rpoS

UniProt ID: Q88ME8
Organism: Pseudomonas putida KT2440
Review Status: DRAFT
Aliases:
PP_1623 Sigma S Sigma-38
📝 Provide Detailed Feedback

Gene Description

Stationary-phase sigma factor that reprograms RNA polymerase promoter specificity during carbon starvation and general stress adaptation in Pseudomonas putida KT2440. RpoS is a sigma-70 family alternative sigma factor that drives transcription initiation at stationary- and stress-associated promoters, supports starvation survival and cross-protection, and also contributes to condition-specific lifestyle outputs such as biofilm-associated c-di-GMP signaling.

Proposed New Ontology Terms

stationary-phase sigma factor activity

Definition: A sigma factor activity that redirects bacterial RNA polymerase to promoters used during stationary phase and general stress adaptation.

Justification: GO:0016987 captures sigma factor activity broadly, but does not distinguish RpoS-like alternative sigma factors dedicated to stationary-phase and general stress transcriptional programs.

Parent term: sigma factor activity

Supporting Evidence:

Existing Annotations Review

GO Term Evidence Action Reason
GO:0003677 DNA binding
IEA
GO_REF:0000120 		MARK AS OVER ANNOTATED
Summary: This term is not entirely wrong because RpoS contributes promoter recognition within RNA polymerase holoenzyme, but it is too generic and potentially misleading as a standalone molecular function. The specific core activity is sigma factor activity, which already captures promoter-specific DNA recognition more accurately.
Supporting Evidence:
file:PSEPK/rpoS/rpoS-notes.md
GO:0003677 DNA binding is too generic for a sigma factor whose core activity is promoter specificity within RNA polymerase holoenzyme rather than a standalone DNA-binding regulator.
file:PSEPK/rpoS/rpoS-deep-research-falcon.md
as a group 2 sigma factor, it binds core RNAP and recognizes promoters similar to RpoD
GO:0003700 DNA-binding transcription factor activity
IEA
GO_REF:0000002 		MODIFY
Summary: The overall idea that RpoS is a transcriptional regulatory factor is sound, but this GO term is too generic for a bacterial sigma factor. GO:0016987 sigma factor activity is the precise molecular function for the promoter-specificity subunit of RNA polymerase.
Reason: Sigma factor activity is the exact and more informative child term for RpoS.
Proposed replacements: sigma factor activity
Supporting Evidence:
file:PSEPK/rpoS/rpoS-notes.md
GO:0016987 sigma factor activity is the precise molecular function term for RpoS and is more informative than the generic GO:0003700 DNA-binding transcription factor activity.
file:PSEPK/rpoS/rpoS-deep-research-falcon.md
RpoS does **not** catalyze a biochemical reaction and is **not** a transporter. Its primary function is **sequence-specific transcription initiation control**
GO:0005737 cytoplasm
IEA
GO_REF:0000120 		ACCEPT
Summary: This annotation is appropriate. RpoS is a bacterial sigma factor that associates with the cytoplasmic RNA polymerase core enzyme and UniProt places the protein in the cytoplasm.
Supporting Evidence:
file:PSEPK/rpoS/rpoS-uniprot.txt
CC -!- SUBCELLULAR LOCATION: Cytoplasm
file:PSEPK/rpoS/rpoS-deep-research-falcon.md
RpoS is a **cytosolic** transcription factor (sigma factor) that exerts its function by interacting with **cytosolic RNA polymerase** and promoter DNA.
GO:0006352 DNA-templated transcription initiation
IEA
GO_REF:0000120 		ACCEPT
Summary: This is a core process annotation for RpoS. Sigma factors function by redirecting RNA polymerase to specific promoters at transcription initiation, and the KT2440 mutant phenotype is consistent with a broad defect in stationary-phase transcriptional reprogramming.
Supporting Evidence:
file:PSEPK/rpoS/rpoS-deep-research-codex.md
Accept GO:0006352 DNA-templated transcription initiation as the direct process executed by RpoS-containing holoenzyme.
file:PSEPK/rpoS/rpoS-uniprot.txt
CC -!- FUNCTION: Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released.
file:PSEPK/rpoS/rpoS-deep-research-falcon.md
RpoS does **not** catalyze a biochemical reaction and is **not** a transporter. Its primary function is **sequence-specific transcription initiation control**
GO:0006355 regulation of DNA-templated transcription
IEA
GO_REF:0000120 		MODIFY
Summary: RpoS certainly regulates transcription, but this term is broader than necessary. The more specific BP term already present in the GOA set is regulation of DNA-templated transcription initiation, which better reflects how sigma factors act.
Reason: Replace the broad regulation term with the initiation-specific child term.
Supporting Evidence:
file:PSEPK/rpoS/rpoS-notes.md
GO:0006352 DNA-templated transcription initiation and GO:2000142 regulation of DNA-templated transcription initiation capture the direct process-level role better than GO:0006355 regulation of DNA-templated transcription or GO:0010468 regulation of gene expression.
file:PSEPK/rpoS/rpoS-deep-research-falcon.md
as a group 2 sigma factor, it binds core RNAP and recognizes promoters similar to RpoD
GO:0010468 regulation of gene expression
IEA
GO_REF:0000104 		MODIFY
Summary: This annotation is directionally correct but far too general. For RpoS, the relevant direct process is regulation of transcription initiation by alternative sigma factor-dependent promoter selection.
Reason: GO:2000142 gives the correct level of specificity for RpoS.
Supporting Evidence:
file:PSEPK/rpoS/rpoS-notes.md
GO:0006352 DNA-templated transcription initiation and GO:2000142 regulation of DNA-templated transcription initiation capture the direct process-level role better than GO:0006355 regulation of DNA-templated transcription or GO:0010468 regulation of gene expression.
GO:0016987 sigma factor activity
IEA
GO_REF:0000120 		ACCEPT
Summary: This is the most precise core molecular function for RpoS. It captures the promoter-specificity role of the alternative sigma subunit within RNA polymerase holoenzyme and is directly supported by UniProt and the experimental literature on stationary-phase regulation.
Supporting Evidence:
file:PSEPK/rpoS/rpoS-notes.md
GO:0016987 sigma factor activity is the precise molecular function term for RpoS and is more informative than the generic GO:0003700 DNA-binding transcription factor activity.
file:PSEPK/rpoS/rpoS-uniprot.txt
CC -!- SIMILARITY: Belongs to the sigma-70 factor family. RpoS subfamily.
file:PSEPK/rpoS/rpoS-deep-research-falcon.md
RpoS is an alternative sigma factor** (sigma-70 family; “group 2” sigma) that binds the **core RNA polymerase** and redirects transcription to a broad set of promoters that support survival during **stationary phase** and diverse stresses—commonly termed the **general stress response (GSR)**
GO:2000142 regulation of DNA-templated transcription initiation
IEA
GO_REF:0000108 		ACCEPT
Summary: This is the best specific biological-process term among the seeded GOA set. RpoS changes promoter recognition by RNA polymerase and thereby regulates transcription specifically at the initiation step.
Supporting Evidence:
file:PSEPK/rpoS/rpoS-deep-research-codex.md
Accept GO:2000142 regulation of DNA-templated transcription initiation as the best specific regulatory BP term already present.
file:PSEPK/rpoS/rpoS-deep-research-falcon.md
A central concept is **sigma competition**: RpoS competes with the housekeeping sigma **RpoD (σ70)** and other alternative sigmas for a limiting pool of core RNAP.
GO:0042594 response to starvation
IMP
file:PSEPK/rpoS/rpoS-notes.md 		NEW
Summary: The original KT2440 rpoS mutant phenotype directly supports involvement in starvation response. Loss of rpoS reduced survival during carbon starvation, making this a well-supported downstream biological process for the gene.
Reason: This term captures the hallmark stationary-phase and starvation phenotype that is not represented in the seeded GOA set.
Supporting Evidence:
file:PSEPK/rpoS/rpoS-notes.md
In KT2440, the rpoS mutant showed reduced survival of carbon starvation and reduced cross-protection against other types of stress in cells starved for carbon, and RpoS controlled expression of more than 50 peptides after short carbon starvation.
file:PSEPK/rpoS/rpoS-deep-research-falcon.md
RpoS-dependent regulons typically include genes that increase tolerance to oxidative stress, osmotic stress, temperature and pH extremes, and other stationary-phase threats.
GO:0006950 response to stress
IMP
file:PSEPK/rpoS/rpoS-notes.md 		NEW
Summary: RpoS is the master transcriptional regulator of the bacterial general stress response, and in KT2440 its loss reduces cross-protection against multiple stresses in starved cells. This general stress response role is the defining function of RpoS-subfamily sigma factors and complements the more specific response to starvation annotation. Treated as a core downstream process driven by RpoS-dependent promoter reprogramming.
Reason: The general stress response is the canonical RpoS function (master regulator of the stationary phase and general stress response) and is not represented in the seeded GOA set.
Supporting Evidence:
file:PSEPK/rpoS/rpoS-uniprot.txt
This sigma factor is the master transcriptional regulator of the stationary phase and the general stress response.
file:PSEPK/rpoS/rpoS-deep-research-falcon.md
RpoS-dependent regulons typically include genes that increase tolerance to oxidative stress, osmotic stress, temperature and pH extremes, and other stationary-phase threats.
GO:0042710 biofilm formation
IMP
file:PSEPK/rpoS/rpoS-notes.md 		NEW
Summary: Multiple studies place RpoS upstream of biofilm-associated pathways in P. putida, and one recent paper showed direct binding of RpoS to the major wspA promoter with a requirement for tetracycline-induced biofilm formation. This is a justified new annotation, but it should be viewed as a conditional, non-core output of the broader RpoS regulon.
Reason: The seeded GOA set misses a recurrent and directly supported RpoS-dependent lifestyle phenotype.
Supporting Evidence:
file:PSEPK/rpoS/rpoS-notes.md
RpoS directly bound the major wspA promoter and was required for tetracycline to induce wspA activity and promote biofilm formation.
file:PSEPK/rpoS/rpoS-notes.md
Expression of cfcR is transcriptionally regulated by RpoS, and cfcR provides most free c-di-GMP during stationary phase in static conditions.
file:PSEPK/rpoS/rpoS-deep-research-falcon.md
lapF transcription is described as dependent on RpoS in KT2440 biofilm literature

Core Functions

RpoS acts as the alternative sigma subunit that redirects RNA polymerase to stationary-phase and stress-associated promoters, thereby driving promoter-specific transcription initiation and transcription-initiation control during carbon starvation adaptation.

