pvdA

UniProt ID: Q88GC8
Organism: Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Review Status: COMPLETE
📝 Provide Detailed Feedback

Gene Description

PvdA is the likely KT2440 ortholog of the pyoverdine biosynthetic ornithine N5-monooxygenase. By homology to experimentally characterized PvdA proteins, it is an FAD- and NADPH-dependent enzyme that hydroxylates L-ornithine early in pyoverdine assembly, generating a precursor required for hydroxamate formation. In Pseudomonas putida KT2440, pyoverdine is the characterized siderophore produced under iron limitation, so PvdA is best interpreted as a dedicated pyoverdine-biosynthetic enzyme rather than as a general iron homeostasis factor.

Existing Annotations Review

GO Term Evidence Action Reason
GO:0006879 intracellular iron ion homeostasis
IEA
GO_REF:0000118
MODIFY
Summary: This TreeGrafter annotation points to the downstream physiological role of pyoverdine in iron acquisition, but it does not capture PvdA's direct function. PvdA is the dedicated ornithine N5-monooxygenase of the pyoverdine pathway, and KT2440 pyoverdine production under iron limitation is experimentally established at the strain level.
Reason: GO:0006879 is too broad and indirect for a pathway enzyme. The more precise direct process term is GO:0002049 pyoverdine biosynthetic process.
Proposed replacements: pyoverdine biosynthetic process
Supporting Evidence:
PMID:8106324
The enzyme L-ornithine N5-oxygenase catalyzes the hydroxylation of L-ornithine (L-Orn), which represents an early step in the biosynthesis of the peptidic moiety of the fluorescent siderophore pyoverdin in Pseudomonas aeruginosa.
PMID:19459056
Structural analysis of the pyoverdine produced by the closely related P. putida KT2440 showed that this strain produces an already characterised pyoverdine, but different from P. entomophila, and no evidence was found for the production of a second siderophore.
PMID:30346656
Fluorescent pseudomonads produce and secrete a siderophore termed pyoverdine to capture iron when it becomes scarce.
file:PSEPK/pvdA/pvdA-deep-research-manual.md
The current seeded annotation, `GO:0006879 intracellular iron ion homeostasis`, is biologically related but too broad for PvdA.
file:PSEPK/pvdA/pvdA-deep-research-falcon.md
PvdA functions in the **cytoplasmic phase** of **pyoverdine siderophore biosynthesis**, supplying a modified amino acid building block needed by the **NRPS assembly line**.
GO:0002049 pyoverdine biosynthetic process
ISS
PMID:8106324
Cloning and nucleotide sequence of the pvdA gene encoding th...
NEW
Summary: Proposed new BP annotation. PvdA catalyzes an early committed reaction in pyoverdine assembly, and loss of pvdA in homologous systems abolishes pyoverdine production unless the hydroxylated precursor is supplied.
Reason: This is the direct biological-process annotation for the enzyme and is more informative than the broad iron-homeostasis term. Falcon deep research confirms PvdA supplies a committed tailoring building block for the pyoverdine NRPS assembly line.
Supporting Evidence:
PMID:8106324
the pvdA mutant obtained by gene disruption also disclosed no pyoverdin synthesis, lacked L-Orn N5-oxygenase activity, was complemented by the cloned pvdA gene, and produced pyoverdin at wild-type levels when fed with the biosynthetic precursor L-N5-OH-Orn.
PMID:19459056
Structural analysis of the pyoverdine produced by the closely related P. putida KT2440 showed that this strain produces an already characterised pyoverdine, but different from P. entomophila, and no evidence was found for the production of a second siderophore.
file:PSEPK/pvdA/pvdA-deep-research-falcon.md
**pvdA encodes the enzyme catalyzing the N5-hydroxylation of L-ornithine** to produce **N5-hydroxyornithine**, which is subsequently **formylated by PvdF** to yield **N5-formyl-N5-hydroxyornithine (L-fOHOrn)**.
GO:0031172 ornithine N5-monooxygenase activity
ISS
PMID:17015659
Heterologous expression, purification, and characterization ...
NEW
Summary: Proposed new MF annotation. PvdA is the dedicated flavin-dependent ornithine N5-monooxygenase that initiates hydroxamate formation during pyoverdine synthesis.
Reason: This is the core catalytic activity of PvdA and the most informative molecular-function term for the KT2440 ortholog. The GO definition of GO:0031172 (L-ornithine + O2 + H+ = N5-hydroxy-L-ornithine + H2O) matches the reaction PvdA catalyzes, and falcon deep research places it in the Class B flavoprotein (FAD + O2 + NADPH) N-hydroxylating monooxygenase family. The UniProtKB-KW IEA term GO:0016491 oxidoreductase activity is a true but uninformative parent of this activity.
Supporting Evidence:
PMID:17015659
Formation of the iron-chelating hydroxamate functional group in pyoverdine requires the enzyme PvdA, a flavin-dependent monooxygenase that catalyzes the N(5) hydroxylation of l-ornithine.
PMID:21757711
The ornithine hydroxylase from Pseudomonas aeruginosa (PvdA) catalyzes the FAD-dependent hydroxylation of the side chain amine of ornithine, which is subsequently formylated to generate the iron-chelating hydroxamates of the siderophore pyoverdin.
file:PSEPK/pvdA/pvdA-deep-research-manual.md
The key missing molecular-function term is `GO:0031172 ornithine N5-monooxygenase activity`, supported by the biochemical and structural literature on characterized PvdA homologs.
file:PSEPK/pvdA/pvdA-deep-research-falcon.md
dependence on **FAD** as a flavin cofactor and **molecular oxygen** as the oxygen donor, proceeding through **C4a-peroxy/hydroperoxyflavin** intermediates that effect oxygen transfer to the substrate amine
GO:0005737 cytoplasm
ISS
PMID:22498339
High cellular organization of pyoverdine biosynthesis in Pse...
NEW
Summary: Proposed new CC annotation. Homolog studies place PvdA among the cytoplasmic enzymes of the pyoverdine pathway, although some membrane association and polar clustering have also been observed. Falcon deep research reinforces that pyoverdine biosynthesis initiates in the cytoplasm and that PvdA physically interacts with all four pyoverdine NRPSs in a membrane-associated multienzyme "siderosome" context.
Reason: Cytoplasm is the conservative and best-supported location to annotate the KT2440 ortholog. A plasma membrane term would overstate the current evidence for this strain, even though PAO1 homolog studies report partial membrane association via an N-terminal inner-membrane-anchoring region.
Supporting Evidence:
PMID:22498339
generate P.aeruginosa strains producing fluorescent fusions with PvdA, one of the initial enzymes in the biosynthetic pathway of PVDI in the cytoplasm
PMID:18757814
The inferred topological model resembled a eukaryotic reverse signal-anchor (type III) protein, with a single N-terminal domain anchored to the inner membrane, and the bulk of the protein spanning the cytosol.
file:PSEPK/pvdA/pvdA-deep-research-falcon.md
Pyoverdine biosynthesis initiates in the **cytoplasm**

Core Functions

PvdA is the KT2440 ornithine N5-monooxygenase. It uses FAD and NADPH to hydroxylate L-ornithine, generating a precursor required for pyoverdine hydroxamate formation during siderophore biosynthesis under iron limitation.

Directly Involved In:
Cellular Locations:
Supporting Evidence:
  • PMID:17015659
    Formation of the iron-chelating hydroxamate functional group in pyoverdine requires the enzyme PvdA, a flavin-dependent monooxygenase that catalyzes the N(5) hydroxylation of l-ornithine.
  • PMID:8106324
    The enzyme L-ornithine N5-oxygenase catalyzes the hydroxylation of L-ornithine (L-Orn), which represents an early step in the biosynthesis of the peptidic moiety of the fluorescent siderophore pyoverdin in Pseudomonas aeruginosa.
  • file:PSEPK/pvdA/pvdA-deep-research-falcon.md
    PvdA functions in the **cytoplasmic phase** of **pyoverdine siderophore biosynthesis**, supplying a modified amino acid building block needed by the **NRPS assembly line**.

References

TreeGrafter-generated GO annotations
Cloning and nucleotide sequence of the pvdA gene encoding the pyoverdin biosynthetic enzyme L-ornithine N5-oxygenase in Pseudomonas aeruginosa.
  • PvdA catalyzes ornithine hydroxylation early in pyoverdine biosynthesis
    "The enzyme L-ornithine N5-oxygenase catalyzes the hydroxylation of L-ornithine (L-Orn), which represents an early step in the biosynthesis of the peptidic moiety of the fluorescent siderophore pyoverdin in Pseudomonas aeruginosa."
  • pvdA loss abolishes pyoverdine synthesis and is rescued by N5-hydroxyornithine
    "the pvdA mutant obtained by gene disruption also disclosed no pyoverdin synthesis, lacked L-Orn N5-oxygenase activity, was complemented by the cloned pvdA gene, and produced pyoverdin at wild-type levels when fed with the biosynthetic precursor L-N5-OH-Orn."
Heterologous expression, purification, and characterization of an l-ornithine N(5)-hydroxylase involved in pyoverdine siderophore biosynthesis in Pseudomonas aeruginosa.
  • PvdA is a flavin-dependent monooxygenase that hydroxylates ornithine
    "Formation of the iron-chelating hydroxamate functional group in pyoverdine requires the enzyme PvdA, a flavin-dependent monooxygenase that catalyzes the N(5) hydroxylation of l-ornithine."
  • PvdA specifically uses NADPH and FAD cofactors
    "The enzyme is specific for NADPH and flavin adenine dinucleotide (FAD(+)) as cofactors, as it cannot utilize NADH and flavin mononucleotide."
Two structures of an N-hydroxylating flavoprotein monooxygenase: ornithine hydroxylase from Pseudomonas aeruginosa.
  • PvdA is a class B flavoprotein monooxygenase
    "PvdA belongs to the class B flavoprotein monooxygenases, which catalyze the oxidation of substrates using NADPH as the electron donor and molecular oxygen."
  • PvdA has Rossmann-like FAD and NADPH binding domains
    "PvdA has the two expected Rossmann-like dinucleotide-binding domains for FAD and NADPH and also a substrate-binding domain, with the active site at the interface between the three domains."
Membrane-association determinants of the omega-amino acid monooxygenase PvdA, a pyoverdine biosynthetic enzyme from Pseudomonas aeruginosa.
  • PvdA provides an essential enzymic function in pyoverdine biogenesis
    "The L-ornithine N(delta)-oxygenase PvdA catalyses the N(delta)-hydroxylation of L-ornithine in many Pseudomonas spp., and thus provides an essential enzymic function in the biogenesis of the pyoverdine siderophore."
  • PvdA has membrane association but its bulk spans the cytosol
    "The inferred topological model resembled a eukaryotic reverse signal-anchor (type III) protein, with a single N-terminal domain anchored to the inner membrane, and the bulk of the protein spanning the cytosol."
High cellular organization of pyoverdine biosynthesis in Pseudomonas aeruginosa: clustering of PvdA at the old cell pole.
  • PvdA is one of the initial cytoplasmic enzymes in pyoverdine biosynthesis
    "generate P.aeruginosa strains producing fluorescent fusions with PvdA, one of the initial enzymes in the biosynthetic pathway of PVDI in the cytoplasm"
  • PvdA can also be recovered in a membrane fraction
    "Cellular fractionation indicated that a substantial amount of PvdA-YFP was located in the membrane fraction."
Siderophore-mediated iron acquisition in the entomopathogenic bacterium Pseudomonas entomophila L48 and its close relative Pseudomonas putida KT2440.
  • KT2440 produces a characterized pyoverdine and no second siderophore was detected
    "Structural analysis of the pyoverdine produced by the closely related P. putida KT2440 showed that this strain produces an already characterised pyoverdine, but different from P. entomophila, and no evidence was found for the production of a second siderophore."
PvdRT-OpmQ and MdtABC-OpmB efflux systems are involved in pyoverdine secretion in Pseudomonas putida KT2440.
  • Pyoverdine secretion genes are stimulated by iron limitation in KT2440
    "Expression from the respective promoters is stimulated by iron limitation albeit to varying degrees."
  • Reduced pyoverdine secretion decreases growth under iron limitation
    "Deletion of pvdRT-opmQ leads to reduced amounts of pyoverdine in the medium and decreased growth under iron limitation."
Arginine Biosynthesis Modulates Pyoverdine Production and Release in Pseudomonas putida as Part of the Mechanism of Adaptation to Oxidative Stress.
  • Defects affecting pyoverdine production increase KT2440 sensitivity to iron limitation
    "Mutants defective in arginine biosynthesis show reduced production and release of the siderophore pyoverdine and altered expression of certain pyoverdine-related genes, resulting in higher sensitivity to iron limitation."
file:PSEPK/pvdA/pvdA-deep-research-manual.md
Deep research on pvdA in Pseudomonas putida KT2440
  • "Q88GC8 is the KT2440 ortholog of the pyoverdine biosynthetic ornithine hydroxylase PvdA"
  • "The direct process annotation is pyoverdine biosynthetic process rather than intracellular iron ion homeostasis"
  • "Cytoplasm is the conservative cellular component call for KT2440 PvdA"
file:PSEPK/pvdA/pvdA-deep-research-falcon.md
Falcon deep research on pvdA (Q88GC8 / PP_3796) in Pseudomonas putida KT2440
  • "The UniProt accession **Q88GC8** corresponds to **pvdA / PP_3796** from *Pseudomonas putida* strain KT2440 and is functionally described as an **L-ornithine N5-monooxygenase (ornithine hydroxylase)**"
  • "**pvdA encodes the enzyme catalyzing the N5-hydroxylation of L-ornithine** to produce **N5-hydroxyornithine**, which is subsequently **formylated by PvdF** to yield **N5-formyl-N5-hydroxyornithine (L-fOHOrn)**."
  • "PvdA belongs to the **flavin-dependent N-hydroxylating monooxygenase / Class B flavin monooxygenase** family."
  • "dependence on **FAD** as a flavin cofactor and **molecular oxygen** as the oxygen donor, proceeding through **C4a-peroxy/hydroperoxyflavin** intermediates that effect oxygen transfer to the substrate amine"
  • "**substrate binding triggers O2 addition but not flavin reduction**, consistent with gating of the oxidative half-reaction by L-ornithine binding"
  • "PvdA functions in the **cytoplasmic phase** of **pyoverdine siderophore biosynthesis**, supplying a modified amino acid building block needed by the **NRPS assembly line**."
  • "Pyoverdine biosynthesis initiates in the **cytoplasm**"
  • "**PvdA physically interacts with all four pyoverdine NRPSs**"
  • "This is an early, committed tailoring step in pyoverdine assembly."
  • "**pvdA** and **pvdD** expression increased in these mutants, while **pvdE** (an inner-membrane transporter needed for immature pyoverdine handling) decreased"

