initiate its breakdown. It operates inside the cell by binding to DNA at target promoters and requires benzoate as a molecular trigger. Through BenR, Pseudomonas species effectively respond to aromatic compounds in their environment, converting pollutants like benzoate into metabolizable forms. This gene and its protein product have been well characterized in the literature, with clear experimental evidence for their function (e.g. loss-of-function mutations abolishing benzoate utilization (pmc.ncbi.nlm.nih.gov) (bmcmicrobiol.biomedcentral.com), and promoter assays demonstrating inducible activation (pmc.ncbi.nlm.nih.gov)). As our understanding has advanced, BenR has also become a practical tool in biotechnology, underscoring the value of fundamental gene function research. The continued study of BenR and related regulators not only deepens our knowledge of bacterial metabolism but also paves the way for innovative applications in bioremediation and synthetic biology.
References: Key studies and reviews include Cowles et al. 2000 (J. Bacteriol. 182:6339-6346) (pmc.ncbi.nlm.nih.gov) (pmc.ncbi.nlm.nih.gov), which first identified BenRβs role; Huang et al. 2010 (BMC Microbiol 10:36) describing benR in P. stutzeri (bmcmicrobiol.biomedcentral.com); and a 2006 study by Jahanian et al. (Microb. Cell Fact. 5:1) on using the benR promoter system in P. fluorescens (microbialcellfactories.biomedcentral.com). These and other works form the basis of the current functional annotation of BenR in Pseudomonas. Each provides experimental backing for BenRβs function, biological process involvement, cellular localization (DNA-binding in cytoplasm), and regulatory impact, as summarized above. The consistency of findings across different Pseudomonas strains and the agreement with bioinformatic predictions (e.g. conserved binding sites (bmcmicrobiol.biomedcentral.com) and gene context (pmc.ncbi.nlm.nih.gov)) give high confidence in this functional annotation. Overall, BenR is characterized as a benzoate-responsive transcriptional activator that is essential for initiating benzoate catabolism and integrating this pathway into the bacteriumβs overall metabolic network (pmc.ncbi.nlm.nih.gov) (bmcmicrobiol.biomedcentral.com).
provider: perplexity
model: sonar-deep-research
cached: false
start_time: '2025-11-05T15:31:19.530764'
end_time: '2025-11-05T15:33:18.218564'
duration_seconds: 118.69
template_file: templates/gene_research_go_focused.md
template_variables:
organism: PSEPK
gene_id: BenR
gene_symbol: benR
provider_config:
timeout: 600
max_retries: 3
parameters:
allowed_domains: []
reasoning_effort: medium
search_domain_filter: []
return_citations: true
temperature: 0.0
citation_count: 51
Please provide a comprehensive research report on the gene benR (BenR) in PSEPK.
The research report should be a detailed narrative explaining the function, biological processes, and localization of the gene product. Citations should be given for all claims.
You should prioritize authoritative reviews and primary scientific literature when conducting research. You can supplement
this with annotations you find in gene/protein databases, but these can be outdated or inaccurate.
We are specifically interested in the primary function of the gene - for enzymes, what reaction is catalyzed, and what is the substrate specificity? For transporters, what is the substrate? For structural proteins or adapters, what is the broader structural role? For signaling molecules, what is the role in the pathway.
We are interested in where in or outside the cell the gene product carries out its function.
We are also interested in the signaling or biochemical pathways in which the gene functions. We are less interested in broad pleiotropic effects, except where these elucidate the precise role.
Include evidence where possible. We are interested in both experimental evidence as well as inference from structure, evolution, or bioinformatic analysis. Precise studies should be prioritized over high-throughput, where available.
The user is asking for a comprehensive research report on the gene benR (BenR) in PSEPK (which appears to be Pseudomonas sp., likely Pseudomonas putida KT2440 or a similar strain based on the context).
Let me analyze the search results to understand what BenR is:
From the search results, I can see that:
1. BenR is a transcriptional regulator (regulatory protein) - sources [8][20][23][29][51][55][57][58]
2. It belongs to the AraC/XylS family of regulators - sources [8][19][20][23][29][51][55][57][58]
3. It regulates benzoate degradation genes - sources [8][20][23][29][51][55][57][58]
4. It activates expression of benABC genes in response to benzoate - sources [8][20][23][29][51][55][57][58]
5. It also represses 4-HBA transport genes - sources [8][20][23][29][51][55][57][58]
6. It has ~62% identity to XylS - sources [8][20][23][29][51][55][57][58]
7. It's a DNA-binding protein that interacts with promoter regions
The structure indicates BenR:
- Is about 318 residues, ~36.4 kDa - sources [20]
- Belongs to the AraC/XylS family
- Has a conserved DNA-binding domain
- Has an N-terminal effector-binding region
Let me organize this into a comprehensive report covering:
1. Primary function (what it does)
2. Biochemical mechanism (how it works)
3. Substrate specificity and specifics
4. Cellular localization
5. Signaling/biochemical pathways
6. Evidence and mechanisms
I need to write a 10,000+ word comprehensive academic report with proper citations.
The benR gene encodes a transcriptional regulatory protein that governs the metabolic response of Pseudomonas putida to benzoate and related aromatic compounds through a sophisticated multi-pathway regulatory system[8][20][23]. BenR functions as a positive transcriptional activator belonging to the AraC/XylS family of bacterial regulators, activating the expression of genes encoding benzoate degradation enzymes while simultaneously repressing competing metabolic pathways[8][19][20][23][29][51][55][57][58]. This regulation enables P. putida to preferentially utilize benzoate as a carbon source even in the presence of alternative substrates. The BenR regulatory mechanism operates through direct DNA binding to specific operator sequences and requires benzoate as an allosteric effector molecule, demonstrating sophisticated molecular sensing and response mechanisms that allow bacterial populations to adapt their metabolism to environmental substrate availability.
The benR gene encodes a protein of 318 amino acid residues with a calculated molecular weight of approximately 36.4 kilodaltons (kDa)[20]. The BenR protein is classified within the AraC/XylS family of prokaryotic transcriptional regulators, a large and functionally diverse group of bacterial proteins that share a characteristic structural organization despite low sequence homology in non-conserved regions[19][22]. Members of this family are typically approximately 300 amino acids in length and possess a conserved C-terminal DNA-binding domain alongside a variable N-terminal domain that determines regulatory specificity and effector binding[19][22].
The structural architecture of BenR exemplifies the modular organization characteristic of AraC/XylS family proteins. The N-terminal region of BenR shares approximately 65% amino acid identity with the corresponding region of XylS, the TOL plasmid-encoded regulator from Pseudomonas putida[8][20][23][29][51][55][57][58]. This N-terminal domain appears to function in both dimerization of the regulatory protein and recognition of the benzoate effector molecule. The C-terminal region contains the conserved DNA-binding domain and is responsible for interactions with specific promoter sequences and the transcriptional machinery[19][22]. The overall sequence similarity between BenR and XylS reaches 62% identity at the amino acid level, establishing BenR as a functional homologue of the plasmid-encoded XylS regulator[8][20][23][29][51][55][57][58].
BenR belongs to the AraC/XylS subfamily rather than to the LysR-type transcriptional regulators (LTTRs) which operate according to different regulatory principles[8][19][20][23][29][51][55][57][58]. This distinction is significant because different bacterial species have evolved distinct regulatory mechanisms for benzoate degradation. For example, in Acinetobacter sp. strain ADP1, the functionally analogous regulatory protein BenM represents a LysR-type regulator rather than an AraC/XylS-type protein[33][43][54][56][59]. The convergent evolution of BenR and BenM demonstrates how different bacterial lineages have adapted distinct protein scaffolds to address similar metabolic challenges, namely the regulation of benzoate catabolism genes.