Molecular Function:
sigma factor activity
Directly Involved In:
DNA-templated transcription initiation regulation of DNA-templated transcription initiation response to starvation response to stress
Cellular Locations:
cytoplasm
Supporting Evidence:
  • file:PSEPK/rpoS/rpoS-notes.md
    In KT2440, the rpoS mutant showed reduced survival of carbon starvation and reduced cross-protection against other types of stress in cells starved for carbon, and RpoS controlled expression of more than 50 peptides after short carbon starvation.
  • file:PSEPK/rpoS/rpoS-deep-research-codex.md
    rpoS encodes the stationary-phase sigma factor RpoS (Sigma S, Sigma-38), an alternative sigma-70 family subunit that redirects RNA polymerase to promoters used during stationary phase and stress adaptation.
  • file:PSEPK/rpoS/rpoS-deep-research-falcon.md
    RpoS is an alternative sigma factor** (sigma-70 family; “group 2” sigma) that binds the **core RNA polymerase** and redirects transcription to a broad set of promoters that support survival during **stationary phase** and diverse stresses—commonly termed the **general stress response (GSR)**

RpoS also feeds into condition-specific surface-associated lifestyle programs by activating transcription of biofilm-related targets such as wspA and cfcR, but this should be viewed as a non-core pleiotropic extension of the RpoS regulon rather than the primary evolved function of the protein.

Molecular Function:
sigma factor activity
Directly Involved In:
biofilm formation
Cellular Locations:
cytoplasm
Supporting Evidence:
  • file:PSEPK/rpoS/rpoS-notes.md
    RpoS directly bound the major wspA promoter and was required for tetracycline to induce wspA activity and promote biofilm formation.
  • file:PSEPK/rpoS/rpoS-notes.md
    Expression of cfcR is transcriptionally regulated by RpoS, and cfcR provides most free c-di-GMP during stationary phase in static conditions.
  • file:PSEPK/rpoS/rpoS-deep-research-falcon.md
    lapF transcription is described as dependent on RpoS in KT2440 biofilm literature

References

GO_REF:0000002
Gene Ontology annotation through association of InterPro records with GO terms
GO_REF:0000104
Electronic Gene Ontology annotations created by transferring manual GO annotations between related proteins based on shared sequence features
GO_REF:0000108
Automatic assignment of GO terms using logical inference, based on on inter-ontology links
GO_REF:0000120
Combined Automated Annotation using Multiple IEA Methods
PMID:9642197
Cloning, sequencing, and phenotypic characterization of the rpoS gene from Pseudomonas putida KT2440.
PMID:11371535
Regulation of rpoS gene expression in Pseudomonas: involvement of a TetR family regulator.
PMID:11914368
TetR family member psrA directly binds the Pseudomonas rpoS and psrA promoters.
PMID:24488315
Roles of cyclic Di-GMP and the Gac system in transcriptional control of the genes coding for the Pseudomonas putida adhesins LapA and LapF.
PMID:28677348
The Pseudomonas putida CsrA/RsmA homologues negatively affect c-di-GMP pools and biofilm formation through the GGDEF/EAL response regulator CfcR.
PMID:28945818
The promoter region of lapA and its transcriptional regulation by Fis in Pseudomonas putida.
PMID:39589111
Tetracycline induces wsp operon expression to promote biofilm formation in Pseudomonas putida.
file:PSEPK/rpoS/rpoS-notes.md
Curator notes for rpoS in Pseudomonas putida KT2440
  • RpoS is the stationary-phase sigma factor in KT2440 and its loss impairs starvation survival and starvation-associated cross-protection.
    "In KT2440, the rpoS mutant showed reduced survival of carbon starvation and reduced cross-protection against other types of stress in cells starved for carbon, and RpoS controlled expression of more than 50 peptides after short carbon starvation."
  • PsrA directly activates rpoS transcription and binds the rpoS promoter.
    "PsrA binds directly to the rpoS promoter from positions -59 to -35 relative to the transcription start site."
  • RpoS participates in biofilm-associated pathways through wspA, cfcR, lapA, and lapF regulation.
    "RpoS directly bound the major wspA promoter and was required for tetracycline to induce wspA activity and promote biofilm formation."
file:PSEPK/rpoS/rpoS-deep-research-codex.md
Deep research report for rpoS in Pseudomonas putida KT2440
  • The core GO curation should center on sigma factor activity and transcription initiation rather than generic DNA-binding transcription factor terms.
    "Accept GO:0006352 DNA-templated transcription initiation as the direct process executed by RpoS-containing holoenzyme."
  • Response to starvation is a justified new process annotation from the original KT2440 mutant phenotype.
    "Add response to starvation as a justified new BP term supported by the KT2440 mutant phenotype."
file:PSEPK/rpoS/rpoS-uniprot.txt
UniProt entry Q88ME8
  • Q88ME8 is RNA polymerase sigma factor RpoS, a sigma-70 family RpoS-subfamily protein.
    "CC -!- SIMILARITY: Belongs to the sigma-70 factor family. RpoS subfamily."
  • UniProt describes RpoS as the master transcriptional regulator of the stationary phase and the general stress response, localized to the cytoplasm.
    "This sigma factor is the master transcriptional regulator of the stationary phase and the general stress response."
file:PSEPK/rpoS/rpoS-deep-research-falcon.md
Falcon deep research report for rpoS (Q88ME8) in Pseudomonas putida KT2440
  • RpoS is an alternative sigma-70 family (group 2) sigma factor that binds core RNA polymerase and redirects transcription to promoters supporting survival during stationary phase and the general stress response.
    "RpoS is an alternative sigma factor** (sigma-70 family; “group 2” sigma) that binds the **core RNA polymerase** and redirects transcription to a broad set of promoters that support survival during **stationary phase** and diverse stresses—commonly termed the **general stress response (GSR)**"
  • RpoS does not catalyze a biochemical reaction and is not a transporter; its primary function is sequence-specific transcription initiation control.
    "RpoS does **not** catalyze a biochemical reaction and is **not** a transporter. Its primary function is **sequence-specific transcription initiation control**"
  • As a group 2 sigma factor RpoS binds core RNAP and recognizes promoters similar to RpoD, supporting annotation as sigma S rather than an enzyme or transporter.
    "as a group 2 sigma factor, it binds core RNAP and recognizes promoters similar to RpoD"
  • RpoS competes with the housekeeping sigma RpoD for a limiting pool of core RNA polymerase (sigma competition), framing a growth-versus-survival tradeoff.
    "A central concept is **sigma competition**: RpoS competes with the housekeeping sigma **RpoD (σ70)** and other alternative sigmas for a limiting pool of core RNAP."
  • RpoS is a cytosolic transcription factor that exerts its function by interacting with cytosolic RNA polymerase and promoter DNA.
    "RpoS is a **cytosolic** transcription factor (sigma factor) that exerts its function by interacting with **cytosolic RNA polymerase** and promoter DNA."
  • RpoS-dependent regulons increase tolerance to oxidative, osmotic, temperature, and pH stress and other stationary-phase threats.
    "RpoS-dependent regulons typically include genes that increase tolerance to oxidative stress, osmotic stress, temperature and pH extremes, and other stationary-phase threats."
  • In KT2440, RsmA directly binds the rpoS mRNA ribosome-binding site and start codon (confirmed by EMSA), supporting post-transcriptional control of RpoS levels via the Gac/Rsm network.
    "binding of RsmA to an RNA fragment containing the **ribosome-binding site and start codon** of rpoS was confirmed by **EMSA**"
  • In KT2440, lapF transcription is dependent on RpoS and cfcR expression is regulated by RpoS, embedding RpoS in the c-di-GMP-controlled biofilm circuit.
    "lapF transcription is described as dependent on RpoS in KT2440 biofilm literature"
  • Stationary-phase induction does not always imply RpoS activation; the KT2440 K1-T6SS is induced in stationary phase but is not RpoS-dependent and is indirectly repressed by RpoS, defining a boundary of the RpoS regulon.
    "K1-T6SS is induced in stationary phase but is not RpoS-dependent and is indirectly repressed by RpoS"

Suggested Questions for Experts

Q: Which promoters constitute the direct core RpoS regulon in KT2440 during carbon starvation versus antibiotic stress?

Q: How broadly conserved is the direct RpoS control of biofilm genes such as wspA, cfcR, lapA, and lapF across environmental conditions relevant to soil and rhizosphere lifestyles?

Q: Which post-transcriptional regulators beyond PsrA most strongly tune RpoS abundance and activity in KT2440?

Suggested Experiments

Experiment: Perform paired RNA-seq and ChIP-seq or ChIP-exo in wild-type and delta-rpoS cells during exponential growth, early carbon starvation, and stationary phase to separate direct promoter targets from indirect downstream effects.

Hypothesis: The direct KT2440 RpoS regulon during starvation is smaller than the full set of downstream stationary-phase phenotypes.