Suggested Questions for Experts

Q: Is KT2440 PvdA predominantly soluble-cytoplasmic or does it become membrane-associated and old-pole clustered during active pyoverdine synthesis, as described for the PAO1 homolog?

Suggested experts: Ignacio J. Schalk, Holger Jung

Q: Does KT2440 PvdA show the same strict ornithine specificity and NADPH/FAD coupling behavior reported for the PAO1 enzyme, or are there strain-specific kinetic differences?

Suggested experts: Sharon Y. N. Seah, Anne L. Lamb

Suggested Experiments

Experiment: Construct a clean pvdA deletion or catalytic-site mutant in KT2440, measure pyoverdine fluorescence and LC-MS profiles under iron limitation, and test rescue with plasmid-borne pvdA or exogenous N5-hydroxyornithine.

Hypothesis: PP_3796 is the dedicated ornithine N5-monooxygenase required for KT2440 pyoverdine biosynthesis.

Type: genetics and metabolite rescue

Experiment: Build a chromosomal fluorescent or epitope-tagged PvdA allele, then compare localization and fractionation patterns in iron-replete versus iron-limited growth while quantifying pyoverdine output.

Hypothesis: KT2440 PvdA undergoes regulated membrane association during active pyoverdine production.

Type: localization and cell biology

Deep Research

Falcon

(pvdA-deep-research-falcon.md)
this with annotations you find in gene/protein databases, but these can be outdated or inaccurate. Falcon Edison Scientific Literature 29 citations 2 artifacts 2026-06-03T03:02:45.473133

The research report should be a detailed narrative explaining the function, biological processes, and localization of the gene product. Citations should be given for all claims.

You should prioritize authoritative reviews and primary scientific literature when conducting research. You can supplement
this with annotations you find in gene/protein databases, but these can be outdated or inaccurate.

We are specifically interested in the primary function of the gene - for enzymes, what reaction is catalyzed, and what is the substrate specificity? For transporters, what is the substrate? For structural proteins or adapters, what is the broader structural role? For signaling molecules, what is the role in the pathway.

We are interested in where in or outside the cell the gene product carries out its function.

We are also interested in the signaling or biochemical pathways in which the gene functions. We are less interested in broad pleiotropic effects, except where these elucidate the precise role.

Include evidence where possible. We are interested in both experimental evidence as well as inference from structure, evolution, or bioinformatic analysis. Precise studies should be prioritized over high-throughput, where available.

Research report: functional annotation of pvdA (UniProt Q88GC8, locus PP_3796) in Pseudomonas putida KT2440

1) Target identity verification and definitions

Target verified. The UniProt accession Q88GC8 corresponds to pvdA / PP_3796 from Pseudomonas putida strain KT2440 and is functionally described as an L-ornithine N5-monooxygenase (ornithine hydroxylase), consistent with the pyoverdine (PVD) biosynthesis gene naming used across fluorescent pseudomonads. In the pyoverdine literature, pvdA is consistently used for the enzyme that produces N5-hydroxyornithine, a hydroxamate precursor required for the pyoverdine peptide backbone. (dell’anno2022novelinsightson pages 8-9, rice2010characterizationofan pages 24-27, barrientosmoreno2019argininebiosynthesismodulates pages 8-10)

Key terms.
- Pyoverdine (PVD): a high-affinity siderophore produced by many Pseudomonas spp. to chelate Fe(III) under iron limitation; pyoverdines are nonribosomal peptides with a conserved chromophore and strain-specific peptide backbone. (dell’anno2022novelinsightson pages 4-8)
- N-hydroxylating monooxygenase (NMO): a flavin-dependent enzyme subclass that hydroxylates amine nitrogens (here, L-ornithine N5), often in siderophore biosynthesis. (chocklett2009biochemicalcharacterizationof pages 20-25, rice2010characterizationofan pages 37-42)

2) Primary biochemical function: reaction, substrate specificity, and mechanism

2.1 Catalyzed reaction and substrate

pvdA encodes the enzyme catalyzing the N5-hydroxylation of L-ornithine to produce N5-hydroxyornithine, which is subsequently formylated by PvdF to yield N5-formyl-N5-hydroxyornithine (L-fOHOrn). This modified amino acid is incorporated by NRPS enzymes into the pyoverdine peptide backbone, contributing hydroxamate ligands used for iron binding. (schalk2025bacterialsiderophoresdiversity pages 4-7, dell’anno2022novelinsightson pages 8-9, rice2010characterizationofan pages 24-27)

2.2 Cofactors and catalytic cycle (current understanding)

PvdA belongs to the flavin-dependent N-hydroxylating monooxygenase / Class B flavin monooxygenase family. Mechanistic work on this enzyme family indicates:
- dependence on FAD as a flavin cofactor and molecular oxygen as the oxygen donor, proceeding through C4a-peroxy/hydroperoxyflavin intermediates that effect oxygen transfer to the substrate amine; (chocklett2009biochemicalcharacterizationof pages 20-25, rice2010characterizationofan pages 37-42)
- use of a reducing cofactor (typically NADPH) to reduce FAD during the reductive half reaction, consistent with Class B monooxygenase behavior; (rice2010characterizationofan pages 37-42)
- bacterial PvdA-family enzymes can be partially flavin-deficient after purification, with activity restored by adding exogenous FAD in assays (a practical point for biochemical reconstitution). (chocklett2009biochemicalcharacterizationof pages 20-25)

A kinetic/mechanistic observation for PvdA highlighted in recent syntheses is that substrate binding triggers O2 addition but not flavin reduction, consistent with gating of the oxidative half-reaction by L-ornithine binding (mechanistic specialization among NMOs). (manko2024pvdlorchestratesthe pages 13-14, schalk2025bacterialsiderophoresdiversity pages 23-27)

Evidence limitations for the exact KT2440 protein. In the retrieved corpus, direct kinetic constants (kcat, KM) for P. putida KT2440 PvdA (Q88GC8) were not found; mechanistic inferences rely chiefly on biochemical characterization of close homologs (notably P. aeruginosa PvdA) and broader NMO family evidence. (chocklett2009biochemicalcharacterizationof pages 20-25, schalk2025bacterialsiderophoresdiversity pages 23-27, rice2010characterizationofan pages 37-42)

3) Pathway placement, cellular localization, and cellular context

3.1 Pathway role in pyoverdine biosynthesis

Pyoverdine biosynthesis initiates in the cytoplasm with assembly of a precursor (often described in the literature as ferribactin-like intermediates) by large nonribosomal peptide synthetases (NRPSs) together with accessory tailoring enzymes; later steps include periplasmic maturation and secretion. Within this framework, PvdA supplies a specialized building block needed for NRPS assembly. (manko2024pvdlorchestratesthe pages 1-2, dell’anno2022novelinsightson pages 8-9, dell’anno2022novelinsightson pages 9-11)

3.2 Spatial organization and multi-enzyme complexes (“siderosomes”)

A major recent conceptual development is the view that pyoverdine biosynthesis enzymes are organized in multi-enzyme assemblies. In P. aeruginosa (the best-studied system), in-cell interaction and microscopy approaches support that:
- PvdA physically interacts with all four pyoverdine NRPSs; and
- components can associate with membrane-linked supramolecular biosynthetic machineries (“siderosomes”), although complete in vitro reconstitution/isolation remains challenging. (manko2024pvdlorchestratesthe pages 1-2, schalk2025bacterialsiderophoresdiversity pages 4-7)

These spatial/organizational findings are important for functional annotation because they imply PvdA acts not as a freely diffusing enzyme only, but as a participant in a coordinated biosynthetic system with metabolite channeling or spatial coupling to downstream steps. (schalk2025bacterialsiderophoresdiversity pages 4-7, manko2024pvdlorchestratesthe pages 1-2)

4) Regulation in P. putida KT2440 and physiological roles

4.1 Iron limitation as the dominant signal

The pyoverdine system is fundamentally an iron starvation response, often governed by Fur-mediated control and iron-responsive sigma-factor networks in pseudomonads (reviewed broadly for the pvd regulon). (rice2010characterizationofan pages 24-27)

In P. putida KT2440, genetic perturbations in arginine biosynthesis (ΔargG, ΔargH) demonstrated that pyoverdine production/secretion can be decoupled from structural gene transcription:
- pvdA and pvdD expression increased in these mutants, while pvdE (an inner-membrane transporter needed for immature pyoverdine handling) decreased, consistent with impaired maturation/export rather than simple failure to induce biosynthesis; (barrientosmoreno2019argininebiosynthesismodulates pages 8-10)
- figure-level evidence shows these transcriptional trends (qRT-PCR) and accompanying phenotypes, including altered pyoverdine distribution. (barrientosmoreno2019argininebiosynthesismodulates media 53ef4128)

These mutants showed reduced extracellular pyoverdine with intracellular retention and increased oxidative stress (CellROX readout), supporting a model in which iron capture, intracellular siderophore handling, and oxidative stress defenses are functionally intertwined. (barrientosmoreno2019argininebiosynthesismodulates pages 8-10, barrientosmoreno2019argininebiosynthesismodulates media 79b5b256, barrientosmoreno2019argininebiosynthesismodulates media 12115201)

5) Real-world implementation: secretion systems and quantitative phenotypes (2023 KT2440 study)

A key KT2440-specific, recent implementation-level insight is that pyoverdine-mediated iron acquisition depends on a network of overlapping tripartite efflux systems.