The primary biological function of BenR is to serve as a transcriptional activator of the benzoate degradation operon in response to benzoate availability[8][20][23][29][51][55][57][58]. The BenR regulatory protein directly activates transcription of the benABC genes, which encode the enzymes required for the initial transformation of benzoate to catechol[8][20][23][29][51][55][57][58]. These three genes are cotranscribed as a single polycistronic message, forming a functional operon under the control of a BenR-responsive promoter[8][20][23][29][51][55][57][58].
The benA gene encodes benzoate 1,2-dioxygenase subunit alpha (also designated benzoate oxygenase component), which functions as the first enzyme in the benzoate degradation pathway[8][20][23][29][51][55][57][58]. This enzyme catalyzes the addition of molecular oxygen to the aromatic benzoate ring, producing a cis-configured dihydrodiol intermediate[8][20][23][29][51][55][57][58]. The benB gene encodes the benzoate dioxygenase subunit beta, the second component of the dioxygenase complex, which is essential for the hydroxylation reaction[8][20][23][29][51][55][57][58]. The benC gene encodes an electron transfer component that delivers electrons to the dioxygenase enzyme complex, enabling the oxidative activation of the benzoate molecule[8][20][23][29][51][55][57][58]. Additionally, the benD gene, which encodes a 2-hydro-1,2-dihydroxybenzoate dehydrogenase responsible for the subsequent oxidation of the dihydrodiol to catechol, appears to be subject to BenR regulatory control[8][20][23][29][51][55][57][58].
The direct transcriptional activation function of BenR has been established through multiple complementary experimental approaches. When P. putida cells carrying a benA-lacZ transcriptional fusion grown in the presence of benzoate show a 15-fold increase in Ξ²-galactosidase activity compared to cells grown without benzoate, and this induction is completely abolished in benR mutant strains, providing strong genetic evidence for BenR-dependent regulation[8][20][23][29][51][55][57][58]. Notably, overexpression of the benR gene from a T7 inducible promoter in E. coli cells carrying the benA-lacZ fusion results in a 25-fold increase in Ξ²-galactosidase expression in the absence of any exogenous benzoate, demonstrating that BenR possesses intrinsic transcriptional activation capacity[8][20][23][29][51][55][57][58]. This observation indicates that some fraction of the BenR protein population assumes an active conformation capable of stimulating transcription even without the benzoate effector.
The physical interaction between BenR and DNA has been characterized through DNase I footprinting analysis, which revealed that BenR protects specific sequences in the benA promoter region from enzymatic cleavage[8][20][23][29][51][55][57][58]. The protected region contains a direct repeat sequence with the consensus motif that matches the experimentally defined XylS binding site from the TOL plasmid meta-cleavage pathway promoter, confirming that BenR recognizes similar DNA sequences to its XylS homologue[8][20][23][29][51][55][57][58]. This sequence conservation at the DNA-binding level further substantiates the functional homology between BenR and XylS despite differences in their effector ligands.
BenR requires benzoate as an allosteric effector molecule to achieve efficient transcriptional activation of the benABC genes[8][20][23][29][51][55][57][58]. The presence of benzoate induces a conformational change in the BenR protein that modulates its DNA-binding properties and its ability to interact with the transcriptional machinery. This represents an elegant example of molecular sensing, wherein the regulatory protein monitors the availability of a specific substrate and couples this sensory information to changes in gene expression patterns.
In the absence of benzoate, BenR retains a basal level of transcriptional activity, as evidenced by the observation that overexpression of benR from high-copy plasmids can drive expression of the benA-lacZ fusion even without exogenous benzoate[8][20][23][29][51][55][57][58]. However, when benzoate is present, the magnitude of transcriptional activation increases dramatically, indicating that benzoate functions as a positive allosteric effector that enhances the regulatory activity of BenR. This mechanism ensures that while some level of benzoate degradation enzyme is present basally, the system responds robustly to the actual presence of substrate in the environment.
The molecular basis for benzoate-induced activation of BenR appears to involve conformational changes in the N-terminal domain of the protein. As discussed previously, the N-terminal regions of BenR and XylS share substantial sequence homology (approximately 65%), and structural and biochemical studies of XylS have suggested that this region undergoes significant conformational rearrangement upon effector binding[8][20][23][29][51][55][57][58]. A prevailing model proposes that in the unliganded state, the N-terminal domain of BenR adopts a conformation that suppresses the transcriptional activity of the C-terminal DNA-binding domain through intramolecular interactions[8][20][23][29][51][55][57][58]. Upon benzoate binding to the N-terminal domain, this intramolecular inhibition is relieved, allowing the C-terminal domain to adopt a conformation favorable for productive interactions with promoter DNA and the transcriptional machinery.
The phenotype of benR mutant strains provides additional insights into this regulatory mechanism. benR null mutants display an inability to grow on benzoate as the sole carbon source, demonstrating that BenR is essential for benzoate catabolism[8][20][23][29][51][55][57][58]. However, when benR is supplied in trans on a plasmid, the complemented mutant strains regain the capacity to grow on benzoate, although with a longer generation time (approximately 2.4 hours) compared to wild-type cells (approximately 1.8 hours), suggesting that expression of benR from a plasmid may not fully recapitulate the native regulatory system, possibly due to differences in gene dosage or promoter architecture[8][20][23][29][51][55][57][58].
In addition to activating the chromosomal benABC genes, BenR has acquired the remarkable capacity to regulate the TOL plasmid-encoded meta-cleavage pathway operon (the Pm promoter)[8][20][23][29][51][55][57][58]. The meta-cleavage pathway catalyzes an alternative ring-fission strategy for benzoate degradation. In this pathway, after initial conversion of benzoate to catechol, the aromatic ring is cleaved between a hydroxyl group and an adjacent carbon atom (meta-cleavage), in contrast to the ortho-cleavage pathway where the ring is cleaved between the two adjacent hydroxyl groups[8][20][23][29][51][55][57][58].
The fact that BenR can activate both the chromosomal ben genes and the plasmid-encoded meta pathway genes indicates that BenR recognizes a common DNA sequence motif shared between these two regulatory regions[8][20][23][29][51][55][57][58]. This cross-regulation ensures that when benzoate is available, P. putida cells can mobilize multiple degradation pathways encoded on different genetic elements. The meta-cleavage pathway, encoded by the TOL plasmid, typically produces higher enzyme levels than the ortho-cleavage pathway, and this dual-pathway regulation may provide metabolic flexibility under varying environmental conditions.
BenR performs a second critical regulatory function by repressing the expression of genes required for the degradation of alternative aromatic compounds, specifically the genes encoding 4-hydroxybenzoate (4-HBA) transport and metabolism[8][20][23][29][51][55][57][58]. This repressive function ensures that when benzoate is available, the cell prioritizes benzoate metabolism and does not waste metabolic resources on the synthesis of enzymes for alternative substrates.
Specifically, BenR is required for benzoate-mediated repression of the pcaK gene, which encodes the 4-HBA permease (transporter protein) that allows cells to import 4-HBA from the environment[8][20][23][29][51][55][57][58]. When P. putida is presented with a mixture of benzoate and 4-HBA, it preferentially degrades benzoate, utilizing it to approximately completion before significantly metabolizing 4-HBAβa phenomenon known as diauxic growth[8][20][23][29][51][55][57][58]. When cells are grown on 4-HBA alone, the pcaK gene is highly expressed and 4-HBA uptake occurs efficiently at approximately 25 nmol per minute per mg of protein[8][20][23][29][51][55][57][58]. However, when cells are grown on a mixture of benzoate and 4-HBA, wild-type cells show a ten-fold reduction in 4-HBA uptake rates to approximately 2.5 nmol per minute per mg of protein, while benR mutant strains maintain high 4-HBA uptake rates even in the presence of benzoate[8][20][23][29][51][55][57][58].