Type: transcriptomics and DNA-binding profiling

Experiment: Measure biofilm formation, c-di-GMP levels, and promoter activity of wspA, cfcR, lapA, and lapF in wild-type, delta-rpoS, and complemented strains under carbon limitation, tetracycline stress, and rhizosphere-mimicking conditions.

Hypothesis: RpoS-dependent biofilm phenotypes arise from a condition-specific promoter subset rather than a universal biofilm program.

Type: targeted genetics and reporter assays

Experiment: Combine translational rpoS reporter fusions with psrA, hfq, and polyphosphate-pathway perturbations to quantify how transcriptional versus post-transcriptional inputs shape RpoS accumulation across the growth curve.

Hypothesis: Upstream regulators such as PsrA and post-transcriptional factors control RpoS at distinct stages of growth-phase transition.

Type: reporter fusion analysis

Deep Research

Codex

(rpoS-deep-research-codex.md)
Deep research: rpoS in Pseudomonas putida KT2440 Codex

Deep research: rpoS in Pseudomonas putida KT2440

Summary

rpoS encodes the stationary-phase sigma factor RpoS (Sigma S, Sigma-38), an alternative sigma-70 family subunit that redirects RNA polymerase to promoters used during stationary phase and stress adaptation. In P. putida KT2440, the direct experimental core is not an enzymatic stress-defense activity, but promoter-specific transcription initiation and global transcriptional reprogramming during carbon starvation and related stress conditions. [PMID:9642197 Cloning, sequencing, and phenotypic characterization of the rpoS gene from Pseudomonas putida KT2440., "reduced survival of carbon starvation" and "controls the expression of more than 50 peptides"] [file:PSEPK/rpoS/rpoS-uniprot.txt]

Direct evidence for core function

The defining KT2440 paper showed that loss of rpoS reduced survival during carbon starvation, weakened starvation-associated cross-protection, and altered the stationary/starvation proteome. This supports the view that the core GO curation should center on sigma factor activity, DNA-templated transcription initiation, and regulation of transcription initiation during starvation-associated stress adaptation. [PMID:9642197 Cloning, sequencing, and phenotypic characterization of the rpoS gene from Pseudomonas putida KT2440., "reduced survival of carbon starvation and reduced cross-protection against other types of stress in cells starved for carbon" and "controls the expression of more than 50 peptides"]

UniProt is consistent with this assignment, describing Q88ME8 as RNA polymerase sigma factor RpoS, placing it in the sigma-70 family RpoS subfamily, and localizing it to the cytoplasm. [file:PSEPK/rpoS/rpoS-uniprot.txt]

Regulation of rpoS itself

Two early Pseudomonas studies established PsrA as a direct upstream regulator. First, psrA mutants showed a 90% decrease in rpoS promoter activity and lost stationary-phase induction of rpoS. Second, PsrA was shown to bind directly to the rpoS promoter from positions -59 to -35. These papers matter for review because they confirm that rpoS is embedded in a dedicated regulatory cascade rather than acting as a constitutive housekeeping sigma factor. [PMID:11371535 Regulation of rpoS gene expression in Pseudomonas: involvement of a TetR family regulator., "showed a 90% decrease in rpoS promoter activity" and "lost the ability to induce rpoS expression at stationary phase"] [PMID:11914368 TetR family member psrA directly binds the Pseudomonas rpoS and psrA promoters., "PsrA binds from positions -59 to -35 in the rpoS promoter"]

Downstream outputs and non-core biology

Recent work expands the downstream RpoS regulon into surface-associated lifestyles. Under tetracycline stress, RpoS directly bound the major wspA promoter and was required for tetracycline-induced biofilm formation. Independent studies also place RpoS upstream of cfcR and parts of the lapA/lapF adhesin program, linking RpoS to c-di-GMP signaling and biofilm maturation. These are biologically real functions, but they are best treated as conditional or pleiotropic outputs rather than the single core function of RpoS. [PMID:39589111 Tetracycline induces wsp operon expression to promote biofilm formation in Pseudomonas putida., "RpoS directly bound to PwspA" and "RpoS was required for tetracycline to induce PwspA activity and promote biofilm formation"] [PMID:28677348 The Pseudomonas putida CsrA/RsmA homologues negatively affect c-di-GMP pools and biofilm formation through the GGDEF/EAL response regulator CfcR., "Expression of cfcR ... is transcriptionally regulated by RpoS"] [PMID:28945818 The promoter region of lapA and its transcriptional regulation by Fis in Pseudomonas putida., "three of which display moderate RpoS-dependence"] [PMID:24488315 Roles of cyclic Di-GMP and the Gac system in transcriptional control of the genes coding for the Pseudomonas putida adhesins LapA and LapF., "lapF transcription was previously shown to take place at late times of growth and to respond to the stationary-phase sigma factor RpoS"]

GO curation implications

  • Accept GO:0016987 sigma factor activity as the best core molecular function.
  • Accept GO:0006352 DNA-templated transcription initiation as the direct process executed by RpoS-containing holoenzyme.
  • Accept GO:2000142 regulation of DNA-templated transcription initiation as the best specific regulatory BP term already present.
  • Treat GO:0003700 DNA-binding transcription factor activity as too generic and better replaced by sigma factor activity.
  • Treat GO:0006355 regulation of DNA-templated transcription and GO:0010468 regulation of gene expression as overly broad relative to GO:2000142.
  • Add response to starvation as a justified new BP term supported by the KT2440 mutant phenotype.
  • Biofilm formation is supportable but non-core.

Falcon

(rpoS-deep-research-falcon.md)
this with annotations you find in gene/protein databases, but these can be outdated or inaccurate. Falcon Edison Scientific Literature 21 citations 2 artifacts 2026-06-03T05:04:44.366565
Edison artifact artifact-00 (text/markdown)
## Context ID: pqac-00000015 I have extracted Figure 2 from page 4 of the document, which includes both the domain architecture schematic for the different sigm (image/png)

The research report should be a detailed narrative explaining the function, biological processes, and localization of the gene product. Citations should be given for all claims.

You should prioritize authoritative reviews and primary scientific literature when conducting research. You can supplement
this with annotations you find in gene/protein databases, but these can be outdated or inaccurate.

We are specifically interested in the primary function of the gene - for enzymes, what reaction is catalyzed, and what is the substrate specificity? For transporters, what is the substrate? For structural proteins or adapters, what is the broader structural role? For signaling molecules, what is the role in the pathway.

We are interested in where in or outside the cell the gene product carries out its function.

We are also interested in the signaling or biochemical pathways in which the gene functions. We are less interested in broad pleiotropic effects, except where these elucidate the precise role.

Include evidence where possible. We are interested in both experimental evidence as well as inference from structure, evolution, or bioinformatic analysis. Precise studies should be prioritized over high-throughput, where available.

Research Report: Functional annotation of rpoS (PP_1623; UniProt Q88ME8) in Pseudomonas putida KT2440

0) Target identity verification (critical)

The UniProt entry Q88ME8 corresponds to RpoS (sigma S / sigma-38) in Pseudomonas putida strain KT2440 (ordered locus PP_1623). Independent KT2440-specific studies explicitly refer to RpoS as the “stationary-phase sigma factor” and map it to KT2440 regulatory phenotypes, matching the requested target and avoiding confusion with rpoS homologs in other bacteria. (huertasrosales2021genomewideanalysisof pages 9-11, liu2017influenceof(p)ppgpp pages 11-15)

1) Key concepts and definitions (current understanding)

1.1 What RpoS is

RpoS is an alternative sigma factor (sigma-70 family; “group 2” sigma) that binds the core RNA polymerase and redirects transcription to a broad set of promoters that support survival during stationary phase and diverse stresses—commonly termed the general stress response (GSR) in γ-proteobacteria. (bouillet2024rposandthe pages 1-5)

At the mechanistic level, sigma factors contain domains that recognize promoter elements: σ2 and σ4 interact with the −10 and −35 promoter regions; group-1 and group-2 sigma factors also include σ3, which links promoter-recognition functions. This is summarized visually in Bouillet et al. (2024) Figure 2. (bouillet2024rposandthe media f4434c02)

1.2 What RpoS does (primary molecular function)

RpoS does not catalyze a biochemical reaction and is not a transporter. Its primary function is sequence-specific transcription initiation control by:
1) associating with core RNAP, and
2) increasing transcription from a specific class of promoters (often similar to σ70/RpoD promoters), thereby reprogramming gene expression toward stress protection. (bouillet2024rposandthe pages 1-5, bouillet2024rposandthe media f4434c02)

1.3 Sigma competition and the growth–stress tradeoff

A central concept is sigma competition: RpoS competes with the housekeeping sigma RpoD (σ70) and other alternative sigmas for a limiting pool of core RNAP. Increased RpoS generally increases stress resistance but can reduce growth performance—framed as a “growth vs. survival” (SPANC) tradeoff in the RpoS literature. (bouillet2024rposandthe pages 5-7)

2) Regulation of RpoS (with KT2440 evidence emphasized)

2.1 Multi-layer regulation is a defining feature of RpoS biology

In the best-characterized paradigm (E. coli), RpoS induction during nutrient limitation/stress occurs largely through activation of rpoS translation and inhibition of RpoS proteolysis, rather than transcription alone. This reflects a multi-input “signal integration” architecture for GSR activation. (bouillet2024rposandthe pages 1-5)

Although these details are best established in E. coli, they provide strong conserved context for interpreting pseudomonad RpoS systems because RpoS is broadly conserved across many γ-proteobacteria. (bouillet2024rposandthe pages 1-5)

2.2 KT2440: RsmA directly targets rpoS mRNA (post-transcriptional control)

In P. putida KT2440, Huertas-Rosales et al. (2021) provide direct biochemical evidence that RsmA binds rpoS (PP_1623) mRNA: binding of RsmA to an RNA fragment containing the ribosome-binding site and start codon of rpoS was confirmed by EMSA. This supports a model where the Gac/Rsm post-transcriptional network can modulate RpoS levels through translation control. (huertasrosales2021genomewideanalysisof pages 9-11)