Core secretion systems and ParXY as an additional contributor (Stein et al., 2023-12; Microbiology Spectrum). Pyoverdine in P. putida KT2440 is secreted primarily via PvdRT–OpmQ and MdtABC–OpmB, and Stein et al. showed the RND efflux system ParXY affects siderophore secretion and growth under iron limitation. (stein2023therndefflux pages 1-2, stein2023therndefflux pages 10-13)

Quantitative data from Stein et al. 2023 (selected):
- Under strong iron limitation, adding parX deletion to the double-secretion mutant background (ΔpvdRT-opmQ ΔmdtA; “Δpm”) produced a major additional growth defect: AUC of ΔpmΔparX ≈ 40% of Δpm, while a pyoverdine non-producer was ~2% of Δpm (indicating pyoverdine-dependent growth is severely compromised). (stein2023therndefflux pages 2-5)
- Rescue experiments supported iron-specific causality: 1 µM FeCl3 restored growth of ΔpmΔparX to Δpm levels, and 10 µM pyoverdine gave the best rescue; 1 µM CuSO4 did not rescue. (stein2023therndefflux pages 8-10)
- Regulatory readouts: a parXY promoter-lux fusion showed iron responsiveness—10 µM FeCl3 reduced luminescence ~7-fold, while 1 mM bipyridyl increased luminescence ~2-fold, indicating induction under iron limitation. (stein2023therndefflux pages 8-10)
- Deletion of parX caused approximately twofold reduced expression of both mdtABC-opmB and pvdL (a pyoverdine NRPS gene), consistent with coupling between efflux capacity and biosynthetic program. (stein2023therndefflux pages 10-13)

These data demonstrate that even though pvdA is a biosynthetic gene, its pathway output (pyoverdine availability for iron uptake) is strongly shaped by export/recycling capacity, which in turn impacts growth under iron scarcity—a key ecological and applied phenotype for KT2440 as an environmental bacterium. (stein2023therndefflux pages 2-5, stein2023therndefflux pages 8-10)

6) Recent developments (prioritizing 2023–2024)

6.1 2024: supramolecular organization of the pyoverdine NRPS machinery

Single-molecule microscopy and interaction-focused approaches described in 2024 work on P. aeruginosa reinforce the emerging model of organized biosynthetic machineries and place PvdA among enzymes that interact with NRPSs in vivo. While not KT2440-specific, these studies are influential for the “current understanding” of how PvdA functions in cells beyond its catalytic activity. (manko2024pvdlorchestratesthe pages 1-2)

6.2 2024: signaling-to-siderophore transcriptional control (conservation across Pseudomonas)

A 2024 study identified a two-component system (BfmRS) in P. aeruginosa that regulates siderophore gene clusters under osmotic stress and reported conservation and promoter binding by BfmR homologs from Pseudomonas species including P. putida KT2440, suggesting a conserved regulatory logic linking environmental stress to siderophore gene expression (including pvd clusters). ()

6.3 2023: secretion systems as a network (KT2440)

The 2023 KT2440 work emphasizes “overlapping activities” and partial functional redundancy among tripartite efflux systems for siderophore secretion—an important practical constraint when attempting to inhibit secretion (e.g., antimicrobial adjuvants) or engineer pyoverdine flux in biotechnology. (stein2023therndefflux pages 1-2, stein2023therndefflux pages 10-13)

7) Applications and expert synthesis

Recent reviews highlight pyoverdines as multifunctional molecules beyond iron uptake, with relevance to biofilms, microbial interactions, and biotechnology. (schalk2025bacterialsiderophoresdiversity pages 23-27, dell’anno2022novelinsightson pages 8-9)

Biotechnological and translational relevance of the pvdA step. Because PvdA contributes to generating hydroxamate-containing residues critical for metal binding, it is a plausible control point for:
- metabolic/synthetic biology engineering of siderophore pathways (tuning iron acquisition, metal-binding specificity, or production yields); and
- anti-virulence strategies in pathogenic pseudomonads by blocking siderophore biosynthesis (PvdA-family NMOs are commonly cited as key enzymes in this logic). (schalk2025bacterialsiderophoresdiversity pages 23-27, chocklett2009biochemicalcharacterizationof pages 20-25, rice2010characterizationofan pages 24-27)

Expert perspective on system-level constraints. Authoritative synthesis emphasizes that siderophore function in vivo depends on not only biosynthesis but also membrane trafficking, periplasmic maturation, and secretion/recycling systems; thus, interpreting “pvdA function” in real-world settings (soil, host-associated environments, engineered bioprocesses) requires integrating catalysis with cellular organization and export networks. (schalk2025bacterialsiderophoresdiversity pages 4-7, dell’anno2022novelinsightson pages 9-11, stein2023therndefflux pages 8-10)

8) Evidence-backed statistics and data points (from recent and key studies)

  • parXY promoter activity: ~7-fold repression by 10 µM FeCl3, ~2-fold induction by 1 mM bipyridyl (iron chelation) in reporter assays. (stein2023therndefflux pages 8-10)
  • Growth under iron limitation: ΔpmΔparX AUC ≈ 40% of Δpm; pyoverdine non-producer ≈ 2% of Δpm in a strong iron-limited condition, supporting that efflux network integrity is essential for siderophore-mediated iron acquisition. (stein2023therndefflux pages 2-5)
  • Rescue experiments: 1 µM FeCl3 or 10 µM pyoverdine rescued growth deficits consistent with impaired pyoverdine-mediated iron uptake; 1 µM CuSO4 did not. (stein2023therndefflux pages 8-10)
  • KT2440 arginine mutants: figure-based qRT-PCR and phenotyping show pvdA/pvdD up, pvdE down, altered extracellular vs intracellular pyoverdine partitioning, and elevated ROS. (barrientosmoreno2019argininebiosynthesismodulates media 53ef4128, barrientosmoreno2019argininebiosynthesismodulates media 79b5b256, barrientosmoreno2019argininebiosynthesismodulates media 12115201)

9) Summary table (functional annotation at a glance)

The following table consolidates the functional annotation, pathway placement, regulation, phenotypes, and recent developments for P. putida KT2440 pvdA (Q88GC8).

Category Key points Best supporting sources (with year and DOI/URL where available)
Identity Target verified: UniProt Q88GC8 in Pseudomonas putida KT2440 corresponds to pvdA / PP_3796, an L-ornithine N5-monooxygenase (ornithine hydroxylase) in pyoverdine biosynthesis; this matches the UniProt description and the broader Pseudomonas pyoverdine literature. P. putida studies treat pvdA as a pyoverdine structural gene, while foundational biochemical characterization is mainly from the close homolog in P. aeruginosa. (rice2010characterizationofan pages 24-27, barrientosmoreno2019argininebiosynthesismodulates pages 8-10) Barrientos-Moreno et al., 2019, J Bacteriol; DOI: https://doi.org/10.1128/jb.00454-19. Rice, 2010 (primary characterization thesis/article excerpt).
Reaction Primary function: catalyzes N5-hydroxylation of L-ornithine to make N5-hydroxyornithine, which is then formylated by PvdF to produce L-fOHOrn for incorporation into the pyoverdine peptide backbone. This is an early, committed tailoring step in pyoverdine assembly. (schalk2025bacterialsiderophoresdiversity pages 4-7, dell’anno2022novelinsightson pages 8-9, rice2010characterizationofan pages 24-27) Dell’Anno et al., 2022, DOI: https://doi.org/10.3390/ijms231911507. Schalk, 2025, DOI: https://doi.org/10.1038/s41579-024-01090-6.
Cofactors & mechanism PvdA belongs to the flavin-dependent N-hydroxylating monooxygenase / Class B FMO family. Mechanistic evidence from Pseudomonas and related homologs indicates use of FAD, molecular oxygen, and typically NADPH as reductant; catalysis proceeds through a C4a-hydroperoxyflavin intermediate. Purified bacterial NMOs can require exogenous FAD because recombinant proteins may be partially flavin-deficient. A kinetic study cited in recent reviews reports that in PvdA, substrate binding triggers O2 addition but not flavin reduction. (chocklett2009biochemicalcharacterizationof pages 20-25, manko2024pvdlorchestratesthe pages 13-14, schalk2025bacterialsiderophoresdiversity pages 23-27, rice2010characterizationofan pages 37-42) Chocklett, 2009 (mechanistic NMO background). Rice, 2010 (PvdA characterization excerpt). Schalk, 2025, DOI: https://doi.org/10.1038/s41579-024-01090-6.
Pathway role PvdA functions in the cytoplasmic phase of pyoverdine siderophore biosynthesis, supplying a modified amino acid building block needed by the NRPS assembly line. Pyoverdine is the major/specific siderophore used by fluorescent pseudomonads for high-affinity Fe(III) acquisition; the mature siderophore has extremely high ferric affinity (~10^-32 M^-1 reported in the pathway literature). (manko2024pvdlorchestratesthe pages 1-2, dell’anno2022novelinsightson pages 8-9, dell’anno2022novelinsightson pages 4-8, dell’anno2022novelinsightson pages 9-11, stein2023therndefflux pages 1-2) Dell’Anno et al., 2022, DOI: https://doi.org/10.3390/ijms231911507. Manko et al., 2024, DOI: https://doi.org/10.3390/ijms25116013. Stein et al., 2023, DOI: https://doi.org/10.1128/spectrum.02300-23.
Cellular localization & complex context Pyoverdine biosynthesis starts in the cytoplasm, with later periplasmic maturation and secretion. Recent cell-biological studies in P. aeruginosa indicate that PvdA can physically interact with all four pyoverdine NRPSs and is part of a membrane-associated multienzyme “siderosome” context; Schalk’s review also notes an N-terminal hydrophobic inner-membrane-anchoring region and varying interaction stoichiometries with NRPS partners. Direct isolation of the full complex remains incomplete. (schalk2025bacterialsiderophoresdiversity pages 4-7, manko2024pvdlorchestratesthe pages 1-2, dell’anno2022novelinsightson pages 8-9) Manko et al., 2024, DOI: https://doi.org/10.3390/ijms25116013. Dell’Anno et al., 2022, DOI: https://doi.org/10.3390/ijms231911507. Schalk, 2025, DOI: https://doi.org/10.1038/s41579-024-01090-6.
Regulation & conditions pvdA is embedded in the canonical iron-starvation-responsive pyoverdine regulon, typically controlled by Fur and pyoverdine sigma-factor circuitry in pseudomonads. In P. putida KT2440, arginine biosynthesis defects alter pyoverdine gene expression: pvdA and pvdD increase, but pvdE decreases, consistent with impaired maturation/export rather than simple biosynthetic shutdown. Recent 2024 work in P. aeruginosa identified BfmRS as a direct regulator of siderophore genes under osmotic stress; homologous BfmR from P. putida KT2440 could bind promoters of key siderophore genes, suggesting conservation of this regulatory logic across pseudomonads. Also, parXY expression is iron responsive: 10 µM FeCl3 reduced parXY promoter activity by ~7-fold, whereas 1 mM bipyridyl increased it ~2-fold. (rice2010characterizationofan pages 24-27, barrientosmoreno2019argininebiosynthesismodulates pages 8-10, stein2023therndefflux pages 10-13, stein2023therndefflux pages 8-10) Barrientos-Moreno et al., 2019, DOI: https://doi.org/10.1128/jb.00454-19. Song et al., 2024, DOI: https://doi.org/10.1038/s42003-024-05995-z. Stein et al., 2023, DOI: https://doi.org/10.1128/spectrum.02300-23.
Phenotypes & quantitative data In P. putida KT2440, pyoverdine homeostasis is tightly linked to secretion and stress adaptation. ΔargG/ΔargH mutants show higher pvdA/pvdD expression but reduced extracellular pyoverdine with intracellular retention, and higher ROS by CellROX assays; figure-based evidence shows increased intracellular vs extracellular pyoverdine and reduced pvdE expression. For secretion, Stein et al. found that in a ΔpvdRT-opmQ ΔmdtA background (Δpm), adding ΔparX caused the strongest extra defect under iron limitation: AUC ~40% of Δpm, while a pyoverdine-nonproducer was ~2% of Δpm. 1 µM FeCl3 rescued the triple-mutant growth defect to Δpm levels, and 10 µM pyoverdine gave the best rescue; 1 µM CuSO4 did not. parX deletion also caused ~2-fold lower mdtABC-opmB and pvdL expression in reporter assays. (barrientosmoreno2019argininebiosynthesismodulates pages 8-10, barrientosmoreno2019argininebiosynthesismodulates media bdcc705a, stein2023therndefflux pages 2-5, stein2023therndefflux pages 10-13, stein2023therndefflux pages 8-10) Barrientos-Moreno et al., 2019, DOI: https://doi.org/10.1128/jb.00454-19. Stein et al., 2023, DOI: https://doi.org/10.1128/spectrum.02300-23.
Recent developments & applications 2023–2024 work has shifted from simple gene-function assignment to pathway organization and export control: (i) ParXY was added to the network of overlapping pyoverdine secretion systems in P. putida KT2440; (ii) PvdL/NRPS spatial organization and PvdA interactions were visualized in live cells; (iii) BfmRS linked environmental stress to siderophore regulation. Reviews emphasize broader applications of pyoverdine biology in biotechnology, synthetic biology, antimicrobial targeting, and environmental metal acquisition, making PvdA relevant both as a biosynthetic engineering node and as a potential anti-virulence target by blocking siderophore production. (schalk2025bacterialsiderophoresdiversity pages 23-27, manko2024pvdlorchestratesthe pages 1-2, stein2023therndefflux pages 1-2) Stein et al., 2023, DOI: https://doi.org/10.1128/spectrum.02300-23. Manko et al., 2024, DOI: https://doi.org/10.3390/ijms25116013. Dell’Anno et al., 2022, DOI: https://doi.org/10.3390/ijms231911507. Schalk, 2025, DOI: https://doi.org/10.1038/s41579-024-01090-6.