The mechanism of benzoate-mediated repression of pcaK appears to involve an indirect regulatory pathway rather than direct BenR binding to the pcaK promoter region[8][20][23][29][51][55][57][58]. While BenR can be shown to directly activate the benABC promoter in E. coli reporter assays, attempts to demonstrate direct BenR-mediated repression of pcaK in such heterologous systems have been unsuccessful[8][20][23][29][51][55][57][58]. This suggests that the repressive effect may require auxiliary factors present in P. putida but absent in E. coli, or that the repression occurs at a post-transcriptional level. One possibility involves the global regulator Crc, which has been shown to inhibit the translation of benR mRNA and thereby reduce BenR protein levels when preferred carbon sources are available[27][60].
As a prokaryotic transcriptional regulator, BenR functions in the bacterial cytoplasm where it interacts with chromosomal DNA and the RNA polymerase enzyme complex[8][20][23][29][51][55][57][58]. Unlike eukaryotic proteins, BenR does not require nuclear import mechanisms and is synthesized directly in the cytoplasm where the DNA substrate is located. The protein localizes to specific regions of the bacterial chromosome where the benA and other target promoters are located, concentrating its regulatory activity on the genes that require coordinated expression in response to benzoate.
The DNA-binding function of BenR resides in its C-terminal domain, which contains a conserved helix-turn-helix (HTH) motif characteristic of the AraC/XylS family[19][22]. The HTH motif inserts directly into the major groove of the DNA double helix, allowing BenR to make specific contacts with the bases lining this groove and with the sugar-phosphate backbone[19][22]. The protected region in the benA promoter identified through DNase I footprinting analysis spans approximately 20 base pairs and is characterized by a direct repeat sequence within this footprint[8][20][23][29][51][55][57][58].
The binding of BenR to its target sequences occurs with high specificity. Comparisons of multiple AraC/XylS family binding sites have revealed that these regulators recognize short, conserved DNA motifs within their target promoters[19][22]. For BenR, the binding site in the benA promoter shows a striking similarity to the previously characterized XylS binding site on the TOL plasmid meta-cleavage pathway promoter, confirming that these two regulators recognize fundamentally similar DNA sequences despite having diverged substantially in other aspects of their sequences and regulatory properties[8][20][23][29][51][55][57][58].
The benzoate degradation genes regulated by BenR are components of the Ξ²-ketoadipate pathway, a highly conserved aromatic compound degradation pathway that is widely distributed in soil bacteria and fungi[41][54]. This pathway represents a biochemically elegant solution to the problem of breaking down aromatic compounds, which are thermodynamically and kinetically stable compared to aliphatic molecules. The Ξ²-ketoadipate pathway is organized into two branches that converge at a central intermediate, enabling efficient degradation of diverse aromatic compounds through the use of shared enzymes for the later steps.
The catechol branch of the Ξ²-ketoadipate pathway, to which benzoate degradation contributes, converts catechol (and catechol derivatives produced from various aromatic precursors) into acetyl-CoA and succinate through a series of enzymatic transformations[37][41][54]. Benzoate is converted to catechol via the BenR-regulated benABC genes in the first step, and this catechol then enters the central catechol branch enzymes encoded by the cat genes (specifically catA, catB, and catC) to be further metabolized[27][37][41][54][60].
The metabolic products generated during benzoate degradation serve as inducers for downstream pathway genes, creating an inducible metabolic cascade[27][37][41][54][60]. Benzoate induces expression of the benABC genes through BenR; these genes produce enzymes that transform benzoate to catechol. Catechol is then cleaved to cis,cis-muconate by the catechol 1,2-dioxygenase enzyme (CatA), and this cis,cis-muconate metabolite serves as the inducer for the downstream cat and pca gene clusters[27][37][41][54][60]. Finally, Ξ²-ketoadipate, the product of the cat pathway enzymes, induces expression of the pca genes necessary for the final steps of the pathway leading to tricarboxylic acid cycle intermediates[27][37][41][54][60].
This hierarchical induction system ensures that enzymes are synthesized only when their substrates become available, representing an economical utilization of cellular resources. The BenR protein, functioning at the apex of this regulatory hierarchy, serves as the critical control point that determines whether the entire pathway is activated in response to benzoate availability.
The AraC/XylS family of transcriptional regulators represents one of the largest families of prokaryotic regulatory proteins, containing more than 100 characterized members[19][22][54]. These regulators are broadly distributed across bacterial species and participate in the regulation of three major categories of biological processes: carbon metabolism, stress response, and pathogenesis[19][22][54]. The benzoate degradation pathway, particularly the regulation by BenR, exemplifies the metabolic regulatory functions of this family.
Members of the AraC/XylS family share a characteristic protein architecture consisting of two functional domains with distinct evolutionary histories. The conserved C-terminal domain (approximately 99 amino acids) contains the DNA-binding helix-turn-helix motif and related DNA-binding determinants[19][22]. This conserved region exhibits strong amino acid sequence homology across different family members, reflecting the need for precise DNA recognition and interaction with the core transcriptional machinery[19][22]. In contrast, the variable N-terminal domain shows much greater sequence divergence between family members and functions in regulatory specificity, including dimerization, oligomerization, and recognition of diverse effector molecules[19][22].
The existence of BenR (an AraC/XylS-type regulator) and BenM (a LysR-type regulator) in different bacterial species, both regulating benzoate degradation, exemplifies convergent evolution of regulatory mechanisms[33][43][54][56][59]. In Acinetobacter sp. strain ADP1, the benzoate degradation genes are regulated by BenM, a LysR-type transcriptional activator that exhibits fundamentally different structural properties and operates according to distinct regulatory principles compared to BenR[33][43][54][56][59].
BenM recognizes two distinct effector molecules (benzoate and cis,cis-muconate) and exhibits synergistic activation when both effectors are simultaneously present, producing transcriptional output levels that exceed the additive effects of each individual effector[21][33][36][43][56][59]. This dual-effector synergy provides a more sophisticated regulatory response than the single-effector system employed by BenR. The BenM protein structure includes interdomain pockets for binding both effectors, and the synergistic effect appears to arise from conformational changes that enhance DNA binding and RNA polymerase interaction when both compounds are bound[21][36][59]. In contrast, BenR responds primarily to benzoate as a single effector molecule.
Despite these mechanistic differences, both regulatory systems achieve the same fundamental outcome: activation of benzoate degradation genes in response to benzoate availability. This convergent evolution suggests that the specific bacterial lineages have independently optimized the regulation of a ubiquitous metabolic pathway using the protein scaffolds available within their respective evolutionary frameworks.
The specificity of BenR for benzoate has been demonstrated through studies comparing the induction of benA expression by different aromatic compounds and their analogues[8][20][23][29][51][55][57][58]. Benzoate serves as the physiological inducer of BenR, while closely related compounds show different induction efficiencies or fail to induce at all. The recognition of benzoate as the specific effector appears to involve specific interactions between benzoate and hydrophobic and hydrogen-bonding residues within the N-terminal effector-binding domain of BenR.
The precision of this recognition system ensures that BenR responds specifically to the intended substrate rather than to structurally similar molecules that might be present in the environment. This specificity prevents wasteful activation of benzoate degradation genes in response to structurally related compounds that the cell cannot efficiently metabolize, thereby maintaining metabolic economy.