A KT2440 study of the stringent response showed that deleting (p)ppGpp synthases (relA and relA/spoT) alters biofilm programs and is accompanied by lowered rpoS expression/activity and downstream changes in RpoS-linked outputs (e.g., lapF). The work used rpoS::lacZ promoter fusions, alongside lapA/lapF reporters and qRT-PCR, placing RpoS downstream of (p)ppGpp-mediated physiology in KT2440 biofilm regulation. (liu2017influenceof(p)ppgpp pages 26-31, liu2017influenceof(p)ppgpp pages 11-15)

3) Cellular localization / where the protein functions

RpoS is a cytosolic transcription factor (sigma factor) that exerts its function by interacting with cytosolic RNA polymerase and promoter DNA. This is consistent with its sigma-factor domain organization and RNAP-binding mechanism. No membrane localization or secretion is implied by the sigma-factor structural model. (bouillet2024rposandthe pages 1-5, bouillet2024rposandthe media f4434c02)

4) Biological processes and pathways controlled by RpoS in P. putida KT2440

4.1 General stress response outputs (conserved categories)

RpoS-dependent regulons typically include genes that increase tolerance to oxidative stress, osmotic stress, temperature and pH extremes, and other stationary-phase threats. Bouillet et al. (2024) summarizes classical protective categories and illustrates that RpoS controls broad stress-protective pathways in γ-proteobacteria. (bouillet2024rposandthe pages 1-5)

4.2 KT2440: biofilm extracellular matrix (ECM) and lifestyle transition

A well-supported KT2440-specific function is RpoS control of biofilm maturation via matrix components:

  • LapF adhesin: lapF transcription is described as dependent on RpoS in KT2440 biofilm literature, and stringent-response perturbations that reduce RpoS activity correlate with strongly reduced lapF reporter output. (liu2017influenceof(p)ppgpp pages 11-15)
  • Pea exopolysaccharide (EPS): in stringent-response mutants, pea transcript abundance was reduced 2.3-fold (ΔrelA) and 5.8-fold (ΔrelAΔspoT; ΔRS) relative to wild type, with associated changes in colony morphology and pellicle architecture; the authors note Pea’s importance in structured/wrinkly colony traits in KT2440. (liu2017influenceof(p)ppgpp pages 11-15)

This supports an interpretation that RpoS helps drive a stationary-phase biofilm/ECM program in KT2440, coordinating adhesins and EPS production. (liu2017influenceof(p)ppgpp pages 11-15)

4.3 KT2440: c-di-GMP signaling via CfcR, with RpoS embedded in the regulatory circuit

Multiple KT2440 studies connect RpoS to c-di-GMP-controlled lifestyle shifts via CfcR, a diguanylate cyclase/response regulator important for stationary-phase c-di-GMP levels:

  • ArgR study: LapF, Pea, and CfcR expression is influenced by ArgR, “likely through the alternative sigma factor RpoS,” linking metabolism to c-di-GMP outputs through RpoS. (barrientosmoreno2022roleofthe pages 1-2)
  • Rsm network study: RpoS is described as controlling lapF expression; and cfcR expression is described as regulated by RpoS, supporting indirect Rsm→RpoS→c-di-GMP control. (huertasrosales2021genomewideanalysisof pages 9-11)
  • Arginine cue study: authors hypothesize that cellular arginine pools connect central metabolism to c-di-GMP turnover and note changes in expression of “RpoS and elements under its control (lapF, pea, cfcR)” in arginine-biosynthesis mutants. (barrientosmoreno2020arginineasan pages 11-12)

Together, these data define a KT2440-specific pathway-level role: RpoS integrates nutrient/stress state into multicellular lifestyle output via ECM genes and the c-di-GMP system. (barrientosmoreno2022roleofthe pages 1-2, huertasrosales2021genomewideanalysisof pages 9-11, barrientosmoreno2020arginineasan pages 11-12)

4.4 Boundaries of the RpoS regulon: stationary-phase induction does not always mean RpoS activation

Bernal et al. (2023) show that the K1 type VI secretion system (T6SS) is induced in stationary phase in KT2440, but its transcription is not dependent on RpoS and is indirectly repressed by RpoS. This cautions against assuming that stationary-phase induction implies direct RpoS positive control and highlights that RpoS can act as an indirect repressor in specific contexts. (bernal2023transcriptionalorganizationand pages 1-2)

5) Recent developments and latest research (prioritizing 2023–2024)

5.1 2024: updated RpoS regulation frameworks (authoritative synthesis)

Bouillet et al. (MMBR, March 2024, https://doi.org/10.1128/mmbr.00151-22) synthesizes “new advances” in how stresses induce RpoS and summarizes approaches used to define RpoS-dependent genes/pathways. Key modern themes relevant for annotation and engineering include: multi-layer control (translation/proteolysis), sigma competition, and heterogeneous regulon outputs. (bouillet2024rposandthe pages 1-5)

The paper’s Figure 2 is a useful up-to-date schematic reference for sigma-factor domain organization and promoter recognition principles that underpin functional inference for Q88ME8. (bouillet2024rposandthe media f4434c02)

5.2 2023: KT2440 regulatory network mapping around plant-protective T6SS

Bernal et al. (Microbiology, Jan 2023, https://doi.org/10.1099/mic.0.001295) delineates a regulatory network for K1-T6SS, important because KT2440 T6SS contributes to outcompetition of phytopathogens (plant protection). While not RpoS-dependent, the system is indirectly repressed by RpoS and regulated by GacS–GacA/RetS, revealing how RpoS intersects with biocontrol-relevant programs. (bernal2023transcriptionalorganizationand pages 1-2)

6) Current applications and real-world implementations

6.1 Biological control / plant protection

KT2440’s K1-T6SS provides competitive advantage by outcompeting phytopathogens, positioning P. putida as a potential biological control agent. The regulatory map (including GacS–GacA activation and RetS repression) provides engineering levers for tuning this behavior; RpoS itself is implicated as an indirect repressor, which could matter for strain optimization depending on desired antimicrobial competitiveness vs stress robustness. (bernal2023transcriptionalorganizationand pages 1-2)

6.2 Industrial biotechnology: stress tolerance vs productivity trade-offs (expert analysis)

A recurring expert conclusion is that increasing RpoS activity can enhance broad stress robustness but may reduce growth on diverse substrates due to sigma competition—implying that industrial strain design must balance RpoS-mediated protection with productivity. Bouillet et al. (2024) emphasizes this growth–survival trade-off and notes that lab evolution often selects for reduced RpoS activity under benign conditions, warning about evolutionary stability of engineered constructs that increase RpoS. (bouillet2024rposandthe pages 5-7)

In KT2440, biofilm/ECM control via RpoS (LapF, Pea) is also operationally relevant because biofilms can be beneficial (immobilized biocatalysis, stress buffering) or detrimental (reactor fouling), so tuning RpoS-linked matrix expression can be a practical lever. (liu2017influenceof(p)ppgpp pages 11-15)

6.3 Stress-engineering strategies in Pseudomonas (broader implementation guidance)

An industrially oriented review of Pseudomonas stress mechanisms emphasizes that upstream pathways (e.g., stringent response, polyphosphate, preconditioning) can be leveraged to improve survival in industrially relevant stresses (drying, temperature shocks, formulation). Quantitative examples include a reported 10-fold competitiveness reduction for a polyphosphate kinase mutant of P. fluorescens in low-phosphate sterile soil, and evidence that osmotic pre-adaptation improved survival across temperature shocks spanning −15°C to 58°C in cited Pseudomonas systems. While not KT2440- or RpoS-exclusive, these strategies intersect with sigma-factor-controlled stress programs and inform translational approaches for robust Pseudomonas chassis design. (craig2021leveragingpseudomonasstress pages 11-12)

7) Relevant statistics and data points from studies (selected)

  • pea EPS transcript change in KT2440 stringent-response mutants: 2.3-fold decrease (ΔrelA) and 5.8-fold decrease (ΔrelAΔspoT/ΔRS) vs wild type (qRT-PCR). (liu2017influenceof(p)ppgpp pages 11-15)
  • Biofilm dynamics in KT2440 stringent-response mutants: ΔRS showed increased microtiter-plate biofilm by 22 h and maintained thick biofilm at 34 h, whereas wild type biofilm strongly reduced by 34 h (dispersion). (liu2017influenceof(p)ppgpp pages 11-15)
  • RsmA enrichment values for cfcR mRNA in KT2440: fold-enrichment 1.82 and 1.88 (below cut-off) reported in the Rsm target capture analysis, highlighting modest in vivo enrichment in that dataset. (huertasrosales2021genomewideanalysisof pages 9-11)
  • Biofilm assay replication/statistics in arginine cue study: crystal-violet biofilm after 10 h reported as A595 normalized to OD660, averages/SE from two independent experiments with four technical replicates, significance by Student’s t test (p ≤ 0.05; *p ≤ 0.01). (barrientosmoreno2020arginineasan pages 11-12)

8) Practical functional annotation summary (for Q88ME8 / PP_1623)

Recommended primary function annotation:
- Molecular function: RNA polymerase sigma factor (alternative sigma), directing transcription initiation at RpoS-dependent promoters by forming an RNAP holoenzyme with core RNAP. (bouillet2024rposandthe pages 1-5, bouillet2024rposandthe media f4434c02)

Recommended biological process annotations (KT2440-supported):
- Stationary-phase/general stress response transcriptional program (conserved context). (bouillet2024rposandthe pages 1-5)
- Regulation of biofilm maturation/extracellular matrix gene expression, including LapF and the Pea EPS pathway, downstream of stringent response and post-transcriptional networks. (liu2017influenceof(p)ppgpp pages 11-15)
- Integration of metabolic state (arginine pools; ArgR network) with c-di-GMP signaling outputs involving CfcR and ECM genes, likely via RpoS. (barrientosmoreno2022roleofthe pages 1-2, barrientosmoreno2020arginineasan pages 11-12)

Cellular component/location:
- Cytosol / nucleoid-associated transcription machinery (RNAP-associated). (bouillet2024rposandthe pages 1-5, bouillet2024rposandthe media f4434c02)

Regulatory context (KT2440-supported):
- Post-transcriptional regulation by Gac/Rsm system via RsmA binding of rpoS mRNA (translational control evidence). (huertasrosales2021genomewideanalysisof pages 9-11)
- Modulation by stringent response ((p)ppGpp), affecting rpoS and RpoS-dependent outputs in biofilm/ECM programs. (liu2017influenceof(p)ppgpp pages 11-15)

Important caveat (regulon boundaries):
- Not all stationary-phase induced functions require RpoS; KT2440 K1-T6SS is induced in stationary phase but is not RpoS-dependent and is indirectly repressed by RpoS. (bernal2023transcriptionalorganizationand pages 1-2)

Evidence summary table

The following table compiles the most directly relevant evidence for KT2440 rpoS/PP_1623, with URLs and publication dates.