Table: This table summarizes the best-supported functional annotation for Pseudomonas putida KT2440 pvdA (UniProt Q88GC8), integrating organism-specific evidence with mechanistic data from closely characterized homologs. It highlights reaction chemistry, pathway role, localization, regulation, phenotypes, and recent 2023–2024 developments.

10) Practical implications for functional annotation pipelines

For annotation of Q88GC8 in KT2440-like genomes, the strongest evidence-supported statements are:
1) Enzyme function: L-ornithine N5-hydroxylase producing N5-hydroxyornithine for pyoverdine biosynthesis (with PvdF yielding formylated product). (dell’anno2022novelinsightson pages 8-9, rice2010characterizationofan pages 24-27)
2) Pathway role: pyoverdine siderophore biosynthesis (iron acquisition) with downstream dependence on periplasmic processing and secretion. (dell’anno2022novelinsightson pages 9-11, stein2023therndefflux pages 8-10)
3) Cellular context: cytoplasmic biosynthetic stage; evidence from Pseudomonas indicates integration into multienzyme biosynthetic assemblies, likely membrane-associated. (manko2024pvdlorchestratesthe pages 1-2, schalk2025bacterialsiderophoresdiversity pages 4-7)
4) Physiology: critical for iron-limited growth and tied to oxidative stress balance through iron/siderophore homeostasis. (barrientosmoreno2019argininebiosynthesismodulates pages 8-10, barrientosmoreno2019argininebiosynthesismodulates media 12115201)

References (URLs and publication dates where available)

  • Stein NV et al. 2023-12. Microbiology Spectrum: “The RND efflux system ParXY affects siderophore secretion in Pseudomonas putida KT2440.” https://doi.org/10.1128/spectrum.02300-23 (stein2023therndefflux pages 1-2, stein2023therndefflux pages 2-5, stein2023therndefflux pages 10-13, stein2023therndefflux pages 8-10)
  • Song Y et al. 2024-03. Communications Biology: “Molecular mechanism of siderophore regulation by the Pseudomonas aeruginosa BfmRS two-component system in response to osmotic stress.” https://doi.org/10.1038/s42003-024-05995-z ()
  • Manko H et al. 2024-05. Int J Mol Sci: “PvdL orchestrates the assembly of the NRPSs involved in pyoverdine biosynthesis in P. aeruginosa.” https://doi.org/10.3390/ijms25116013 (manko2024pvdlorchestratesthe pages 1-2)
  • Dell’Anno F et al. 2022-09. Int J Mol Sci: “Novel insights on pyoverdine: from biosynthesis to biotechnological application.” https://doi.org/10.3390/ijms231911507 (dell’anno2022novelinsightson pages 8-9, dell’anno2022novelinsightson pages 4-8, dell’anno2022novelinsightson pages 9-11)
  • Barrientos-Moreno L et al. 2019-11. Journal of Bacteriology: “Arginine biosynthesis modulates pyoverdine production and release in Pseudomonas putida … adaptation to oxidative stress.” https://doi.org/10.1128/jb.00454-19 (barrientosmoreno2019argininebiosynthesismodulates pages 8-10, barrientosmoreno2019argininebiosynthesismodulates media bdcc705a, barrientosmoreno2019argininebiosynthesismodulates media 53ef4128, barrientosmoreno2019argininebiosynthesismodulates media 79b5b256, barrientosmoreno2019argininebiosynthesismodulates media 12115201)
  • Schalk IJ. 2025-09 (DOI indicates 2024 record). Nature Reviews Microbiology: “Bacterial siderophores: diversity, uptake pathways and applications.” https://doi.org/10.1038/s41579-024-01090-6 (schalk2025bacterialsiderophoresdiversity pages 23-27, schalk2025bacterialsiderophoresdiversity pages 4-7)
  • Rice LJ. 2010. “Characterization of … PvdA involved in pyoverdine biosynthesis in P. aeruginosa …” (primary characterization excerpt). (rice2010characterizationofan pages 24-27, rice2010characterizationofan pages 37-42)
  • Chocklett SW. 2009. “Biochemical characterization of Aspergillus fumigatus SidA: a flavin-dependent N-hydroxylating enzyme.” (mechanistic NMO background relevant to PvdA family). (chocklett2009biochemicalcharacterizationof pages 20-25)

References

  1. (dell’anno2022novelinsightson pages 8-9): Filippo Dell’Anno, Giovanni Andrea Vitale, Carmine Buonocore, Laura Vitale, Fortunato Palma Esposito, Daniela Coppola, Gerardo Della Sala, Pietro Tedesco, and Donatella de Pascale. Novel insights on pyoverdine: from biosynthesis to biotechnological application. International Journal of Molecular Sciences, 23:11507, Sep 2022. URL: https://doi.org/10.3390/ijms231911507, doi:10.3390/ijms231911507. This article has 40 citations.

  2. (rice2010characterizationofan pages 24-27): LJ Rice. Characterization of an ntn-hydrolase, pvdq, and an l-ornithine n5-monooxygenase, pvda, involved in pyoverdine biosynthesis in pseudomonas aeruginosa …. Unknown journal, 2010.

  3. (barrientosmoreno2019argininebiosynthesismodulates pages 8-10): Laura Barrientos-Moreno, María Antonia Molina-Henares, Marta Pastor-García, María Isabel Ramos-González, and Manuel Espinosa-Urgel. Arginine biosynthesis modulates pyoverdine production and release in pseudomonas putida as part of the mechanism of adaptation to oxidative stress. Journal of Bacteriology, Nov 2019. URL: https://doi.org/10.1128/jb.00454-19, doi:10.1128/jb.00454-19. This article has 44 citations and is from a peer-reviewed journal.

  4. (dell’anno2022novelinsightson pages 4-8): Filippo Dell’Anno, Giovanni Andrea Vitale, Carmine Buonocore, Laura Vitale, Fortunato Palma Esposito, Daniela Coppola, Gerardo Della Sala, Pietro Tedesco, and Donatella de Pascale. Novel insights on pyoverdine: from biosynthesis to biotechnological application. International Journal of Molecular Sciences, 23:11507, Sep 2022. URL: https://doi.org/10.3390/ijms231911507, doi:10.3390/ijms231911507. This article has 40 citations.

  5. (chocklett2009biochemicalcharacterizationof pages 20-25): SW Chocklett. Biochemical characterization of aspergillus fumigatus sida: a flavin-dependent n-hydroxylating enzyme. Unknown journal, 2009.

  6. (rice2010characterizationofan pages 37-42): LJ Rice. Characterization of an ntn-hydrolase, pvdq, and an l-ornithine n5-monooxygenase, pvda, involved in pyoverdine biosynthesis in pseudomonas aeruginosa …. Unknown journal, 2010.

  7. (schalk2025bacterialsiderophoresdiversity pages 4-7): Isabelle J. Schalk. Bacterial siderophores: diversity, uptake pathways and applications. Nature reviews. Microbiology, 23:24-40, Sep 2025. URL: https://doi.org/10.1038/s41579-024-01090-6, doi:10.1038/s41579-024-01090-6. This article has 211 citations.

  8. (manko2024pvdlorchestratesthe pages 13-14): Hanna Manko, Tania Steffan, Véronique Gasser, Yves Mély, Isabelle Schalk, and Julien Godet. Pvdl orchestrates the assembly of the nonribosomal peptide synthetases involved in pyoverdine biosynthesis in pseudomonas aeruginosa. International Journal of Molecular Sciences, 25:6013, May 2024. URL: https://doi.org/10.3390/ijms25116013, doi:10.3390/ijms25116013. This article has 6 citations.

  9. (schalk2025bacterialsiderophoresdiversity pages 23-27): Isabelle J. Schalk. Bacterial siderophores: diversity, uptake pathways and applications. Nature reviews. Microbiology, 23:24-40, Sep 2025. URL: https://doi.org/10.1038/s41579-024-01090-6, doi:10.1038/s41579-024-01090-6. This article has 211 citations.

  10. (manko2024pvdlorchestratesthe pages 1-2): Hanna Manko, Tania Steffan, Véronique Gasser, Yves Mély, Isabelle Schalk, and Julien Godet. Pvdl orchestrates the assembly of the nonribosomal peptide synthetases involved in pyoverdine biosynthesis in pseudomonas aeruginosa. International Journal of Molecular Sciences, 25:6013, May 2024. URL: https://doi.org/10.3390/ijms25116013, doi:10.3390/ijms25116013. This article has 6 citations.