Studies with the plasmid-encoded XylS regulator, which shares substantial homology with BenR, have demonstrated that while XylS responds to benzoate, it does not respond equally to all benzoate analogues[8][20][23][29][51][55][57][58]. For example, 3-methylbenzoate (meta-methylbenzoate) shows reduced ability to induce XylS-regulated gene expression compared to benzoate itself. This differential recognition suggests that the effector-binding pocket of these regulators exhibits relatively strict structural constraints on the accommodated ligand. The fact that BenR, despite its homology to XylS, shows substantially similar substrate preferences indicates that the effector-binding region has been conserved to maintain recognition specificity for the natural substrate, benzoate.
The activity of BenR is subject to post-transcriptional regulation by the global regulator Crc (catabolite repression control protein), which modulates the expression levels of aromatic compound degradation genes in response to the presence of preferred carbon sources[27][60]. Crc functions as a post-transcriptional repressor that inhibits the translation of the benR mRNA, thereby reducing BenR protein levels below those necessary for full induction of the benABCD promoter[27][60].
When cells are grown in the presence of glucose or other preferred carbon sources, Crc levels are elevated and the translation of benR mRNA is inhibited, preventing synthesis of new BenR protein molecules[27][60]. This leads to a rapid decrease in BenR protein concentration through normal protein degradation, which in turn causes a substantial reduction in benABCD mRNA levels (approximately 70-fold reduction)[27][60]. The reduced levels of benzoate dioxygenase enzymes mean that even if benzoate is present in the medium, the rate of benzoate transformation to catechol is severely limited[27][60].
This regulatory mechanism represents a hierarchical utilization strategy wherein cells preferentially consume preferred carbon sources (such as glucose or succinate) before shifting to aromatic compounds like benzoate. The Crc-mediated inhibition of BenR translation thus provides a mechanism for carbon source hierarchy or diauxic growth, wherein cells display biphasic growth curves with distinct growth rates on different carbon sources.
In addition to its role in activating the ben genes, BenR has been reported to interact with and regulate the expression of other genes involved in aromatic compound metabolism. The most extensively characterized example involves the regulation of the Pm meta-cleavage pathway promoter from the TOL plasmid[8][20][23][29][51][55][57][58]. This cross-regulation indicates that BenR recognizes a degenerate DNA sequence motif that is present in multiple chromosomal and plasmid-encoded promoters involved in aromatic compound degradation.
The functional characterization of BenR has relied heavily on classical microbial genetics approaches. The construction of benR null mutants through random transposon mutagenesis or targeted deletion using the Red system (recombination-mediated genetic engineering) has provided definitive evidence for the essential role of BenR in benzoate metabolism[8][20][23][29][51][55][57][58]. These benR mutant strains display an inability to grow on benzoate as the sole carbon source, demonstrating that BenR is not merely regulatory but is absolutely required for benzoate utilization. The complementation of these mutants with a plasmid-borne benR gene restores growth on benzoate, confirming that the phenotype results from loss of BenR function rather than from polar effects or other indirect consequences of the mutagenesis[8][20][23][29][51][55][57][58].
The lacZ transcriptional fusion approach has been instrumental in characterizing BenR function at the molecular level. The construction of fusions between the benA promoter and the promoterless lacZ gene allows quantitative measurement of promoter activity through Ξ²-galactosidase enzyme assays[8][20][23][29][51][55][57][58]. These assays reveal that benzoate induces benA-lacZ expression approximately 15-fold, and this induction is completely abolished in benR mutant backgrounds, confirming that BenR is specifically required for benzoate-induced expression[8][20][23][29][51][55][57][58].
DNase I footprinting experiments have directly visualized the binding of BenR to specific sequences within the benA promoter region[8][20][23][29][51][55][57][58]. This technique involves incubation of the regulatory protein with labeled DNA, followed by partial digestion with DNase I. Regions of DNA protected by protein binding are resistant to cleavage and appear as gaps ("footprints") in the ladder of DNA fragments generated[8][20][23][29][51][55][57][58]. The identified BenR binding site contains a direct repeat sequence that matches the previously characterized XylS binding site, providing molecular evidence for the functional homology between these two regulators[8][20][23][29][51][55][57][58].
Expression of the benA genes in E. coli cells harboring a benA-lacZ fusion has demonstrated that BenR alone is sufficient to activate the benA promoter in this heterologous bacterial species[8][20][23][29][51][55][57][58]. Overexpression of benR from a T7 inducible promoter in E. coli BL21(DE3) cells results in a remarkable 25-fold increase in Ξ²-galactosidase expression, indicating that BenR possesses intrinsic transcriptional activation capacity that functions even in the absence of P. putida-specific factors[8][20][23][29][51][55][57][58].
The BenR regulatory system provides a valuable model for understanding how bacteria sense and respond to specific organic molecules in their environment. The specificity of BenR for benzoate as an effector, combined with its ability to directly activate target promoters and simultaneously repress competing metabolic pathways, exemplifies the sophisticated regulatory mechanisms that have evolved to control complex metabolic networks. Study of BenR has contributed substantially to our understanding of how transcriptional regulatory proteins integrate sensory information about substrate availability with the expression of metabolic enzymes.
Understanding the regulation of benzoate degradation genes through BenR has important implications for bioremediation of aromatic hydrocarbon contamination. Benzene and other aromatic compounds are significant groundwater contaminants, and Pseudomonas species are frequently employed in bioremediation efforts[6]. The fact that benzoate and related compounds can be readily degraded by Pseudomonas putida under aerobic conditions has made this bacterium a focus of bioremediation research[6].
The discovery that BenR is critical for expressing the enzymes necessary for benzoate degradation suggests that optimization of BenR expression or activity might enhance the degradation capacity of engineered Pseudomonas strains[6]. Furthermore, understanding the regulation of benzoate degradation genes is essential for engineering bacterial strains with enhanced degradation capacity for environmental contaminants.
The benzoate degradation pathway, controlled by BenR and related regulators, plays an important role in carbon cycling in soil environments where benzene, benzoate, and related aromatic compounds are produced through the decomposition of plant material (particularly from lignin metabolism) and petroleum products[41][54]. Bacteria possessing functional BenR systems are therefore likely to have a competitive advantage in soil environments where aromatic compounds from these sources are available.
The benR gene encodes a sophisticated transcriptional regulatory protein that integrates multiple levels of metabolic control. At the primary level, BenR functions as a benzoate-responsive transcriptional activator that directly binds to specific DNA sequences in the benABC promoter region and stimulates transcription of the genes encoding benzoate-metabolizing enzymes. Beyond this primary function, BenR exhibits remarkable regulatory versatility, including the ability to activate the meta-cleavage pathway genes on the TOL plasmid and to mediate repression of competing metabolic pathways such as 4-HBA degradation.
The structural homology between BenR and the plasmid-encoded XylS protein, combined with their ability to activate both chromosomal and plasmid-encoded promoters, indicates that these proteins recognize fundamentally similar DNA sequences despite having undergone substantial divergence in other properties. However, BenR's reliance on a single effector molecule (benzoate) contrasts with the dual-effector synergistic mechanism exhibited by BenM in Acinetobacter species, demonstrating that different bacterial lineages have evolved distinct regulatory sophistication for addressing the same metabolic challenge.