Aspect Key finding Evidence type Quantitative/statistical details (if any) Source (first author year, journal) URL Publication date (month year if known)
identity/function RpoS is the conserved general-stress/stationary-phase alternative sigma factor in many γ-proteobacteria; as a group 2 sigma factor, it binds core RNAP and recognizes promoters similar to RpoD, using σ2/σ3/σ4 domains to engage promoter elements. This supports annotation of PP_1623/Q88ME8 as sigma S rather than an enzyme or transporter. (bouillet2024rposandthe pages 1-5, bouillet2024rposandthe media f4434c02) Authoritative review; domain/promoter synthesis Review notes >300 promoters in the E. coli RpoS regulon; emphasizes promoter similarity to σ70/RpoD promoters rather than a catalytic reaction. (bouillet2024rposandthe pages 1-5) Bouillet 2024, Microbiology and Molecular Biology Reviews https://doi.org/10.1128/mmbr.00151-22 March 2024
regulation/process In P. putida KT2440, RsmA directly binds the untranslated region of rpoS mRNA (including the ribosome-binding/start-codon region), supporting post-transcriptional control of RpoS. Through RpoS, the Gac/Rsm cascade connects to lapF expression and indirectly to cfcR-dependent c-di-GMP signaling. (huertasrosales2021genomewideanalysisof pages 9-11, huertasrosales2021genomewideanalysisof pages 7-9) EMSA; RNA target capture; regulatory model EMSA confirmed RsmA–rpoS RNA binding; cfcR transcript showed RsmA enrichment values 1.82 and 1.88 (below cut-off), consistent with modest in vivo enrichment despite prior interaction evidence. (huertasrosales2021genomewideanalysisof pages 9-11) Huertas-Rosales 2021, Frontiers in Molecular Biosciences https://doi.org/10.3389/fmolb.2021.624061 February 2021
regulation/phenotype Loss of (p)ppGpp synthesis alters RpoS-linked biofilm regulation in KT2440: ΔrelA and especially ΔrelAΔspoT show reduced rpoS promoter activity, increased lapA, decreased lapF, reduced pea, and abnormal pellicle/biofilm architecture. This places RpoS downstream of the stringent response in biofilm control. (liu2017influenceof(p)ppgpp pages 11-15, liu2017influenceof(p)ppgpp pages 15-19, liu2017influenceof(p)ppgpp pages 26-31) Reporter assays (rpoS::lacZ, lapA::lacZ, lapF::lacZ); qRT-PCR; crystal violet biofilm assay; morphology assays pea reduced 2.3-fold in ΔrelA and 5.8-fold in ΔRS; peb and bcs increased about 2.0-fold and 2.2-fold in ΔRS; ΔRS showed noticeably increased microtiter biofilm at 22 h and maintained thick biofilm at 34 h, while WT dispersed by 34 h. (liu2017influenceof(p)ppgpp pages 11-15) Liu 2017, Microbiological Research https://doi.org/10.1016/j.micres.2017.07.003 November 2017
process/phenotype ArgR links arginine metabolism to c-di-GMP signaling and likely modulates LapF, Pea, and the diguanylate cyclase CfcR through RpoS in KT2440; argR deletion increases biofilm formation and reduces surface motility. (barrientosmoreno2022roleofthe pages 1-2) Primary genetics/phenotyping study The excerpt reports qualitative phenotypes (increased biofilm, reduced surface motility) but no explicit fold-change for RpoS-dependent outputs in the provided text. (barrientosmoreno2022roleofthe pages 1-2) Barrientos-Moreno 2022, Applied and Environmental Microbiology https://doi.org/10.1128/aem.00064-22 April 2022
process/application Arginine acts as an environmental/metabolic cue that raises c-di-GMP in KT2440; the response is associated with altered expression of RpoS-controlled elements (lapF, pea, cfcR) in arginine-biosynthesis mutants, linking metabolism to RpoS-regulated biofilm output. (barrientosmoreno2020arginineasan pages 11-12) c-di-GMP biosensor study; biofilm assay; mutant analysis Biofilm quantified after 10 h as crystal-violet A595/OD660; values were averages from 2 independent experiments with 4 technical replicates each; significance by Student’s t test (*p ≤ 0.05; **p ≤ 0.01). (barrientosmoreno2020arginineasan pages 11-12) Barrientos-Moreno 2020, Scientific Reports https://doi.org/10.1038/s41598-020-70675-x August 2020
process/regulation Stationary-phase induction in KT2440 does not necessarily imply positive RpoS control: the K1-T6SS is induced in stationary phase, but transcription is not dependent on RpoS and is instead indirectly repressed by RpoS. This helps define boundaries of the RpoS regulon. (bernal2023transcriptionalorganizationand pages 1-2) Promoter mapping; mutant regulatory analysis Four K1-T6SS promoters showed typical σ70-dependent features; no fold-change values were given in the provided excerpt for RpoS effects. (bernal2023transcriptionalorganizationand pages 1-2) Bernal 2023, Microbiology https://doi.org/10.1099/mic.0.001295 January 2023

Table: This table summarizes the most relevant literature-backed findings for Pseudomonas putida KT2440 rpoS (PP_1623), spanning core molecular function, regulation, and organism-specific phenotypes. It highlights where evidence is direct for KT2440 and where recent reviews provide conserved mechanistic context for sigma S.

References

  1. (huertasrosales2021genomewideanalysisof pages 9-11): Óscar Huertas-Rosales, Manuel Romero, Kok-Gan Chan, Kar-Wai Hong, Miguel Cámara, Stephan Heeb, Laura Barrientos-Moreno, María Antonia Molina-Henares, María L. Travieso, María Isabel Ramos-González, and Manuel Espinosa-Urgel. Genome-wide analysis of targets for post-transcriptional regulation by rsm proteins in pseudomonas putida. Frontiers in Molecular Biosciences, Feb 2021. URL: https://doi.org/10.3389/fmolb.2021.624061, doi:10.3389/fmolb.2021.624061. This article has 15 citations.

  2. (liu2017influenceof(p)ppgpp pages 11-15): Huizhong Liu, Yujie Xiao, Hailing Nie, Qiaoyun Huang, and Wenli Chen. Influence of (p)ppgpp on biofilm regulation in pseudomonas putida kt2440. Microbiological Research, 204:1-8, Nov 2017. URL: https://doi.org/10.1016/j.micres.2017.07.003, doi:10.1016/j.micres.2017.07.003. This article has 64 citations and is from a peer-reviewed journal.

  3. (bouillet2024rposandthe pages 1-5): Sophie Bouillet, Taran S. Bauer, and Susan Gottesman. Rpos and the bacterial general stress response. Microbiology and Molecular Biology Reviews, Mar 2024. URL: https://doi.org/10.1128/mmbr.00151-22, doi:10.1128/mmbr.00151-22. This article has 103 citations and is from a domain leading peer-reviewed journal.

  4. (bouillet2024rposandthe media f4434c02): Sophie Bouillet, Taran S. Bauer, and Susan Gottesman. Rpos and the bacterial general stress response. Microbiology and Molecular Biology Reviews, Mar 2024. URL: https://doi.org/10.1128/mmbr.00151-22, doi:10.1128/mmbr.00151-22. This article has 103 citations and is from a domain leading peer-reviewed journal.

  5. (bouillet2024rposandthe pages 5-7): Sophie Bouillet, Taran S. Bauer, and Susan Gottesman. Rpos and the bacterial general stress response. Microbiology and Molecular Biology Reviews, Mar 2024. URL: https://doi.org/10.1128/mmbr.00151-22, doi:10.1128/mmbr.00151-22. This article has 103 citations and is from a domain leading peer-reviewed journal.

  6. (liu2017influenceof(p)ppgpp pages 26-31): Huizhong Liu, Yujie Xiao, Hailing Nie, Qiaoyun Huang, and Wenli Chen. Influence of (p)ppgpp on biofilm regulation in pseudomonas putida kt2440. Microbiological Research, 204:1-8, Nov 2017. URL: https://doi.org/10.1016/j.micres.2017.07.003, doi:10.1016/j.micres.2017.07.003. This article has 64 citations and is from a peer-reviewed journal.