  11. (dell’anno2022novelinsightson pages 9-11): Filippo Dell’Anno, Giovanni Andrea Vitale, Carmine Buonocore, Laura Vitale, Fortunato Palma Esposito, Daniela Coppola, Gerardo Della Sala, Pietro Tedesco, and Donatella de Pascale. Novel insights on pyoverdine: from biosynthesis to biotechnological application. International Journal of Molecular Sciences, 23:11507, Sep 2022. URL: https://doi.org/10.3390/ijms231911507, doi:10.3390/ijms231911507. This article has 40 citations.

  12. (barrientosmoreno2019argininebiosynthesismodulates media 53ef4128): Laura Barrientos-Moreno, María Antonia Molina-Henares, Marta Pastor-García, María Isabel Ramos-González, and Manuel Espinosa-Urgel. Arginine biosynthesis modulates pyoverdine production and release in pseudomonas putida as part of the mechanism of adaptation to oxidative stress. Journal of Bacteriology, Nov 2019. URL: https://doi.org/10.1128/jb.00454-19, doi:10.1128/jb.00454-19. This article has 44 citations and is from a peer-reviewed journal.

  13. (barrientosmoreno2019argininebiosynthesismodulates media 79b5b256): Laura Barrientos-Moreno, María Antonia Molina-Henares, Marta Pastor-García, María Isabel Ramos-González, and Manuel Espinosa-Urgel. Arginine biosynthesis modulates pyoverdine production and release in pseudomonas putida as part of the mechanism of adaptation to oxidative stress. Journal of Bacteriology, Nov 2019. URL: https://doi.org/10.1128/jb.00454-19, doi:10.1128/jb.00454-19. This article has 44 citations and is from a peer-reviewed journal.

  14. (barrientosmoreno2019argininebiosynthesismodulates media 12115201): Laura Barrientos-Moreno, María Antonia Molina-Henares, Marta Pastor-García, María Isabel Ramos-González, and Manuel Espinosa-Urgel. Arginine biosynthesis modulates pyoverdine production and release in pseudomonas putida as part of the mechanism of adaptation to oxidative stress. Journal of Bacteriology, Nov 2019. URL: https://doi.org/10.1128/jb.00454-19, doi:10.1128/jb.00454-19. This article has 44 citations and is from a peer-reviewed journal.

  15. (stein2023therndefflux pages 1-2): Nicola Victoria Stein, Michelle Eder, Fabienne Burr, Sarah Stoss, Lorenz Holzner, Hans-Henning Kunz, and Heinrich Jung. The rnd efflux system parxy affects siderophore secretion in pseudomonas putida kt2440. Dec 2023. URL: https://doi.org/10.1128/spectrum.02300-23, doi:10.1128/spectrum.02300-23. This article has 8 citations and is from a domain leading peer-reviewed journal.

  16. (stein2023therndefflux pages 10-13): Nicola Victoria Stein, Michelle Eder, Fabienne Burr, Sarah Stoss, Lorenz Holzner, Hans-Henning Kunz, and Heinrich Jung. The rnd efflux system parxy affects siderophore secretion in pseudomonas putida kt2440. Dec 2023. URL: https://doi.org/10.1128/spectrum.02300-23, doi:10.1128/spectrum.02300-23. This article has 8 citations and is from a domain leading peer-reviewed journal.

  17. (stein2023therndefflux pages 2-5): Nicola Victoria Stein, Michelle Eder, Fabienne Burr, Sarah Stoss, Lorenz Holzner, Hans-Henning Kunz, and Heinrich Jung. The rnd efflux system parxy affects siderophore secretion in pseudomonas putida kt2440. Dec 2023. URL: https://doi.org/10.1128/spectrum.02300-23, doi:10.1128/spectrum.02300-23. This article has 8 citations and is from a domain leading peer-reviewed journal.

  18. (stein2023therndefflux pages 8-10): Nicola Victoria Stein, Michelle Eder, Fabienne Burr, Sarah Stoss, Lorenz Holzner, Hans-Henning Kunz, and Heinrich Jung. The rnd efflux system parxy affects siderophore secretion in pseudomonas putida kt2440. Dec 2023. URL: https://doi.org/10.1128/spectrum.02300-23, doi:10.1128/spectrum.02300-23. This article has 8 citations and is from a domain leading peer-reviewed journal.

  19. (barrientosmoreno2019argininebiosynthesismodulates media bdcc705a): Laura Barrientos-Moreno, María Antonia Molina-Henares, Marta Pastor-García, María Isabel Ramos-González, and Manuel Espinosa-Urgel. Arginine biosynthesis modulates pyoverdine production and release in pseudomonas putida as part of the mechanism of adaptation to oxidative stress. Journal of Bacteriology, Nov 2019. URL: https://doi.org/10.1128/jb.00454-19, doi:10.1128/jb.00454-19. This article has 44 citations and is from a peer-reviewed journal.

Artifacts

Citations

  1. rice2010characterizationofan pages 37-42
  2. chocklett2009biochemicalcharacterizationof pages 20-25
  3. rice2010characterizationofan pages 24-27
  4. barrientosmoreno2019argininebiosynthesismodulates pages 8-10
  5. stein2023therndefflux pages 2-5
  6. stein2023therndefflux pages 8-10
  7. stein2023therndefflux pages 10-13
  8. manko2024pvdlorchestratesthe pages 1-2
  9. schalk2025bacterialsiderophoresdiversity pages 4-7
  10. manko2024pvdlorchestratesthe pages 13-14
  11. schalk2025bacterialsiderophoresdiversity pages 23-27
  12. stein2023therndefflux pages 1-2
  13. https://doi.org/10.1128/jb.00454-19.
  14. https://doi.org/10.3390/ijms231911507.
  15. https://doi.org/10.1038/s41579-024-01090-6.
  16. https://doi.org/10.3390/ijms25116013.
  17. https://doi.org/10.1128/spectrum.02300-23.
  18. https://doi.org/10.1038/s42003-024-05995-z.
  19. https://doi.org/10.1128/spectrum.02300-23
  20. https://doi.org/10.1038/s42003-024-05995-z
  21. https://doi.org/10.3390/ijms25116013
  22. https://doi.org/10.3390/ijms231911507
  23. https://doi.org/10.1128/jb.00454-19
  24. https://doi.org/10.1038/s41579-024-01090-6
  25. https://doi.org/10.3390/ijms231911507,
  26. https://doi.org/10.1128/jb.00454-19,
  27. https://doi.org/10.1038/s41579-024-01090-6,
  28. https://doi.org/10.3390/ijms25116013,
  29. https://doi.org/10.1128/spectrum.02300-23,

Manual

(pvdA-deep-research-manual.md)
Deep Research on pvdA in *Pseudomonas putida* KT2440 Manual

Deep Research on pvdA in Pseudomonas putida KT2440

Identity and Functional Transfer

pvdA in KT2440 (PP_3796, UniProt Q88GC8) is best interpreted as the KT2440 ortholog of the well-characterized pyoverdine biosynthetic ornithine hydroxylase PvdA. UniProt names the protein L-ornithine 5-monooxygenase and places it in the lysine N(6)-hydroxylase/L-ornithine N(5)-oxygenase family [file:PSEPK/pvdA/pvdA-uniprot.txt "DE SubName: Full=L-ornithine 5-monooxygenase"; file:PSEPK/pvdA/pvdA-uniprot.txt "CC -!- SIMILARITY: Belongs to the lysine N(6)-hydroxylase/L-ornithine N(5)-oxygenase family."]. The matched PANTHER subfamily also contains reviewed bacterial pvdA entries from Pseudomonas aeruginosa (Q51548) and Burkholderia cepacia (O51940), which makes orthology-based transfer of the core molecular function conservative rather than speculative [file:interpro/panther/PTHR42802/PTHR42802-entries.csv "Q51548,L-ornithine N(5)-monooxygenase"; file:interpro/panther/PTHR42802/PTHR42802-entries.csv "O51940,L-ornithine N(5)-monooxygenase"].

Biochemical Function

The central enzymatic role of PvdA is well established in homologous systems. In P. aeruginosa, pvdA encodes the enzyme that hydroxylates ornithine early in pyoverdine assembly PMID:8106324. Disruption of pvdA abolishes pyoverdine synthesis and is rescued by feeding L-N5-OH-Orn, which is exactly the phenotype expected for a dedicated ornithine hydroxylase in the pyoverdine pathway PMID:8106324.

Purified PvdA is a flavin-dependent monooxygenase that specifically uses NADPH and FAD [PMID:17015659 "Formation of the iron-chelating hydroxamate functional group in pyoverdine requires the enzyme PvdA, a flavin-dependent monooxygenase that catalyzes the N(5) hydroxylation of l-ornithine."; PMID:17015659 "The enzyme is specific for NADPH and flavin adenine dinucleotide (FAD(+)) as cofactors, as it cannot utilize NADH and flavin mononucleotide."]. Structural work places PvdA among the class B flavoprotein monooxygenases and shows the expected FAD/NADPH-binding architecture plus a substrate-binding domain [PMID:21757711 "PvdA belongs to the class B flavoprotein monooxygenases, which catalyze the oxidation of substrates using NADPH as the electron donor and molecular oxygen."; PMID:21757711 "PvdA has the two expected Rossmann-like dinucleotide-binding domains for FAD and NADPH and also a substrate-binding domain, with the active site at the interface between the three domains."].

Localization and Cellular Organization

The safest cellular component conclusion is that PvdA is a cytoplasmic pyoverdine biosynthetic enzyme with additional membrane association. A fluorescence-localization study explicitly describes PvdA as one of the initial enzymes in the biosynthetic pathway of PVDI in the cytoplasm PMID:22498339. At the same time, membrane-association studies showed that PvdA has a membrane-bound fraction and that its N-terminal segment has a structural role without behaving as a stable transmembrane anchor [PMID:18757814 "Cell fractionation and proteinase K accessibility experiments in P. aeruginosa confirmed the membrane-bound nature of PvdA, but excluded the transmembrane topology of its N-terminal hydrophobic region."; PMID:22498339 "Cellular fractionation indicated that a substantial amount of PvdA-YFP was located in the membrane fraction."].

For KT2440, direct localization data for Q88GC8 are not in hand, so a conservative curation choice is GO:0005737 cytoplasm, while leaving stronger membrane terms for future strain-specific experiments.

KT2440 Pathway Context

Independent KT2440 studies establish that pyoverdine is a real and important siderophore in this strain. Structural analysis showed that KT2440 produces a characterized pyoverdine and that no second siderophore was detected in that work PMID:19459056. Pyoverdine secretion is stimulated by iron limitation, and impaired secretion reduces growth under iron limitation [PMID:30346656 "Expression from the respective promoters is stimulated by iron limitation albeit to varying degrees."; PMID:30346656 "Deletion of pvdRT-opmQ leads to reduced amounts of pyoverdine in the medium and decreased growth under iron limitation."]. Pyoverdine production and release are also tied to oxidative-stress adaptation in KT2440 PMID:31451546.

These KT2440 papers do not directly assay PP_3796, but they establish the organismal context in which a pvdA ortholog should act: pyoverdine biosynthesis and siderophore-mediated iron acquisition under iron limitation.