Future research directions should include structural studies of BenR in complex with DNA and benzoate to elucidate the precise mechanism of allosteric activation and DNA binding at atomic resolution. The integration of BenR regulation with post-transcriptional controls exerted by the Crc global regulator merits further investigation to understand how multiple regulatory layers coordinate to establish metabolic hierarchies. Finally, the exploitation of BenR and related benzoate degradation systems for biotechnological applications in bioremediation and biocatalysis remains an active area of investigation in environmental biotechnology and metabolic engineering.
The benR gene of Pseudomonas putida encodes a transcriptional regulatory protein that represents a paradigm of sophisticated bacterial metabolic control. Functioning as an AraC/XylS-type transcriptional regulator, BenR directly activates the expression of benzoate-degrading enzymes in response to benzoate availability while simultaneously repressing competing metabolic pathways. The protein exhibits remarkable functional versatility, regulating both chromosomal genes and plasmid-encoded genes involved in aromatic compound metabolism. Through its integration into the Ξ²-ketoadipate pathway and its subject to post-transcriptional regulation by the Crc global regulator, BenR participates in hierarchical metabolic control systems that optimize bacterial resource utilization in response to changing environmental conditions. Understanding BenR provides insights into fundamental mechanisms of bacterial transcriptional regulation, the evolution of metabolic capabilities in soil microorganisms, and potential strategies for engineering enhanced bioremediation organisms.
provider: perplexity
model: sonar-pro
cached: false
start_time: '2025-11-05T15:34:08.002245'
end_time: '2025-11-05T15:34:19.950199'
duration_seconds: 11.95
provider_config:
timeout: 600
max_retries: 3
parameters:
allowed_domains: []
reasoning_effort: low
search_domain_filter: []
return_citations: true
temperature: 0.0
citation_count: 10
Research the benR (BenR) gene in PSEPK, focusing on its molecular function, biological processes, and cellular localization. Include information about protein domains, known interactions, and any disease associations.
No direct information about the benR (BenR) gene in PSEPK was found in the provided search results. However, I will synthesize available knowledge about the BenR gene from established literature and databases, focusing on its molecular function, biological processes, cellular localization, protein domains, known interactions, and disease associations. Where necessary, I will clearly indicate inferences and supplement with current scientific understanding.
BenR Gene: In bacterial systems, BenR is typically a transcriptional regulator belonging to the AraC/XylS family, involved in the regulation of genes for benzoate degradation. Its function in PSEPK (presumably a strain of Pseudomonas) is inferred to be similar, acting as a transcriptional activator for the benzoate catabolic pathway.
Molecular Function: BenR acts as a DNA-binding transcriptional activator. It recognizes specific promoter regions upstream of benzoate degradation genes and facilitates their transcription in response to the presence of benzoate or related aromatic compounds.
Protein Domains: BenR contains two main domains:
Structural Insights: Recent studies (2023-2024) have used AlphaFold and other prediction tools to model BenRβs structure, confirming the presence of the canonical AraC/XylS fold and identifying key residues involved in ligand recognition and DNA interaction (no direct citation in provided results; inferred from current literature).
Summary Table: BenR in PSEPK
| Feature | Description |
|---|---|
| Molecular Function | DNA-binding transcriptional activator (AraC/XylS family) |
| Biological Processes | Benzoate catabolism, transcriptional regulation |
| Cellular Localization | Cytoplasmic |
| Protein Domains | N-terminal ligand-binding, C-terminal DNA-binding (helix-turn-helix) |
| Known Interactions | DNA, RNA polymerase, effector molecules (benzoate) |
| Disease Associations | None (bacterial gene; relevance in bioremediation) |
| Applications | Bioremediation, synthetic biology |
If you require more specific data on BenR in PSEPK, including sequence, structure, or experimental results, please provide additional context or access to relevant genomic/proteomic databases.
BenR is a transcriptional activator that regulates aromatic compound degradation in response to benzoate [file:BenR-deep-research-claudecode.md "BenR is a chromosomally-encoded transcriptional regulator that controls expression of genes involved in aromatic compound degradation"]
BenR directly activates the benABCD operon encoding benzoate degradation enzymes:
The ben genes are part of the Ξ²-ketoadipate (ortho-cleavage) pathway [file:BenR-deep-research-perplexity.md "The genes regulated by BenR are components of the Ξ²-ketoadipate pathway"]
Pathway: Benzoate β Benzoate-cis-diol β Catechol β cis,cis-muconate β Ξ²-ketoadipate β Acetyl-CoA + Succinyl-CoA
BenR regulates at least three aromatic degradation pathways [file:BenR-deep-research-claudecode.md "BenR regulates at least three distinct aromatic acid degradation pathways"]:
This creates hierarchical substrate utilization - cells preferentially degrade benzoate over 4-HBA [file:BenR-deep-research-claudecode.md "P. putida preferentially degrades benzoate"]
BenR is subject to translational repression by Crc (catabolite repression control) [file:BenR-deep-research-claudecode.md "BenR itself is subject to regulation by Crc"]:
Cytoplasm [file:BenR-uniprot.txt "SUBCELLULAR LOCATION: Cytoplasm"] - where it interacts with chromosomal DNA and RNA polymerase
BenR homologs exist across Pseudomonas species [file:BenR-deep-research-claudecode.md "BenR homologs exist across Pseudomonas species"]:
- P. putida KT2440 (this gene)
- P. fluorescens MB214
- P. aeruginosa
CRITICAL: The UniProt function statement is INCORRECT:
- States: "Regulatory protein of the TOL plasmid xyl operons. XylS activates the xylXYZLTEGFJQKIH operon"
- This describes XylS, NOT BenR
- BenR regulates benABCD, not xyl genes
- This appears to be automated annotation error based on family similarity
Based on deep research files (PMIDs cited in those files):
- Collier et al. 2000 - Primary characterization [BenR-deep-research-claudecode.md]
- Gallegos et al. 1997 - AraC/XylS family review
- Marques et al. 2008 - XylS effector mechanism
- Moreno & Rojo 2008 - Crc regulation of BenR
- Perez-Pantoja et al. 2018 - Systems-level benzoate metabolism
- Wolfe et al. 2002 - Benzoate dioxygenase mechanism
- Voyvodic et al. 2019 - Cell-free biosensors
- Shaw et al. 2012 - Promoter engineering
- van der Geize et al. 2006 - BenR in P. fluorescens
- Durant et al. 2014 - Differential Pben promoter response
Why GO:0043640/GO:0043639 but NOT GO:0042952 or GO:0019336:
The Ξ²-ketoadipate pathway involves multiple regulatory modules:
- BenR regulates: benABCD (benzoate β catechol) = GO:0043640
- CatR regulates: cat genes (catechol β beta-ketoadipate)
- PcaR regulates: pca genes (beta-ketoadipate β TCA intermediates)
BenR only controls the entry point, not the entire pathway. Annotating with GO:0042952 (beta-ketoadipate pathway) would incorrectly imply BenR regulates the whole cascade. The specific benzoate terms accurately capture what BenR directly controls.
Similarly, GO:0019336 (phenol-containing compound catabolic process) is too broad - while catechol is a phenol, BenR's role is specifically in benzoate catabolism, not general phenol metabolism.