  7. (barrientosmoreno2022roleofthe pages 1-2): Laura Barrientos-Moreno, María Antonia Molina-Henares, María Isabel Ramos-González, and Manuel Espinosa-Urgel. Role of the transcriptional regulator argr in the connection between arginine metabolism and c-di-gmp signaling in pseudomonas putida. Apr 2022. URL: https://doi.org/10.1128/aem.00064-22, doi:10.1128/aem.00064-22. This article has 27 citations and is from a peer-reviewed journal.

  8. (barrientosmoreno2020arginineasan pages 11-12): Laura Barrientos-Moreno, María Antonia Molina-Henares, María Isabel Ramos-González, and Manuel Espinosa-Urgel. Arginine as an environmental and metabolic cue for cyclic diguanylate signalling and biofilm formation in pseudomonas putida. Scientific Reports, Aug 2020. URL: https://doi.org/10.1038/s41598-020-70675-x, doi:10.1038/s41598-020-70675-x. This article has 51 citations and is from a peer-reviewed journal.

  9. (bernal2023transcriptionalorganizationand pages 1-2): Patricia Bernal, Cristina Civantos, Daniel Pacheco-Sánchez, José M. Quesada, Alain Filloux, and María A. Llamas. Transcriptional organization and regulation of the pseudomonas putida k1 type vi secretion system gene cluster. Jan 2023. URL: https://doi.org/10.1099/mic.0.001295, doi:10.1099/mic.0.001295. This article has 15 citations and is from a peer-reviewed journal.

  10. (craig2021leveragingpseudomonasstress pages 11-12): Kelly Craig, Brant R. Johnson, and Amy Grunden. Leveraging pseudomonas stress response mechanisms for industrial applications. Frontiers in Microbiology, May 2021. URL: https://doi.org/10.3389/fmicb.2021.660134, doi:10.3389/fmicb.2021.660134. This article has 67 citations and is from a peer-reviewed journal.

  11. (huertasrosales2021genomewideanalysisof pages 7-9): Óscar Huertas-Rosales, Manuel Romero, Kok-Gan Chan, Kar-Wai Hong, Miguel Cámara, Stephan Heeb, Laura Barrientos-Moreno, María Antonia Molina-Henares, María L. Travieso, María Isabel Ramos-González, and Manuel Espinosa-Urgel. Genome-wide analysis of targets for post-transcriptional regulation by rsm proteins in pseudomonas putida. Frontiers in Molecular Biosciences, Feb 2021. URL: https://doi.org/10.3389/fmolb.2021.624061, doi:10.3389/fmolb.2021.624061. This article has 15 citations.

  12. (liu2017influenceof(p)ppgpp pages 15-19): Huizhong Liu, Yujie Xiao, Hailing Nie, Qiaoyun Huang, and Wenli Chen. Influence of (p)ppgpp on biofilm regulation in pseudomonas putida kt2440. Microbiological Research, 204:1-8, Nov 2017. URL: https://doi.org/10.1016/j.micres.2017.07.003, doi:10.1016/j.micres.2017.07.003. This article has 64 citations and is from a peer-reviewed journal.

Artifacts

Citations

  1. bouillet2024rposandthe pages 1-5
  2. bouillet2024rposandthe pages 5-7
  3. huertasrosales2021genomewideanalysisof pages 9-11
  4. barrientosmoreno2022roleofthe pages 1-2
  5. barrientosmoreno2020arginineasan pages 11-12
  6. bernal2023transcriptionalorganizationand pages 1-2
  7. craig2021leveragingpseudomonasstress pages 11-12
  8. huertasrosales2021genomewideanalysisof pages 7-9
  9. https://doi.org/10.1128/mmbr.00151-22
  10. https://doi.org/10.1099/mic.0.001295
  11. https://doi.org/10.3389/fmolb.2021.624061
  12. https://doi.org/10.1016/j.micres.2017.07.003
  13. https://doi.org/10.1128/aem.00064-22
  14. https://doi.org/10.1038/s41598-020-70675-x
  15. https://doi.org/10.3389/fmolb.2021.624061,
  16. https://doi.org/10.1016/j.micres.2017.07.003,
  17. https://doi.org/10.1128/mmbr.00151-22,
  18. https://doi.org/10.1128/aem.00064-22,
  19. https://doi.org/10.1038/s41598-020-70675-x,
  20. https://doi.org/10.1099/mic.0.001295,
  21. https://doi.org/10.3389/fmicb.2021.660134,

📚 Additional Documentation

Notes

(rpoS-notes.md)

rpoS notes

Identity

  • UniProt Q88ME8 encodes RNA polymerase sigma factor RpoS, also called Sigma S or Sigma-38, a cytoplasmic sigma-70 family protein in the RpoS subfamily. [file:PSEPK/rpoS/rpoS-uniprot.txt]

Core role in KT2440

  • In KT2440, the rpoS mutant showed reduced survival of carbon starvation and reduced cross-protection against other types of stress in cells starved for carbon, and RpoS controlled expression of more than 50 peptides after short carbon starvation. [PMID:9642197 Cloning, sequencing, and phenotypic characterization of the rpoS gene from Pseudomonas putida KT2440., "showed reduced survival of carbon starvation and reduced cross-protection against other types of stress in cells starved for carbon" and "controls the expression of more than 50 peptides"]
  • This supports treating sigma factor activity and DNA-templated transcription initiation as the core GO-level functions, with response to starvation as a justified downstream biological process. [PMID:9642197 Cloning, sequencing, and phenotypic characterization of the rpoS gene from Pseudomonas putida KT2440., "reduced survival of carbon starvation"]

Upstream regulation

  • PsrA activates rpoS expression: psrA mutants showed a 90% decrease in rpoS promoter activity and lost the ability to induce rpoS expression at stationary phase. [PMID:11371535 Regulation of rpoS gene expression in Pseudomonas: involvement of a TetR family regulator., "showed a 90% decrease in rpoS promoter activity" and "lost the ability to induce rpoS expression at stationary phase"]
  • PsrA binds directly to the rpoS promoter from positions -59 to -35 relative to the transcription start site. [PMID:11914368 TetR family member psrA directly binds the Pseudomonas rpoS and psrA promoters., "PsrA binds from positions -59 to -35 in the rpoS promoter"]

Biofilm and lifestyle outputs

  • RpoS directly bound the major wspA promoter and was required for tetracycline to induce wspA activity and promote biofilm formation. [PMID:39589111 Tetracycline induces wsp operon expression to promote biofilm formation in Pseudomonas putida., "RpoS directly bound to PwspA and positively regulated its activity under tetracycline stress" and "RpoS was required for tetracycline to induce PwspA activity and promote biofilm formation"]
  • Expression of cfcR is transcriptionally regulated by RpoS, and cfcR provides most free c-di-GMP during stationary phase in static conditions. [PMID:28677348 The Pseudomonas putida CsrA/RsmA homologues negatively affect c-di-GMP pools and biofilm formation through the GGDEF/EAL response regulator CfcR., "Expression of cfcR ... is transcriptionally regulated by RpoS" and "cfcR ... is responsible for most of the free c-di-GMP during stationary phase in static conditions"]
  • lapA transcription is initiated from six promoters, three of which show moderate RpoS dependence, while lapF transcription responds to the stationary-phase sigma factor RpoS. [PMID:28945818 The promoter region of lapA and its transcriptional regulation by Fis in Pseudomonas putida., "transcription of lapA ... is initiated from six promoters, three of which display moderate RpoS-dependence"] [PMID:24488315 Roles of cyclic Di-GMP and the Gac system in transcriptional control of the genes coding for the Pseudomonas putida adhesins LapA and LapF., "lapF transcription was previously shown to take place at late times of growth and to respond to the stationary-phase sigma factor RpoS"]

Curation take

  • GO:0016987 sigma factor activity is the precise molecular function term for RpoS and is more informative than the generic GO:0003700 DNA-binding transcription factor activity.
  • GO:0006352 DNA-templated transcription initiation and GO:2000142 regulation of DNA-templated transcription initiation capture the direct process-level role better than GO:0006355 regulation of DNA-templated transcription or GO:0010468 regulation of gene expression.
  • GO:0003677 DNA binding is too generic for a sigma factor whose core activity is promoter specificity within RNA polymerase holoenzyme rather than a standalone DNA-binding regulator.
  • Biofilm formation is well supported but should be treated as a non-core pleiotropic output of the RpoS regulon rather than the main evolved function of the protein.

Bioreason Rl Predictions

(rpoS-bioreason-rl-predictions.md)

BioReason Chat Export

Exported on March 22, 2026 at 03:00 AM

Organism: Pseudomonas putida

Sequence:

MALSKEVPEFDIDDDVLLMETGIVLETDVVSDEPAVSSVRTRAKSGSSLKQHKYIDYSRALDATQLYLNEIGFSPLLSPEEEVHFARLSQKGDPAGRKRMIESNLRLVVKIARRYVNRGLSLLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRLPIHVVKELNVYLRAARELTQKLDHEPSPEEIATLLEKPVAEVKRMLGLNERVSSVDVSLGPDSDKTLLDTLTDDRPTDPCELLQDDDLSQSIDQWLGELTDKQREVVVRRFGLRGHESSTLEDVGLEIGLTRERVRQIQVEGLKRLREILEKNGLSSESLFQ

Thinking Trace

I begin with the InterPro architecture, which is diagnostic for a sigma-70-type initiation factor. The N-terminal half is anchored by IPR012761 (RNA polymerase sigma factor RpoS family, residues 2–334), establishing the overall identity as an RpoS-like sigma factor. Within this scaffold, the early module IPR009042 (RNA polymerase sigma-70 region 1.2, residues 62–95) precedes a well-defined central core comprising IPR013325 (sigma factor, region 2 homologous superfamily, residues 62–170) and IPR007627 (sigma-70 region 2, residues 100–169). This arrangement produces the canonical region 2 fold that grips the non-template strand and stabilizes open-complex formation at promoters. The C-terminal half is dominated by IPR013324 (sigma factor, region 3/4-like homologous superfamily, residues 173–328) and IPR036388 (winged helix-like DNA-binding domain superfamily, residues 173–325), which together form the promoter-recognition and DNA-binding apparatus. This is followed by IPR007624 (sigma-70 region 3, residues 180–254) and IPR007630 (sigma-70 region 4, residues 268–321), completing the assembly that recognizes the −10 and −35 elements and anchors to the RNA polymerase core. The overall sigma-70 architecture is reinforced by broader family signatures IPR050239 (Sigma-70 factor family, residues 96–329) and IPR014284 (RNA polymerase sigma-70-like domain, residues 97–323), with the core catalytic/recognition block IPR000943 (RNA polymerase sigma-70, residues 124–319). The ordered layout—region 1.2 → region 2 → region 3 → region 4—causes selective promoter binding and initiation control rather than catalysis, which is characteristic of sigma factors.