GO-Curation Implications

The current seeded annotation, GO:0006879 intracellular iron ion homeostasis, is biologically related but too broad for PvdA. PvdA is not a general iron-homeostasis regulator; it is a dedicated pathway enzyme whose direct role is in pyoverdine biosynthesis. The better direct biological-process term is therefore GO:0002049 pyoverdine biosynthetic process.

The key missing molecular-function term is GO:0031172 ornithine N5-monooxygenase activity, supported by the biochemical and structural literature on characterized PvdA homologs. A conservative cellular-component addition is GO:0005737 cytoplasm.

Open Questions

The main unresolved points are strain-specific rather than family-level. It remains worth testing whether KT2440 PvdA has the same degree of membrane association and old-pole clustering described in P. aeruginosa, and whether KT2440 PvdA shows the same tight cofactor coupling and substrate specificity documented biochemically for the PAO1 enzyme.

📚 Additional Documentation

Notes

(pvdA-notes.md)

pvdA Gene Review Notes

Identity and Orthology

  • pvdA (PP_3796, UniProt Q88GC8) is annotated in UniProt as L-ornithine 5-monooxygenase and belongs to the lysine N(6)-hydroxylase/L-ornithine N(5)-oxygenase family [file:PSEPK/pvdA/pvdA-uniprot.txt "DE SubName: Full=L-ornithine 5-monooxygenase"; file:PSEPK/pvdA/pvdA-uniprot.txt "CC -!- SIMILARITY: Belongs to the lysine N(6)-hydroxylase/L-ornithine N(5)-oxygenase family."].
  • The matched PANTHER subfamily (PTHR42802:SF1) contains reviewed bacterial pvdA proteins from Pseudomonas aeruginosa (Q51548) and Burkholderia cepacia (O51940), supporting conservative transfer of the core enzyme function to KT2440 [file:interpro/panther/PTHR42802/PTHR42802-entries.csv "Q51548,L-ornithine N(5)-monooxygenase"; file:interpro/panther/PTHR42802/PTHR42802-entries.csv "O51940,L-ornithine N(5)-monooxygenase"].

Enzymatic Function

  • PvdA catalyzes L-ornithine N5 hydroxylation, an early committed step in pyoverdine biosynthesis PMID:8106324.
  • Loss of pvdA abolishes pyoverdine synthesis in the homologous P. aeruginosa system and can be rescued by the hydroxylated precursor, directly tying the enzyme to pyoverdine biosynthesis rather than general iron physiology PMID:8106324.
  • Purified PvdA is a flavin-dependent monooxygenase that specifically uses NADPH and FAD [PMID:17015659 "Formation of the iron-chelating hydroxamate functional group in pyoverdine requires the enzyme PvdA, a flavin-dependent monooxygenase that catalyzes the N(5) hydroxylation of l-ornithine."; PMID:17015659 "The enzyme is specific for NADPH and flavin adenine dinucleotide (FAD(+)) as cofactors, as it cannot utilize NADH and flavin mononucleotide."; PMID:21757711 "The ornithine hydroxylase from Pseudomonas aeruginosa (PvdA) catalyzes the FAD-dependent hydroxylation of the side chain amine of ornithine, which is subsequently formylated to generate the iron-chelating hydroxamates of the siderophore pyoverdin."].

Localization and Cell Biology

  • The conservative localization call is cytoplasm: PvdA is described as one of the initial enzymes in the biosynthetic pathway of PVDI in the cytoplasm PMID:22498339.
  • There is also evidence for membrane association and spatial organization, so plasma membrane is plausible biology but not the safest core term to transfer directly to KT2440 without gene-specific localization data [PMID:18757814 "Cell fractionation and proteinase K accessibility experiments in P. aeruginosa confirmed the membrane-bound nature of PvdA, but excluded the transmembrane topology of its N-terminal hydrophobic region."; PMID:22498339 "Cellular fractionation indicated that a substantial amount of PvdA-YFP was located in the membrane fraction."].

KT2440 Context

  • P. putida KT2440 produces a characterized pyoverdine and no second siderophore was detected in the cited structural study PMID:19459056.
  • Pyoverdine secretion in KT2440 is iron responsive and contributes to growth under iron limitation [PMID:30346656 "Expression from the respective promoters is stimulated by iron limitation albeit to varying degrees."; PMID:30346656 "Deletion of pvdRT-opmQ leads to reduced amounts of pyoverdine in the medium and decreased growth under iron limitation."].
  • Pyoverdine turnover is physiologically important in KT2440 and linked to oxidative-stress adaptation PMID:31451546.

Curation Takeaways

  • The seeded TreeGrafter term GO:0006879 intracellular iron ion homeostasis is too broad for a dedicated pathway enzyme. The direct process term should be GO:0002049 pyoverdine biosynthetic process [PMID:8106324 "The enzyme L-ornithine N5-oxygenase catalyzes the hydroxylation of L-ornithine (L-Orn), which represents an early step in the biosynthesis of the peptidic moiety of the fluorescent siderophore pyoverdin in Pseudomonas aeruginosa."; PMID:19459056 "Structural analysis of the pyoverdine produced by the closely related P. putida KT2440 showed that this strain produces an already characterised pyoverdine, but different from P. entomophila, and no evidence was found for the production of a second siderophore."].
  • The core missing MF term is GO:0031172 ornithine N5-monooxygenase activity [PMID:17015659 "Formation of the iron-chelating hydroxamate functional group in pyoverdine requires the enzyme PvdA, a flavin-dependent monooxygenase that catalyzes the N(5) hydroxylation of l-ornithine."; PMID:21757711 "The ornithine hydroxylase from Pseudomonas aeruginosa (PvdA) catalyzes the FAD-dependent hydroxylation of the side chain amine of ornithine, which is subsequently formylated to generate the iron-chelating hydroxamates of the siderophore pyoverdin."].
  • Conservative CC addition is GO:0005737 cytoplasm; I would not make plasma membrane a core KT2440 annotation without direct localization data in this strain [PMID:22498339 "generate P.aeruginosa strains producing fluorescent fusions with PvdA, one of the initial enzymes in the biosynthetic pathway of PVDI in the cytoplasm"; PMID:18757814 "The inferred topological model resembled a eukaryotic reverse signal-anchor (type III) protein, with a single N-terminal domain anchored to the inner membrane, and the bulk of the protein spanning the cytosol."].

Bioreason Rl Predictions

(pvdA-bioreason-rl-predictions.md)

BioReason Chat Export

Exported on March 22, 2026 at 02:31 AM


Organism: Pseudomonas putida

Sequence:

MSQSSQQETIKDMIGVGFGPSNLALAIALEELAESRGHALDALFIDKQQDYHWHGETLATQSELQISFLKDLVSLRTPTSPYSFVNYLHQKQRLADFINLGTFYPCRLEYNDYLRWAAEHFTSQAVYGQEVLRIEPHVHAGRVQHLCVITRDRQGREYSRPTRSVVVGSGGTPKIPENFGAFKDDPRVFHHSQYLSSLTKLPCTAGKPMRIAVIGSGQSAAEAFIDLNDSYPSVKVDMILRGSALKPADDSPFVNEIFSPDYTDLVYNEPADQRSKLLGEYHNTNYSVVDLNLIERIYGILYRQKVAHQHRHNVLCRRQVEAVVATREGLELTLRDLATGQQQTHRYDAVILATGYERRSHRELLAPLADYLEDFSVDRNYRVLASPDLQASVYLQGFCESSHGLSDTLLSVLPTRAAEIGRALYQDLEQLHEKPQAAVALTRA

Thinking Trace

I begin with the InterPro architecture. The sequence is dominated by IPR025700 (L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase family) spanning residues 3–428, a hallmark of soluble flavin-dependent amine monooxygenases that hydroxylate basic amino acids. This family assignment is reinforced by IPR036188 (FAD/NAD(P)-binding domain superfamily) extending from residues 8–440, indicating a Rossmann-like fold that binds FAD and often exchanges reducing equivalents with NAD(P)H. The near-full-length coverage of both signatures establishes a soluble FAD-enzyme core without transmembrane elements or signal peptides, pointing to a cytosolic enzyme that executes oxidative N-hydroxylation chemistry.

From this architecture, the molecular function follows. Members of the IPR025700 family catalyze flavin-mediated monooxygenation of primary aliphatic amino groups on lysine or ornithine scaffolds. The FAD/NAD(P)-binding superfamily domain provides the redox relay that activates molecular oxygen at the flavin cofactor. This causes hydroxylation of a bound diamine/trimine substrate—here tuned by the L-lysine 6-monooxygenase chemistry—to yield L-beta-hydroxylysine. The mechanistic hallmarks (FAD-dependent oxygen activation, substrate hydroxylation on an amino acid backbone) align with GO:0016705 oxidoreductase activity, acting on paired donors with incorporation or reduction of molecular oxygen.

Linking function to process, L-beta-hydroxylysine production in soil bacteria ties into lysine utilization and nitrogen flux. By converting free lysine into a hydroxylated derivative, the enzyme channels carbon and nitrogen through downstream catabolic or salvage routes. This situates the enzyme in lysine-centered metabolism, consistent with the biological process of lysine metabolic process.

Cellular location is inferred from the soluble, cofactor-binding architecture and the absence of targeting signals. A soluble FAD monooxygenase of this sort operates in the cytoplasm, where amino acid pools and redox cofactors are managed; thus the cellular component is the cytoplasm.

A coherent mechanistic hypothesis emerges: the enzyme binds FAD in a Rossmann-like core (residues 8–440), receives electrons from NAD(P)H, activates O2, and hydroxylates the epsilon-amino group of L-lysine within a basic-amino-acid pocket shaped by the IPR025700 family scaffold (residues 3–428). In Pseudomonas putida and related Arthrobacter lineages, this chemistry integrates lysine catabolism with broader nitrogen economy in nutrient-rich soils. Likely interaction partners include cytosolic redox and amino-acid-metabolism hubs: NADPH-supplying dehydrogenases (e.g., glucose-6-phosphate dehydrogenase), glutathione-dependent systems that buffer flavin redox states, and lysine-pathway enzymes that hand off L-beta-hydroxylysine. Together these associations would stabilize the monooxygenase cycle and coordinate flux through lysine metabolism in the cytoplasm.

Functional Summary

A soluble flavin-dependent monooxygenase in soil bacteria that uses a Rossmann-like FAD-binding core to hydroxylate the epsilon-amino group of L-lysine, generating L-beta-hydroxylysine in the cytoplasm. By coupling electron transfer from cellular redox systems to oxygen activation, it modifies lysine for downstream utilization, thereby integrating nitrogen and amino-acid metabolism in nutrient-rich environments.

UniProt Summary

Catalyzes the formation of L-beta-hydroxylysine from L-lysine.