BenR is an effector-responsive transcriptional activator that:
1. Senses benzoate via N-terminal effector-binding domain
2. Activates transcription of benABCD operon encoding benzoateβcatechol conversion enzymes
3. Coordinates hierarchical utilization of aromatic compounds
4. Functions as part of Ξ²-ketoadipate pathway for aromatic compound degradation
5. Exhibits sophisticated multi-level regulation (effector-responsive + Crc translational control)
Primary molecular activity: DNA-binding transcription factor activity, activating genes in response to benzoate
Primary biological process: Regulation of aromatic compound (specifically benzoate) catabolic processes
Cellular component: Cytoplasm (bacterial nucleoid region)
Source: BenR-deep-research-bioreason-rl.md
The BioReason functional summary describes BenR as:
A soluble bacterial transcriptional regulator that uses an N-terminal regulatory module and a C-terminal helix-turn-helix DNA-binding domain to control operons involved in carbon monoxide and formate catabolism. By sensing intracellular cues and assembling into operator-bound complexes, it modulates promoter accessibility and RNA polymerase engagement to repress pathway genes under non-inducing conditions, operating within the cytoplasm and coordinating environmental responses with transcriptional output.
The domain architecture description is correct: N-terminal AraC-type ligand-binding domain + C-terminal HTH DNA-binding domain. The general transcriptional regulator function is correct. However, there are significant errors:
Wrong pathway target: The summary says BenR controls "carbon monoxide and formate catabolism." This is incorrect. BenR regulates the benABCD operon for benzoate degradation via the beta-ketoadipate pathway. The UniProt summary for this protein (which BioReason itself includes) says "Involved in the regulation of carbon monoxide (CO) and formate catabolism" -- this appears to be a UniProt annotation error that BioReason propagated without correction.
Wrong mode of regulation: The summary emphasizes repression ("repress pathway genes under non-inducing conditions"). BenR is primarily a transcriptional activator that requires benzoate as an allosteric effector for optimal activation of the benABCD operon. The curated review assigns GO:0141097 (ligand-modulated transcription activator activity) as the core molecular function.
Cytoplasmic localization: Correctly identified.
AraC/XylS family membership: Correctly identified, with good domain architecture description.
Comparison with interpro2go:
The curated review's interpro2go annotations include DNA binding (GO:0003677, accepted), DNA-binding transcription factor activity (GO:0003700, accepted), and sequence-specific DNA binding (GO:0043565, accepted). BioReason recapitulates these interpro2go annotations and adds the pathway context -- but adds it incorrectly. The model's GO term predictions include "DNA-binding transcription activator activity" (GO:0001216) and "positive regulation of DNA-templated transcription" (GO:0045893), which correctly predict activator function. However, the narrative summary describes a repressor, contradicting the model's own GO predictions. This is another case of narrative-GO prediction disconnect.
The trace demonstrates good structural reasoning from the AraC/XylS domain architecture. However, it appears to uncritically adopt the UniProt summary about CO/formate catabolism, which is incorrect for this specific gene. The thinking trace also mentions "IHF, H-NS" as potential partners, which is speculative but not unreasonable for an AraC-family regulator.
Dataset: P. putida putidaPRECISE321 (Lim et al., 2022, Metabolic Engineering 72:297-310)
- 321 transcriptome profiles analyzed with Independent Component Analysis
- 84 iModulons identified explaining 75.7% of variance
| Metric | Value | Interpretation |
|---|---|---|
| iModulon Size | 10 genes | Core regulon members |
| Known Regulon Size | 4 genes | From literature |
| True Positives | 4 genes | Known targets correctly identified |
| Precision | 0.40 (40%) | 4/10 genes are validated targets |
| Recall | 1.00 (100%) | All known targets captured |
| F1 Score | 0.57 | Balanced measure |
| Category | Carbon - Aromatics catabolism | |
| Function | Aromatic acid catabolism | |
| Regulation Type | New_containing | Contains novel predicted targets |
| Rank | Locus | Gene | Weight | Product | In Review? |
|---|---|---|---|---|---|
| 1 | PP_3162 | benB | 0.2592 | benzoate 1,2-dioxygenase subunit beta | β YES - Core target |
| 2 | PP_3163 | benC | 0.2422 | benzoate 1,2-dioxygenase electron transfer component | β YES - Core target |
| 3 | PP_3166 | catA-II | 0.2308 | catechol 1,2-dioxygenase | β οΈ INDIRECT - Downstream pathway |
| 4 | PP_3164 | benD | 0.2286 | 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase | β YES - Core target |
| 5 | PP_3161 | benA | 0.2258 | benzoate 1,2-dioxygenase subunit alpha | β YES - Core target |
| 6 | PP_3165 | benK | 0.1709 | benzoate MFS transporter | β YES - Mentioned in review |
| 7 | PP_3714 | catC | 0.1573 | Muconolactone Delta-isomerase | β οΈ INDIRECT - Ξ²-ketoadipate pathway |
| 8 | PP_3713 | catA-I | 0.1460 | catechol 1,2-dioxygenase | β οΈ INDIRECT - Alternate catechol pathway |
| 9 | PP_3167 | benE-II | 0.1445 | benzoate transport protein | β YES - Mentioned in review |
| 10 | PP_3715 | catB | 0.1389 | Muconate cycloisomerase 1 | β οΈ INDIRECT - Ξ²-ketoadipate pathway |
| 11 | PP_3765 | mvaT | 0.1175 | H-NS family protein MvaT | β NEW - Global regulator |
| 12 | PP_3168 | nicP-I | 0.0974 | porin-like protein | β PARTIAL - benF equivalent? |
| 13 | PP_3792 | --- | 0.0568 | conserved protein of unknown function | β NEW - Unknown |
The review correctly identifies the benABCD operon as direct BenR targets:
- benA (PP_3161) - weight 0.2258 - β
Rank 5
- benB (PP_3162) - weight 0.2592 - β
Rank 1 (highest!)
- benC (PP_3163) - weight 0.2422 - β
Rank 2
- benD (PP_3164) - weight 0.2286 - β
Rank 4
These are the 4 true positives with the highest weights (0.23-0.26), confirming they are the core BenR regulon.
The review mentions:
- benK (PP_3165) - Benzoate permease - β
Rank 6, weight 0.1709
- benE (PP_3167) - Membrane protein - β
Rank 9, weight 0.1445
- benF equivalent might be nicP-I (PP_3168) - Rank 12, weight 0.0974
The iModulon includes catechol degradation genes (cat genes):
- catA-II (PP_3166) - weight 0.2308 - Rank 3!
- catA-I (PP_3713) - weight 0.1460 - Rank 8
- catB (PP_3715) - weight 0.1389 - Rank 10
- catC (PP_3714) - weight 0.1573 - Rank 7
Review statement: "BenR only controls the entry point, not the entire pathway. BenR does not regulate cat genes (regulated by CatR)"
iModulon finding: cat genes show coordinated expression with ben genes!
Interpretation:
1. The review is correct that CatR is the direct regulator of cat genes
2. BUT: cat genes co-vary with ben genes across 321 conditions
3. This suggests functional coupling - when benzoate is present and ben genes are active, cat genes are also induced (possibly via CatR responding to catechol accumulation)
4. ICA captures this coordinated regulation even if not direct
MvaT (H-NS-like global regulator) shows weight 0.1175 in BenR iModulon.
Possible explanations:
1. MvaT might modulate BenR-regulated genes
2. MvaT expression might be affected by aromatic compound stress
3. Could be false positive (contributes to low precision)
Not mentioned in review - this is a novel association.
Recall = 100%: All 4 known BenR targets (benABCD) are captured β
Precision = 40%: Only 4/10 genes in iModulon are validated direct targets β οΈ
Why low precision?
- cat genes included (functionally coupled but not directly regulated)
- MvaT and unknown genes included
- ICA captures functional modules not just direct regulons
Is this bad?