This domain architecture dictates the molecular function as a transcription initiation factor that confers promoter specificity to the bacterial RNA polymerase holoenzyme. The presence of the winged helix-like superfamily and the discrete region 2/3/4 modules supports DNA engagement and recognition; thus the activity aligns with GO:0003700 sigma factor activity. The absence of enzymatic motifs and the presence of multiple promoter-recognition domains emphasize a role in assembly and regulation of the initiation complex.

From this molecular function, the biological process follows: sigma-70-type factors nucleate open-complex formation and trigger transcript start-site selection, which is the essence of transcription initiation. Therefore, the process is transcription initiation within the bacterial-type RNA polymerase system; this maps to DNA-templated transcription initiation and, more specifically for bacteria, the initiation arm of transcription.

The cellular context is bacterial and soluble. Sigma factors operate with the cytosolic RNA polymerase and diffuse to promoter sites on the nucleoid. The soluble, non-membranous architecture and lack of transmembrane segments place the protein in the cytoplasm, consistent with assembly and action of transcription complexes.

Mechanistically, region 1.2 primes holoenzyme assembly and promoter escape, region 2 stabilizes DNA melting at −10 elements, region 3 recognizes the −10/−35 platform and modulates start-site fidelity, and region 4 binds the -35 element and interfaces with the polymerase clamp/funnel. This architecture causes selective initiation at stress- and stationary-phase–type promoters, consistent with an RpoS-like program. I hypothesize preferential interaction with the core RNA polymerase subunits (RpoA, RpoB, RpoC), the primary sigma partner (RpoZ/stable A200) in holoenzyme formation, and transient contacts with nucleoid-associated factors that modulate promoter accessibility. Together, these interactions would tune initiation pathways toward adaptive transcriptional regimes in Pseudomonas putida.

Functional Summary

A soluble bacterial transcription initiation factor that confers promoter specificity to the core RNA polymerase. It uses a modular sigma-70 architecture to bind and recognize −10 and −35 promoter elements, assemble the holoenzyme, and trigger open-complex formation that commits RNA polymerase to productive transcription initiation. Operating with cytosolic polymerase and engaging DNA within the nucleoid, it likely biases initiation toward adaptive gene programs characteristic of stress-responsive and stationary-phase regulation.

UniProt Summary

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released.

InterPro Domains

  • RNA polymerase sigma factor RpoS (IPR012761, family) — residues 2-334
  • RNA polymerase sigma-70 region 1.2 (IPR009042, domain) — residues 62-95
  • RNA polymerase sigma factor, region 2 (IPR013325, homologous_superfamily) — residues 62-170
  • Sigma-70 factor family, RNA polymerase initiation factors (IPR050239, family) — residues 96-329
  • RNA polymerase sigma-70-like domain (IPR014284, domain) — residues 97-323
  • RNA polymerase sigma-70 region 2 (IPR007627, domain) — residues 100-169
  • RNA polymerase sigma-70 (IPR000943, domain) — residues 124-319
  • RNA polymerase sigma factor, region 3/4-like (IPR013324, homologous_superfamily) — residues 173-328
  • Winged helix-like DNA-binding domain superfamily (IPR036388, homologous_superfamily) — residues 173-325
  • RNA polymerase sigma-70 region 3 (IPR007624, domain) — residues 180-254
  • RNA polymerase sigma-70 region 4 (IPR007630, domain) — residues 268-321

GO Terms

Molecular Function: molecular_function (GO:0003674), binding (GO:0005488), transcription regulator activity (GO:0140110), organic cyclic compound binding (GO:0097159), heterocyclic compound binding (GO:1901363), sigma factor activity (GO:0003700), nucleic acid binding (GO:0003676), DNA-binding transcription activator activity (GO:0001216), DNA binding (GO:0003677), transcription regulatory region nucleic acid binding (GO:0001067), double-stranded DNA binding (GO:0003690), sequence-specific DNA binding (GO:0043565), transcription cis-regulatory region binding (GO:0000976), sequence-specific double-stranded DNA binding (GO:1990837)

Biological Process: biological_process (GO:0008150), biological regulation (GO:0065007), positive regulation of biological process (GO:0048518), regulation of biological process (GO:0050789), negative regulation of biological process (GO:0048519), positive regulation of response to stimulus (GO:0048584), regulation of metabolic process (GO:0019222), positive regulation of locomotion (GO:0040017), regulation of cellular process (GO:0050794), regulation of response to stimulus (GO:0048583), regulation of locomotion (GO:0040012), negative regulation of metabolic process (GO:0009892), positive regulation of cellular process (GO:0048522), positive regulation of response to external stimulus (GO:0032103), regulation of cell motility (GO:2000145), regulation of chemotaxis (GO:0050920), regulation of response to stress (GO:0080134), regulation of biosynthetic process (GO:0009889), regulation of nitrogen compound metabolic process (GO:0051171), regulation of macromolecule metabolic process (GO:0060255), regulation of response to external stimulus (GO:0032101), regulation of cellular metabolic process (GO:0031323), negative regulation of biosynthetic process (GO:0009890), regulation of primary metabolic process (GO:0080090), positive regulation of chemotaxis (GO:0050921), positive regulation of cell motility (GO:2000147), regulation of defense response (GO:0031347), regulation of inflammatory response (GO:0050727), regulation of macromolecule biosynthetic process (GO:0010556), regulation of cellular biosynthetic process (GO:0031326), regulation of nucleobase-containing compound metabolic process (GO:0019219), positive regulation of cell migration (GO:0030335), negative regulation of macromolecule biosynthetic process (GO:0010558), negative regulation of cellular biosynthetic process (GO:0031327), regulation of RNA metabolic process (GO:0051252), regulation of cell migration (GO:0030334), negative regulation of RNA metabolic process (GO:0051253), negative regulation of nucleobase-containing compound metabolic process (GO:0045934), regulation of gene expression (GO:0010468), regulation of RNA biosynthetic process (GO:2001141), negative regulation of RNA biosynthetic process (GO:1902679), regulation of DNA-templated transcription (GO:0006355), negative regulation of nucleic acid-templated transcription (GO:1903507), regulation of nucleic acid-templated transcription (GO:1903506), negative regulation of DNA-templated transcription (GO:0045892)

Cellular Component: cellular_component (GO:0005575), protein-containing complex (GO:0032991), transcription regulator complex (GO:0005667)

Generated by BioReason

Bioreason Rl Review

(rpoS-bioreason-rl-review.md)

BioReason-Pro RL Review: rpoS (P. putida)

Source: rpoS-bioreason-rl-predictions.md

  • Correctness: 4/5
  • Completeness: 3/5

Functional Summary Review

The BioReason functional summary describes rpoS as:

A soluble bacterial transcription initiation factor that confers promoter specificity to the core RNA polymerase. It uses a modular sigma-70 architecture to bind and recognize -10 and -35 promoter elements, assemble the holoenzyme, and trigger open-complex formation that commits RNA polymerase to productive transcription initiation. Operating with cytosolic polymerase and engaging DNA within the nucleoid, it likely biases initiation toward adaptive gene programs characteristic of stress-responsive and stationary-phase regulation.

This is a solid summary that correctly captures the core function of RpoS:
- Sigma factor function conferring promoter specificity
- Sigma-70 family architecture
- Recognition of -10 and -35 promoter elements
- Holoenzyme assembly and open-complex formation
- Cytoplasmic localization
- Association with stress and stationary-phase gene regulation

The thinking trace correctly identifies all eleven InterPro domains spanning the sigma-70 regions (1.2, 2, 3, 4) and the RpoS family signature.

Notable omissions:
- Does not mention the specific stationary-phase/carbon starvation context that is central to RpoS biology in P. putida
- Does not mention the cross-protection function (starvation-induced stress cross-resistance)
- Does not mention the biofilm/c-di-GMP signaling connection specific to P. putida KT2440
- Does not mention the regulation of RpoS itself (proteolytic turnover, transcriptional regulation)
- The summary mentions "adaptive gene programs" vaguely but does not specify what genes are regulated

The summary is accurate but reads as a generic sigma factor description rather than a specific account of RpoS biology. Any sigma-70 family member would receive essentially the same summary from this model.

Comparison with interpro2go:

The curated review's interpro2go annotations include DNA binding (GO:0003677, marked as over-annotated in favor of sigma factor activity) and sigma factor activity (GO:0016987, from another IEA source). BioReason's GO predictions include sigma factor activity (GO:0003700 is listed as "sigma factor activity" in the predictions), which is correct. Notably, the GO predictions also include negative regulation of DNA-templated transcription (GO:0045892), which reflects RpoS's ability to compete with other sigma factors and indirectly repress some genes. The narrative does not capture this nuance. The GO predictions include "positive regulation of chemotaxis" and "regulation of inflammatory response," which appear to be eukaryotic-biased predictions inappropriate for a bacterial protein.