InterPro Domains

  • L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase (IPR025700, family) — residues 3-428
  • FAD/NAD(P)-binding domain superfamily (IPR036188, homologous_superfamily) — residues 8-440

GO Terms

Molecular Function: molecular_function (GO:0003674), catalytic activity (GO:0003824), oxidoreductase activity (GO:0016491), monooxygenase activity (GO:0004497), oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (GO:0016705), oxidoreductase activity, acting on single donors with incorporation of molecular oxygen (GO:0016701), oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen (GO:0016709)

Biological Process: biological_process (GO:0008150), metabolic process (GO:0008152), cellular process (GO:0009987), biosynthetic process (GO:0009058), cellular metabolic process (GO:0044237), secondary metabolic process (GO:0019748), organic substance metabolic process (GO:0071704), nitrogen compound metabolic process (GO:0006807), siderophore metabolic process (GO:0009237), secondary metabolite biosynthetic process (GO:0044550), cellular biosynthetic process (GO:0044249), cellular nitrogen compound metabolic process (GO:0034641), amide metabolic process (GO:0043603), organonitrogen compound metabolic process (GO:1901564), organic substance biosynthetic process (GO:1901576), organonitrogen compound biosynthetic process (GO:1901566), amide biosynthetic process (GO:0043604), cellular nitrogen compound biosynthetic process (GO:0044271), peptide metabolic process (GO:0006518), siderophore biosynthetic process (GO:0019290), peptide biosynthetic process (GO:0043043), nonribosomal peptide biosynthetic process (GO:0019184)

Cellular Component: cellular_component (GO:0005575), cellular anatomical entity (GO:0110165), cytoplasm (GO:0005737), intracellular anatomical structure (GO:0005622)


Generated by BioReason

Bioreason Rl Review

(pvdA-bioreason-rl-review.md)

BioReason-Pro RL Review: pvdA (P. putida)

Source: pvdA-bioreason-rl-predictions.md

  • Correctness: 2/5
  • Completeness: 2/5

Functional Summary Review

The BioReason functional summary describes pvdA as:

A soluble flavin-dependent monooxygenase in soil bacteria that uses a Rossmann-like FAD-binding core to hydroxylate the epsilon-amino group of L-lysine, generating L-beta-hydroxylysine in the cytoplasm. By coupling electron transfer from cellular redox systems to oxygen activation, it modifies lysine for downstream utilization, thereby integrating nitrogen and amino-acid metabolism in nutrient-rich environments.

This summary contains a major substrate error:

  1. Wrong substrate: The summary says pvdA hydroxylates L-lysine to produce L-beta-hydroxylysine. In reality, pvdA is an ornithine N5-monooxygenase that hydroxylates L-ornithine, not L-lysine. The curated review assigns GO:0031172 (ornithine N5-monooxygenase activity) as the core molecular function. The InterPro family IPR025700 is described as "L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase," but BioReason chose the wrong member of this ambiguous family designation.

  2. Wrong pathway context: The summary places pvdA in "lysine catabolism" and "nitrogen economy in nutrient-rich soils." In reality, pvdA is a dedicated pyoverdine biosynthetic enzyme. The hydroxylation of L-ornithine is an early step in pyoverdine (siderophore) assembly, specifically generating a precursor required for hydroxamate formation. The curated review places pvdA in GO:0002049 (pyoverdine biosynthetic process).

  3. Missing siderophore/iron acquisition context: Pyoverdine is the characterized siderophore produced by P. putida KT2440 under iron limitation. pvdA's function is directly linked to iron acquisition, not general nitrogen metabolism.

  4. FAD/NADPH dependence correctly identified: The cofactor requirements are accurately described.

  5. Cytoplasmic localization: Likely correct, though the curated review notes uncertainty about whether pvdA becomes membrane-associated during active pyoverdine synthesis.

Comparison with interpro2go:

pvdA has no GO_REF:0000002 annotations in the curated review. BioReason's GO predictions include siderophore biosynthetic process (GO:0019290) and nonribosomal peptide biosynthetic process (GO:0019184), which are correct and more accurate than the functional summary narrative. This is yet another case where the GO predictions are substantially better than the narrative. The disconnect is stark -- the GO terms correctly identify the siderophore context while the narrative discusses lysine catabolism.

Notes on thinking trace

The trace correctly identifies IPR025700 (L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase) and IPR036188 (FAD/NAD(P)-binding domain superfamily). However, it resolves the ambiguous family to L-lysine rather than L-ornithine, likely because the InterPro name lists lysine first. BioReason's model-generated UniProt-style section repeats the same L-beta-hydroxylysine claim; it is not imported UniProt evidence. The actual P. putida KT2440 pvdA is an ornithine hydroxylase based on pathway context and homology to characterized pvdA enzymes (PMID:17015659, PMID:8106324).