- For understanding transcriptional networks β Lower precision expected
- For understanding metabolic pathways β Higher precision (captures functional units)
- The F1 score of 0.57 indicates well-matched despite imperfect precision
Both perspectives are correct at different levels
β οΈ Review: "Regulates multiple pathways (benzoate, methylbenzoate, 4-HBA repression)"
The BenR gene review is strongly validated by iModulonDB data:
| Metric | Value |
|---|---|
| Genes in review's core_functions | 5 (benABCDK) |
| Genes in iModulon (weight > 0.05) | 13 |
| Overlap | 5/5 review genes in iModulon β |
| Confirmed targets | 4/4 (benABCD) β |
| Transport genes | 3/3 (benKE + nicP) β |
| Novel associations | 5 (cat genes + MvaT + unknowns) |
| Overall consistency | π’ HIGH |
id: Q88I42
gene_symbol: BenR
product_type: PROTEIN
status: COMPLETE
taxon:
id: NCBITaxon:160488
label: Pseudomonas putida KT2440
description: BenR is an AraC/XylS family transcriptional activator that regulates aromatic compound degradation
in response to benzoate. It directly activates expression of the benABCD operon encoding benzoate 1,2-dioxygenase
and related enzymes that catalyze the conversion of benzoate to catechol via the Ξ²-ketoadipate pathway.
BenR exhibits effector-responsive regulation, requiring benzoate binding to its N-terminal domain for
optimal transcriptional activation. It functions as a master regulator coordinating multiple aromatic
degradation pathways and is essential for benzoate utilization.
existing_annotations:
- term:
id: GO:0003677
label: DNA binding
evidence_type: IEA
original_reference_id: GO_REF:0000043
review:
summary: This annotation is correct and supported by the HTH araC/xylS-type DNA-binding domain (residues
215-316) and DNase I footprinting evidence showing direct binding to benA promoter sequences. The
annotation accurately reflects a core molecular function of BenR.
action: ACCEPT
supported_by:
- reference_id: file:PSEPK/BenR/BenR-deep-research-claudecode.md
supporting_text: BenR contains HTH DNA-binding domain and directly binds to benA promoter sequences
as demonstrated by DNase I footprinting
- reference_id: file:PSEPK/BenR/BenR-uniprot.txt
supporting_text: HTH araC/xylS-type domain at residues 215-316
- reference_id: file:PSEPK/BenR/BenR-deep-research-perplexity-lite.md
supporting_text: See deep research file for comprehensive analysis
- term:
id: GO:0003700
label: DNA-binding transcription factor activity
evidence_type: IEA
original_reference_id: GO_REF:0000002
review:
summary: This annotation correctly captures the core function of BenR as a transcription factor. However,
a more specific child term 'DNA-binding transcription activator activity' (GO:0001216) or 'ligand-modulated
transcription activator activity' (GO:0141097) would be more precise given that BenR is an activator
(not repressor) and is regulated by benzoate binding.
action: MODIFY
proposed_replacement_terms:
- id: GO:0001216
label: DNA-binding transcription activator activity
- id: GO:0141097
label: ligand-modulated transcription activator activity
supported_by:
- reference_id: file:PSEPK/BenR/BenR-deep-research-claudecode.md
supporting_text: BenR is a transcriptional activator that induces benA-lacZ expression 15-fold in
response to benzoate
- reference_id: file:PSEPK/BenR/BenR-deep-research-perplexity.md
supporting_text: BenR requires benzoate as allosteric effector for efficient transcriptional activation
- term:
id: GO:0005737
label: cytoplasm
evidence_type: IEA
original_reference_id: GO_REF:0000044
review:
summary: Correct localization for a bacterial transcriptional regulator. BenR functions in the cytoplasm
where it interacts with chromosomal DNA and RNA polymerase. This is a core cellular component annotation.
action: ACCEPT
supported_by:
- reference_id: file:PSEPK/BenR/BenR-uniprot.txt
supporting_text: Subcellular location - cytoplasm
- reference_id: file:PSEPK/BenR/BenR-deep-research-perplexity.md
supporting_text: BenR functions in cytoplasm interacting with chromosomal DNA and RNA polymerase
- term:
id: GO:0006355
label: regulation of DNA-templated transcription
evidence_type: IEA
original_reference_id: GO_REF:0000120
review:
summary: This annotation is technically correct but extremely general. While BenR does regulate transcription,
this term doesn't capture the specific biological role in benzoate catabolism or aromatic compound
degradation. This should be kept but marked as non-core, with more specific biological process terms
added to capture the actual metabolic context.
action: KEEP_AS_NON_CORE
supported_by:
- reference_id: file:PSEPK/BenR/BenR-deep-research-claudecode.md
supporting_text: BenR regulates transcription of benABCD operon
- term:
id: GO:0009893
label: positive regulation of metabolic process
evidence_type: IEA
original_reference_id: GO_REF:0000117
review:
summary: This annotation is correct (BenR activates metabolic genes) but very general. It doesn't
specify which metabolic process. This is an appropriate high-level annotation but should be supplemented
with more specific terms for aromatic/benzoate catabolism. The annotation is technically accurate
but lacks biological specificity.
action: KEEP_AS_NON_CORE
supported_by:
- reference_id: file:PSEPK/BenR/BenR-deep-research-claudecode.md
supporting_text: BenR activates benzoate degradation genes which are metabolic enzymes
- term:
id: GO:0043565
label: sequence-specific DNA binding
evidence_type: IEA
original_reference_id: GO_REF:0000002
review:
summary: This annotation is correct and more specific than GO:0003677. BenR recognizes specific direct
repeat sequences (TGCA-N6-GGNTA motifs) in the benA promoter and related promoters, as demonstrated
by DNase I footprinting. This is a core molecular function.
action: ACCEPT
supported_by:
- reference_id: file:PSEPK/BenR/BenR-deep-research-claudecode.md
supporting_text: BenR recognizes direct repeat sequences (TGCA-N6-GGNTA) in benA promoter by DNase
I footprinting
- reference_id: file:PSEPK/BenR/BenR-deep-research-perplexity.md
supporting_text: DNase I footprinting shows direct binding to benA promoter protecting specific
DNA sequences
- term:
id: GO:0043640
label: benzoate catabolic process via hydroxylation
evidence_type: IEA
original_reference_id: file:PSEPK/BenR/BenR-deep-research-claudecode.md
review:
summary: This is the specific biological process regulated by BenR. The benABCD operon encodes benzoate
1,2-dioxygenase which hydroxylates benzoate to cis-1,2-dihydroxybenzoate followed by dehydrogenation
to catechol. This annotation should be added as NEW to capture the core biological function.
action: NEW
supported_by:
- reference_id: file:PSEPK/BenR/BenR-deep-research-claudecode.md
supporting_text: BenR activates benABCD operon. BenABC is benzoate 1,2-dioxygenase converting benzoate
to benzoate-cis-diol, BenD is cis-diol dehydrogenase converting to catechol
- reference_id: file:PSEPK/BenR/BenR-deep-research-perplexity.md
supporting_text: BenR directly activates benzoate degradation genes via the hydroxylation pathway
- term:
id: GO:0043639
label: benzoate catabolic process
evidence_type: IEA
original_reference_id: file:PSEPK/BenR/BenR-deep-research-perplexity.md
review:
summary: BenR regulates benzoate catabolism - this is its primary biological role. BenR null mutants
cannot grow on benzoate as sole carbon source. This should be added as a NEW core annotation.
action: NEW
supported_by:
- reference_id: file:PSEPK/BenR/BenR-deep-research-claudecode.md
supporting_text: BenR is essential for benzoate utilization - null mutants cannot grow on benzoate
- reference_id: file:PSEPK/BenR/BenR-deep-research-perplexity.md
supporting_text: BenR null mutants unable to grow on benzoate - essential for benzoate metabolism
references:
- id: GO_REF:0000002
title: Gene Ontology annotation through association of InterPro records with GO terms.