📄 View Raw YAML

id: Q88GC8
gene_symbol: pvdA
product_type: PROTEIN
status: COMPLETE
taxon:
  id: NCBITaxon:160488
  label: Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
description: >-
  PvdA is the likely KT2440 ortholog of the pyoverdine biosynthetic ornithine
  N5-monooxygenase. By homology to experimentally characterized PvdA proteins,
  it is an FAD- and NADPH-dependent enzyme that hydroxylates L-ornithine early
  in pyoverdine assembly, generating a precursor required for hydroxamate
  formation. In Pseudomonas putida KT2440, pyoverdine is the characterized
  siderophore produced under iron limitation, so PvdA is best interpreted as a
  dedicated pyoverdine-biosynthetic enzyme rather than as a general iron
  homeostasis factor.
existing_annotations:
- term:
    id: GO:0006879
    label: intracellular iron ion homeostasis
  evidence_type: IEA
  original_reference_id: GO_REF:0000118
  review:
    summary: >-
      This TreeGrafter annotation points to the downstream physiological role of
      pyoverdine in iron acquisition, but it does not capture PvdA's direct
      function. PvdA is the dedicated ornithine N5-monooxygenase of the
      pyoverdine pathway, and KT2440 pyoverdine production under iron limitation
      is experimentally established at the strain level.
    action: MODIFY
    reason: >-
      GO:0006879 is too broad and indirect for a pathway enzyme. The more
      precise direct process term is GO:0002049 pyoverdine biosynthetic process.
    proposed_replacement_terms:
    - id: GO:0002049
      label: pyoverdine biosynthetic process
    additional_reference_ids:
    - PMID:19459056
    - PMID:30346656
    - file:PSEPK/pvdA/pvdA-deep-research-manual.md
    - file:PSEPK/pvdA/pvdA-deep-research-falcon.md
    supported_by:
    - reference_id: PMID:8106324
      supporting_text: "The enzyme L-ornithine N5-oxygenase catalyzes the hydroxylation of L-ornithine (L-Orn), which represents an early step in the biosynthesis of the peptidic moiety of the fluorescent siderophore pyoverdin in Pseudomonas aeruginosa."
    - reference_id: PMID:19459056
      supporting_text: "Structural analysis of the pyoverdine produced by the closely related P. putida KT2440 showed that this strain produces an already characterised pyoverdine, but different from P. entomophila, and no evidence was found for the production of a second siderophore."
    - reference_id: PMID:30346656
      supporting_text: "Fluorescent pseudomonads produce and secrete a siderophore termed pyoverdine to capture iron when it becomes scarce."
    - reference_id: file:PSEPK/pvdA/pvdA-deep-research-manual.md
      supporting_text: "The current seeded annotation, `GO:0006879 intracellular iron ion homeostasis`, is biologically related but too broad for PvdA."
    - reference_id: file:PSEPK/pvdA/pvdA-deep-research-falcon.md
      supporting_text: "PvdA functions in the **cytoplasmic phase** of **pyoverdine siderophore biosynthesis**, supplying a modified amino acid building block needed by the **NRPS assembly line**."
- term:
    id: GO:0002049
    label: pyoverdine biosynthetic process
  evidence_type: ISS
  original_reference_id: PMID:8106324
  review:
    summary: >-
      Proposed new BP annotation. PvdA catalyzes an early committed reaction in
      pyoverdine assembly, and loss of pvdA in homologous systems abolishes
      pyoverdine production unless the hydroxylated precursor is supplied.
    action: NEW
    reason: >-
      This is the direct biological-process annotation for the enzyme and is more
      informative than the broad iron-homeostasis term. Falcon deep research
      confirms PvdA supplies a committed tailoring building block for the
      pyoverdine NRPS assembly line.
    additional_reference_ids:
    - PMID:19459056
    - file:PSEPK/pvdA/pvdA-deep-research-falcon.md
    supported_by:
    - reference_id: PMID:8106324
      supporting_text: "the pvdA mutant obtained by gene disruption also disclosed no pyoverdin synthesis, lacked L-Orn N5-oxygenase activity, was complemented by the cloned pvdA gene, and produced pyoverdin at wild-type levels when fed with the biosynthetic precursor L-N5-OH-Orn."
    - reference_id: PMID:19459056
      supporting_text: "Structural analysis of the pyoverdine produced by the closely related P. putida KT2440 showed that this strain produces an already characterised pyoverdine, but different from P. entomophila, and no evidence was found for the production of a second siderophore."
    - reference_id: file:PSEPK/pvdA/pvdA-deep-research-falcon.md
      supporting_text: "**pvdA encodes the enzyme catalyzing the N5-hydroxylation of L-ornithine** to produce **N5-hydroxyornithine**, which is subsequently **formylated by PvdF** to yield **N5-formyl-N5-hydroxyornithine (L-fOHOrn)**."
- term:
    id: GO:0031172
    label: ornithine N5-monooxygenase activity
  evidence_type: ISS
  original_reference_id: PMID:17015659
  review:
    summary: >-
      Proposed new MF annotation. PvdA is the dedicated flavin-dependent
      ornithine N5-monooxygenase that initiates hydroxamate formation during
      pyoverdine synthesis.
    action: NEW
    reason: >-
      This is the core catalytic activity of PvdA and the most informative
      molecular-function term for the KT2440 ortholog. The GO definition of
      GO:0031172 (L-ornithine + O2 + H+ = N5-hydroxy-L-ornithine + H2O) matches
      the reaction PvdA catalyzes, and falcon deep research places it in the
      Class B flavoprotein (FAD + O2 + NADPH) N-hydroxylating monooxygenase
      family. The UniProtKB-KW IEA term GO:0016491 oxidoreductase activity is a
      true but uninformative parent of this activity.
    additional_reference_ids:
    - PMID:21757711
    - file:PSEPK/pvdA/pvdA-deep-research-manual.md
    - file:PSEPK/pvdA/pvdA-deep-research-falcon.md
    supported_by:
    - reference_id: PMID:17015659
      supporting_text: "Formation of the iron-chelating hydroxamate functional group in pyoverdine requires the enzyme PvdA, a flavin-dependent monooxygenase that catalyzes the N(5) hydroxylation of l-ornithine."
    - reference_id: PMID:21757711
      supporting_text: "The ornithine hydroxylase from Pseudomonas aeruginosa (PvdA) catalyzes the FAD-dependent hydroxylation of the side chain amine of ornithine, which is subsequently formylated to generate the iron-chelating hydroxamates of the siderophore pyoverdin."
    - reference_id: file:PSEPK/pvdA/pvdA-deep-research-manual.md
      supporting_text: "The key missing molecular-function term is `GO:0031172 ornithine N5-monooxygenase activity`, supported by the biochemical and structural literature on characterized PvdA homologs."
    - reference_id: file:PSEPK/pvdA/pvdA-deep-research-falcon.md
      supporting_text: "dependence on **FAD** as a flavin cofactor and **molecular oxygen** as the oxygen donor, proceeding through **C4a-peroxy/hydroperoxyflavin** intermediates that effect oxygen transfer to the substrate amine"
- term:
    id: GO:0005737
    label: cytoplasm
  evidence_type: ISS
  original_reference_id: PMID:22498339
  review:
    summary: >-
      Proposed new CC annotation. Homolog studies place PvdA among the
      cytoplasmic enzymes of the pyoverdine pathway, although some membrane
      association and polar clustering have also been observed. Falcon deep
      research reinforces that pyoverdine biosynthesis initiates in the cytoplasm
      and that PvdA physically interacts with all four pyoverdine NRPSs in a
      membrane-associated multienzyme "siderosome" context.
    action: NEW
    reason: >-
      Cytoplasm is the conservative and best-supported location to annotate the
      KT2440 ortholog. A plasma membrane term would overstate the current
      evidence for this strain, even though PAO1 homolog studies report partial
      membrane association via an N-terminal inner-membrane-anchoring region.
    additional_reference_ids:
    - PMID:18757814
    - file:PSEPK/pvdA/pvdA-deep-research-falcon.md
    supported_by:
    - reference_id: PMID:22498339
      supporting_text: "generate P.aeruginosa strains producing fluorescent fusions with PvdA, one of the initial enzymes in the biosynthetic pathway of PVDI in the cytoplasm"
    - reference_id: PMID:18757814
      supporting_text: "The inferred topological model resembled a eukaryotic reverse signal-anchor (type III) protein, with a single N-terminal domain anchored to the inner membrane, and the bulk of the protein spanning the cytosol."
    - reference_id: file:PSEPK/pvdA/pvdA-deep-research-falcon.md
      supporting_text: "Pyoverdine biosynthesis initiates in the **cytoplasm**"
references:
- id: GO_REF:0000118
  title: TreeGrafter-generated GO annotations
  findings: []
- id: PMID:8106324
  title: Cloning and nucleotide sequence of the pvdA gene encoding the pyoverdin biosynthetic enzyme L-ornithine N5-oxygenase in Pseudomonas aeruginosa.
  full_text_unavailable: true
  findings:
  - statement: PvdA catalyzes ornithine hydroxylation early in pyoverdine biosynthesis
    supporting_text: "The enzyme L-ornithine N5-oxygenase catalyzes the hydroxylation of L-ornithine (L-Orn), which represents an early step in the biosynthesis of the peptidic moiety of the fluorescent siderophore pyoverdin in Pseudomonas aeruginosa."
  - statement: pvdA loss abolishes pyoverdine synthesis and is rescued by N5-hydroxyornithine
    supporting_text: "the pvdA mutant obtained by gene disruption also disclosed no pyoverdin synthesis, lacked L-Orn N5-oxygenase activity, was complemented by the cloned pvdA gene, and produced pyoverdin at wild-type levels when fed with the biosynthetic precursor L-N5-OH-Orn."
- id: PMID:17015659
  title: Heterologous expression, purification, and characterization of an l-ornithine N(5)-hydroxylase involved in pyoverdine siderophore biosynthesis in Pseudomonas aeruginosa.
  full_text_unavailable: true
  findings:
  - statement: PvdA is a flavin-dependent monooxygenase that hydroxylates ornithine
    supporting_text: "Formation of the iron-chelating hydroxamate functional group in pyoverdine requires the enzyme PvdA, a flavin-dependent monooxygenase that catalyzes the N(5) hydroxylation of l-ornithine."
  - statement: PvdA specifically uses NADPH and FAD cofactors
    supporting_text: "The enzyme is specific for NADPH and flavin adenine dinucleotide (FAD(+)) as cofactors, as it cannot utilize NADH and flavin mononucleotide."
- id: PMID:21757711
  title: 'Two structures of an N-hydroxylating flavoprotein monooxygenase: ornithine hydroxylase from Pseudomonas aeruginosa.'
  full_text_unavailable: true
  findings:
  - statement: PvdA is a class B flavoprotein monooxygenase
    supporting_text: "PvdA belongs to the class B flavoprotein monooxygenases, which catalyze the oxidation of substrates using NADPH as the electron donor and molecular oxygen."
  - statement: PvdA has Rossmann-like FAD and NADPH binding domains
    supporting_text: "PvdA has the two expected Rossmann-like dinucleotide-binding domains for FAD and NADPH and also a substrate-binding domain, with the active site at the interface between the three domains."
- id: PMID:18757814
  title: Membrane-association determinants of the omega-amino acid monooxygenase PvdA, a pyoverdine biosynthetic enzyme from Pseudomonas aeruginosa.
  full_text_unavailable: true
  findings:
  - statement: PvdA provides an essential enzymic function in pyoverdine biogenesis
    supporting_text: "The L-ornithine N(delta)-oxygenase PvdA catalyses the N(delta)-hydroxylation of L-ornithine in many Pseudomonas spp., and thus provides an essential enzymic function in the biogenesis of the pyoverdine siderophore."
  - statement: PvdA has membrane association but its bulk spans the cytosol
    supporting_text: "The inferred topological model resembled a eukaryotic reverse signal-anchor (type III) protein, with a single N-terminal domain anchored to the inner membrane, and the bulk of the protein spanning the cytosol."
- id: PMID:22498339
  title: 'High cellular organization of pyoverdine biosynthesis in Pseudomonas aeruginosa: clustering of PvdA at the old cell pole.'
  full_text_unavailable: true
  findings:
  - statement: PvdA is one of the initial cytoplasmic enzymes in pyoverdine biosynthesis
    supporting_text: "generate P.aeruginosa strains producing fluorescent fusions with PvdA, one of the initial enzymes in the biosynthetic pathway of PVDI in the cytoplasm"
  - statement: PvdA can also be recovered in a membrane fraction
    supporting_text: "Cellular fractionation indicated that a substantial amount of PvdA-YFP was located in the membrane fraction."
- id: PMID:19459056
  title: Siderophore-mediated iron acquisition in the entomopathogenic bacterium Pseudomonas entomophila L48 and its close relative Pseudomonas putida KT2440.
  full_text_unavailable: true
  findings:
  - statement: KT2440 produces a characterized pyoverdine and no second siderophore was detected
    supporting_text: "Structural analysis of the pyoverdine produced by the closely related P. putida KT2440 showed that this strain produces an already characterised pyoverdine, but different from P. entomophila, and no evidence was found for the production of a second siderophore."
- id: PMID:30346656
  title: PvdRT-OpmQ and MdtABC-OpmB efflux systems are involved in pyoverdine secretion in Pseudomonas putida KT2440.
  full_text_unavailable: true
  findings:
  - statement: Pyoverdine secretion genes are stimulated by iron limitation in KT2440
    supporting_text: "Expression from the respective promoters is stimulated by iron limitation albeit to varying degrees."
  - statement: Reduced pyoverdine secretion decreases growth under iron limitation
    supporting_text: "Deletion of pvdRT-opmQ leads to reduced amounts of pyoverdine in the medium and decreased growth under iron limitation."
- id: PMID:31451546
  title: Arginine Biosynthesis Modulates Pyoverdine Production and Release in Pseudomonas putida as Part of the Mechanism of Adaptation to Oxidative Stress.
  full_text_unavailable: true
  findings:
  - statement: Defects affecting pyoverdine production increase KT2440 sensitivity to iron limitation
    supporting_text: "Mutants defective in arginine biosynthesis show reduced production and release of the siderophore pyoverdine and altered expression of certain pyoverdine-related genes, resulting in higher sensitivity to iron limitation."
- id: file:PSEPK/pvdA/pvdA-deep-research-manual.md
  title: Deep research on pvdA in Pseudomonas putida KT2440
  findings:
  - supporting_text: Q88GC8 is the KT2440 ortholog of the pyoverdine biosynthetic ornithine hydroxylase PvdA
  - supporting_text: The direct process annotation is pyoverdine biosynthetic process rather than intracellular iron ion homeostasis
  - supporting_text: Cytoplasm is the conservative cellular component call for KT2440 PvdA
- id: file:PSEPK/pvdA/pvdA-deep-research-falcon.md
  title: Falcon deep research on pvdA (Q88GC8 / PP_3796) in Pseudomonas putida KT2440
  findings:
  - supporting_text: "The UniProt accession **Q88GC8** corresponds to **pvdA / PP_3796** from *Pseudomonas putida* strain KT2440 and is functionally described as an **L-ornithine N5-monooxygenase (ornithine hydroxylase)**"
  - supporting_text: "**pvdA encodes the enzyme catalyzing the N5-hydroxylation of L-ornithine** to produce **N5-hydroxyornithine**, which is subsequently **formylated by PvdF** to yield **N5-formyl-N5-hydroxyornithine (L-fOHOrn)**."
  - supporting_text: "PvdA belongs to the **flavin-dependent N-hydroxylating monooxygenase / Class B flavin monooxygenase** family."
  - supporting_text: "dependence on **FAD** as a flavin cofactor and **molecular oxygen** as the oxygen donor, proceeding through **C4a-peroxy/hydroperoxyflavin** intermediates that effect oxygen transfer to the substrate amine"
  - supporting_text: "**substrate binding triggers O2 addition but not flavin reduction**, consistent with gating of the oxidative half-reaction by L-ornithine binding"
  - supporting_text: "PvdA functions in the **cytoplasmic phase** of **pyoverdine siderophore biosynthesis**, supplying a modified amino acid building block needed by the **NRPS assembly line**."
  - supporting_text: "Pyoverdine biosynthesis initiates in the **cytoplasm**"
  - supporting_text: "**PvdA physically interacts with all four pyoverdine NRPSs**"
  - supporting_text: "This is an early, committed tailoring step in pyoverdine assembly."
  - supporting_text: "**pvdA** and **pvdD** expression increased in these mutants, while **pvdE** (an inner-membrane transporter needed for immature pyoverdine handling) decreased"

core_functions:
- molecular_function:
    id: GO:0031172
    label: ornithine N5-monooxygenase activity
  directly_involved_in:
  - id: GO:0002049
    label: pyoverdine biosynthetic process
  locations:
  - id: GO:0005737
    label: cytoplasm
  supported_by:
  - reference_id: PMID:17015659
    supporting_text: "Formation of the iron-chelating hydroxamate functional group in pyoverdine requires the enzyme PvdA, a flavin-dependent monooxygenase that catalyzes the N(5) hydroxylation of l-ornithine."
  - reference_id: PMID:8106324
    supporting_text: "The enzyme L-ornithine N5-oxygenase catalyzes the hydroxylation of L-ornithine (L-Orn), which represents an early step in the biosynthesis of the peptidic moiety of the fluorescent siderophore pyoverdin in Pseudomonas aeruginosa."
  - reference_id: file:PSEPK/pvdA/pvdA-deep-research-falcon.md
    supporting_text: "PvdA functions in the **cytoplasmic phase** of **pyoverdine siderophore biosynthesis**, supplying a modified amino acid building block needed by the **NRPS assembly line**."
  description: >-
    PvdA is the KT2440 ornithine N5-monooxygenase. It uses FAD and NADPH to
    hydroxylate L-ornithine, generating a precursor required for pyoverdine
    hydroxamate formation during siderophore biosynthesis under iron
    limitation.

suggested_questions:
- question: >-
    Is KT2440 PvdA predominantly soluble-cytoplasmic or does it become
    membrane-associated and old-pole clustered during active pyoverdine
    synthesis, as described for the PAO1 homolog?
  experts:
  - Ignacio J. Schalk
  - Holger Jung
- question: >-
    Does KT2440 PvdA show the same strict ornithine specificity and NADPH/FAD
    coupling behavior reported for the PAO1 enzyme, or are there strain-specific
    kinetic differences?
  experts:
  - Sharon Y. N. Seah
  - Anne L. Lamb

suggested_experiments:
- hypothesis: >-
    PP_3796 is the dedicated ornithine N5-monooxygenase required for KT2440
    pyoverdine biosynthesis.
  description: >-
    Construct a clean pvdA deletion or catalytic-site mutant in KT2440, measure
    pyoverdine fluorescence and LC-MS profiles under iron limitation, and test
    rescue with plasmid-borne pvdA or exogenous N5-hydroxyornithine.
  experiment_type: genetics and metabolite rescue
- hypothesis: >-
    KT2440 PvdA undergoes regulated membrane association during active
    pyoverdine production.
  description: >-
    Build a chromosomal fluorescent or epitope-tagged PvdA allele, then compare
    localization and fractionation patterns in iron-replete versus iron-limited
    growth while quantifying pyoverdine output.
  experiment_type: localization and cell biology