findings:
- statement: InterPro correctly identifies HTH araC/xylS-type domain and associates it with DNA-binding
transcription factor activity
- id: GO_REF:0000043
title: Gene Ontology annotation based on UniProtKB/Swiss-Prot keyword mapping
findings:
- statement: UniProt keywords correctly identify DNA-binding function based on domain analysis
- id: GO_REF:0000044
title: Gene Ontology annotation based on UniProtKB/Swiss-Prot Subcellular Location vocabulary mapping,
accompanied by conservative changes to GO terms applied by UniProt.
findings:
- statement: Cytoplasmic localization is correctly inferred for bacterial transcription factor
- id: GO_REF:0000117
title: Electronic Gene Ontology annotations created by ARBA machine learning models
findings:
- statement: ARBA correctly predicts positive regulation of metabolic process based on protein family
- id: GO_REF:0000120
title: Combined Automated Annotation using Multiple IEA Methods.
findings:
- statement: Combined methods correctly identify transcriptional regulatory function
- id: file:PSEPK/BenR/BenR-deep-research-claudecode.md
title: Research Report - BenR Gene Function in Pseudomonas putida
findings:
- statement: BenR is chromosomally-encoded transcriptional regulator controlling aromatic compound degradation
- statement: Member of AraC/XylS family with 62% identity to XylS
- statement: Responds to benzoate as inducing effector molecule
- statement: Activates benABCD operon (benzoate 1,2-dioxygenase and related genes)
- statement: Essential for benzoate utilization - null mutants cannot grow on benzoate
- statement: benA-lacZ fusions show 15-fold induction by benzoate, abolished in benR mutants
- statement: Recognizes direct repeat sequences (TGCA-N6-GGNTA) in benA promoter by DNase I footprinting
- statement: N-terminal domain (~200 aa) responsible for effector binding and dimerization
- statement: C-terminal domain (~99 aa, residues 215-316) contains HTH DNA-binding motif
- statement: Regulates multiple pathways - benzoate degradation, methylbenzoate degradation, and represses
4-HBA transport
- statement: Part of Ξ²-ketoadipate ortho-cleavage pathway
- statement: Subject to translational repression by Crc global regulator
- statement: Effector-induced conformational change releases intramolecular inhibition allowing DNA
binding
- statement: Functions as dimer in active state
- id: file:PSEPK/BenR/BenR-deep-research-perplexity.md
title: Comprehensive Functional Analysis of BenR - Perplexity Deep Research
findings:
- statement: BenR is 318 amino acids, ~36.4 kDa
- statement: Primary function is transcriptional activation of benABCD operon
- statement: Requires benzoate as allosteric effector molecule for efficient activation
- statement: Overexpression in E. coli shows 25-fold activation demonstrating intrinsic activity
- statement: DNase I footprinting shows direct binding to benA promoter protecting ~20 bp region
- statement: BenR null mutants unable to grow on benzoate - essential for benzoate metabolism
- statement: Activates chromosomal ben genes and plasmid-encoded meta-cleavage pathway genes
- statement: Indirectly represses pcaK (4-HBA permease) causing 10-fold reduction in 4-HBA uptake
- statement: Creates hierarchical substrate utilization favoring benzoate over 4-HBA
- statement: Crc binds 5' UTR of benR mRNA causing ~70-fold reduction in expression
- statement: Functions in cytoplasm interacting with chromosomal DNA and RNA polymerase
- statement: Convergent evolution with LysR-type BenM regulator in Acinetobacter
- id: file:PSEPK/BenR/BenR-uniprot.txt
title: UniProt entry Q88I42
findings:
- statement: Gene name benR, locus tag PP_3159
- statement: 318 amino acids
- statement: HTH araC/xylS-type domain at residues 215-316
- statement: Subcellular location - cytoplasm
- statement: NOTE - Function description appears incorrect, states "Regulatory protein of the TOL plasmid
xyl operons" which describes XylS not BenR
core_functions:
- description: BenR acts as an effector-responsive transcriptional activator that senses benzoate via
its N-terminal domain and activates transcription of the benABCD operon encoding benzoate 1,2-dioxygenase
(BenABC) and cis-diol dehydrogenase (BenD), which catalyze the conversion of benzoate to catechol
as part of the Ξ²-ketoadipate pathway for aromatic compound degradation
molecular_function:
id: GO:0141097
label: ligand-modulated transcription activator activity
directly_involved_in:
- id: GO:0043640
label: benzoate catabolic process via hydroxylation
- id: GO:0043639
label: benzoate catabolic process
locations:
- id: GO:0005737
label: cytoplasm
supported_by:
- reference_id: file:PSEPK/BenR/BenR-deep-research-claudecode.md
supporting_text: BenR activates benABCD operon in response to benzoate. BenABC is benzoate 1,2-dioxygenase
converting benzoate to benzoate-cis-diol, BenD is cis-diol dehydrogenase converting benzoate-cis-diol
to catechol
- reference_id: file:PSEPK/BenR/BenR-deep-research-perplexity.md
supporting_text: BenR requires benzoate as allosteric effector molecule for efficient activation of
benABCD operon
- description: Through sequence-specific DNA binding to direct repeat motifs in target promoters, BenR
coordinates hierarchical utilization of aromatic compounds by activating benzoate degradation genes
while indirectly repressing competing pathways such as 4-hydroxybenzoate metabolism
molecular_function:
id: GO:0043565
label: sequence-specific DNA binding
directly_involved_in:
- id: GO:0043639
label: benzoate catabolic process
locations:
- id: GO:0005737
label: cytoplasm
supported_by:
- reference_id: file:PSEPK/BenR/BenR-deep-research-claudecode.md
supporting_text: BenR recognizes TGCA-N6-GGNTA direct repeat sequences. BenR mediates hierarchical
substrate utilization by activating benzoate genes and repressing pcaK (4-HBA transport)
- reference_id: file:PSEPK/BenR/BenR-deep-research-perplexity.md
supporting_text: BenR indirectly represses pcaK causing 10-fold reduction in 4-HBA uptake, creating
hierarchical substrate preference
proposed_new_terms: []
suggested_questions:
- question: What is the precise mechanism by which BenR indirectly represses pcaK expression for 4-hydroxybenzoate
transport?
- question: Are there additional transcriptional regulators beyond Crc that modulate BenR expression or
activity?
- question: What is the crystal structure of BenR bound to benzoate and DNA, revealing the molecular details
of effector-induced activation?
suggested_experiments:
- description: Determine the crystal structure of BenR in complex with benzoate and target DNA to reveal
the molecular mechanism of effector-induced conformational change and DNA binding specificity
experiment_type: X-ray crystallography or cryo-EM
hypothesis: Benzoate binding to the N-terminal domain causes a conformational change that releases intramolecular
inhibition of the C-terminal DNA-binding domain
- description: Use ChIP-seq to identify the complete BenR regulon - all genomic loci bound by BenR under
benzoate-induced conditions to map direct vs indirect targets
experiment_type: Chromatin immunoprecipitation followed by sequencing
hypothesis: BenR directly binds additional promoters beyond benABCD that coordinate aromatic compound
metabolism
- description: Perform in vitro transcription assays with purified BenR, RNA polymerase, and benA promoter
DNA to measure the dose-response of benzoate on transcriptional activation
experiment_type: In vitro transcription assay with varying benzoate concentrations
hypothesis: Benzoate binding to BenR increases its affinity for DNA and/or RNA polymerase in a dose-dependent
manner