Notes on thinking trace

The trace correctly walks through the sigma-70 region architecture (1.2 -> 2 -> 3 -> 4) and their individual functions in promoter recognition and open-complex formation. The mention of "RpoZ/stable A200" as a partner is not standard nomenclature. The overall reasoning is sound but generic, producing a sigma factor description that lacks RpoS-specific biological context.

📄 View Raw YAML

 
id: Q88ME8
gene_symbol: rpoS
product_type: PROTEIN
aliases:
- PP_1623
- Sigma S
- Sigma-38
status: DRAFT
taxon:
  id: NCBITaxon:160488
  label: Pseudomonas putida KT2440
description: Stationary-phase sigma factor that reprograms RNA polymerase promoter specificity during carbon starvation and general stress adaptation in Pseudomonas putida KT2440. RpoS is a sigma-70 family alternative sigma factor that drives transcription initiation at stationary- and stress-associated promoters, supports starvation survival and cross-protection, and also contributes to condition-specific lifestyle outputs such as biofilm-associated c-di-GMP signaling.
existing_annotations:
- term:
    id: GO:0003677
    label: DNA binding
  evidence_type: IEA
  original_reference_id: GO_REF:0000120
  review:
    summary: This term is not entirely wrong because RpoS contributes promoter recognition within RNA polymerase holoenzyme, but it is too generic and potentially misleading as a standalone molecular function. The specific core activity is sigma factor activity, which already captures promoter-specific DNA recognition more accurately.
    action: MARK_AS_OVER_ANNOTATED
    supported_by:
    - reference_id: file:PSEPK/rpoS/rpoS-notes.md
      supporting_text: GO:0003677 DNA binding is too generic for a sigma factor whose core activity is promoter specificity within RNA polymerase holoenzyme rather than a standalone DNA-binding regulator.
    - reference_id: file:PSEPK/rpoS/rpoS-deep-research-falcon.md
      supporting_text: 'as a group 2 sigma factor, it binds core RNAP and recognizes promoters similar to RpoD'
- term:
    id: GO:0003700
    label: DNA-binding transcription factor activity
  evidence_type: IEA
  original_reference_id: GO_REF:0000002
  review:
    summary: The overall idea that RpoS is a transcriptional regulatory factor is sound, but this GO term is too generic for a bacterial sigma factor. GO:0016987 sigma factor activity is the precise molecular function for the promoter-specificity subunit of RNA polymerase.
    action: MODIFY
    reason: Sigma factor activity is the exact and more informative child term for RpoS.
    proposed_replacement_terms:
    - id: GO:0016987
      label: sigma factor activity
    supported_by:
    - reference_id: file:PSEPK/rpoS/rpoS-notes.md
      supporting_text: GO:0016987 sigma factor activity is the precise molecular function term for RpoS and is more informative than the generic GO:0003700 DNA-binding transcription factor activity.
    - reference_id: file:PSEPK/rpoS/rpoS-deep-research-falcon.md
      supporting_text: 'RpoS does **not** catalyze a biochemical reaction and is **not** a transporter. Its primary function is **sequence-specific transcription initiation control**'
- term:
    id: GO:0005737
    label: cytoplasm
  evidence_type: IEA
  original_reference_id: GO_REF:0000120
  review:
    summary: This annotation is appropriate. RpoS is a bacterial sigma factor that associates with the cytoplasmic RNA polymerase core enzyme and UniProt places the protein in the cytoplasm.
    action: ACCEPT
    supported_by:
    - reference_id: file:PSEPK/rpoS/rpoS-uniprot.txt
      supporting_text: 'CC   -!- SUBCELLULAR LOCATION: Cytoplasm'
    - reference_id: file:PSEPK/rpoS/rpoS-deep-research-falcon.md
      supporting_text: 'RpoS is a **cytosolic** transcription factor (sigma factor) that exerts its function by interacting with **cytosolic RNA polymerase** and promoter DNA.'
- term:
    id: GO:0006352
    label: DNA-templated transcription initiation
  evidence_type: IEA
  original_reference_id: GO_REF:0000120
  review:
    summary: This is a core process annotation for RpoS. Sigma factors function by redirecting RNA polymerase to specific promoters at transcription initiation, and the KT2440 mutant phenotype is consistent with a broad defect in stationary-phase transcriptional reprogramming.
    action: ACCEPT
    supported_by:
    - reference_id: file:PSEPK/rpoS/rpoS-deep-research-codex.md
      supporting_text: Accept GO:0006352 DNA-templated transcription initiation as the direct process executed by RpoS-containing holoenzyme.
    - reference_id: file:PSEPK/rpoS/rpoS-uniprot.txt
      supporting_text: 'CC   -!- FUNCTION: Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released.'
    - reference_id: file:PSEPK/rpoS/rpoS-deep-research-falcon.md
      supporting_text: 'RpoS does **not** catalyze a biochemical reaction and is **not** a transporter. Its primary function is **sequence-specific transcription initiation control**'
- term:
    id: GO:0006355
    label: regulation of DNA-templated transcription
  evidence_type: IEA
  original_reference_id: GO_REF:0000120
  review:
    summary: RpoS certainly regulates transcription, but this term is broader than necessary. The more specific BP term already present in the GOA set is regulation of DNA-templated transcription initiation, which better reflects how sigma factors act.
    action: MODIFY
    reason: Replace the broad regulation term with the initiation-specific child term.
    proposed_replacement_terms:
    - id: GO:2000142
      label: regulation of DNA-templated transcription initiation
    supported_by:
    - reference_id: file:PSEPK/rpoS/rpoS-notes.md
      supporting_text: GO:0006352 DNA-templated transcription initiation and GO:2000142 regulation of DNA-templated transcription initiation capture the direct process-level role better than GO:0006355 regulation of DNA-templated transcription or GO:0010468 regulation of gene expression.
    - reference_id: file:PSEPK/rpoS/rpoS-deep-research-falcon.md
      supporting_text: 'as a group 2 sigma factor, it binds core RNAP and recognizes promoters similar to RpoD'
- term:
    id: GO:0010468
    label: regulation of gene expression
  evidence_type: IEA
  original_reference_id: GO_REF:0000104
  review:
    summary: This annotation is directionally correct but far too general. For RpoS, the relevant direct process is regulation of transcription initiation by alternative sigma factor-dependent promoter selection.
    action: MODIFY
    reason: GO:2000142 gives the correct level of specificity for RpoS.
    proposed_replacement_terms:
    - id: GO:2000142
      label: regulation of DNA-templated transcription initiation
    supported_by:
    - reference_id: file:PSEPK/rpoS/rpoS-notes.md
      supporting_text: GO:0006352 DNA-templated transcription initiation and GO:2000142 regulation of DNA-templated transcription initiation capture the direct process-level role better than GO:0006355 regulation of DNA-templated transcription or GO:0010468 regulation of gene expression.
- term:
    id: GO:0016987
    label: sigma factor activity
  evidence_type: IEA
  original_reference_id: GO_REF:0000120
  review:
    summary: This is the most precise core molecular function for RpoS. It captures the promoter-specificity role of the alternative sigma subunit within RNA polymerase holoenzyme and is directly supported by UniProt and the experimental literature on stationary-phase regulation.
    action: ACCEPT
    supported_by:
    - reference_id: file:PSEPK/rpoS/rpoS-notes.md
      supporting_text: GO:0016987 sigma factor activity is the precise molecular function term for RpoS and is more informative than the generic GO:0003700 DNA-binding transcription factor activity.
    - reference_id: file:PSEPK/rpoS/rpoS-uniprot.txt
      supporting_text: 'CC   -!- SIMILARITY: Belongs to the sigma-70 factor family. RpoS subfamily.'
    - reference_id: file:PSEPK/rpoS/rpoS-deep-research-falcon.md
      supporting_text: 'RpoS is an alternative sigma factor** (sigma-70 family; “group 2” sigma) that binds the **core RNA polymerase** and redirects transcription to a broad set of promoters that support survival during **stationary phase** and diverse stresses—commonly termed the **general stress response (GSR)**'
- term:
    id: GO:2000142
    label: regulation of DNA-templated transcription initiation
  evidence_type: IEA
  original_reference_id: GO_REF:0000108
  review:
    summary: This is the best specific biological-process term among the seeded GOA set. RpoS changes promoter recognition by RNA polymerase and thereby regulates transcription specifically at the initiation step.
    action: ACCEPT
    supported_by:
    - reference_id: file:PSEPK/rpoS/rpoS-deep-research-codex.md
      supporting_text: Accept GO:2000142 regulation of DNA-templated transcription initiation as the best specific regulatory BP term already present.
    - reference_id: file:PSEPK/rpoS/rpoS-deep-research-falcon.md
      supporting_text: 'A central concept is **sigma competition**: RpoS competes with the housekeeping sigma **RpoD (σ70)** and other alternative sigmas for a limiting pool of core RNAP.'
- term:
    id: GO:0042594
    label: response to starvation
  evidence_type: IMP
  original_reference_id: file:PSEPK/rpoS/rpoS-notes.md
  review:
    summary: The original KT2440 rpoS mutant phenotype directly supports involvement in starvation response. Loss of rpoS reduced survival during carbon starvation, making this a well-supported downstream biological process for the gene.
    action: NEW
    reason: This term captures the hallmark stationary-phase and starvation phenotype that is not represented in the seeded GOA set.
    supported_by:
    - reference_id: file:PSEPK/rpoS/rpoS-notes.md
      supporting_text: In KT2440, the rpoS mutant showed reduced survival of carbon starvation and reduced cross-protection against other types of stress in cells starved for carbon, and RpoS controlled expression of more than 50 peptides after short carbon starvation.
    - reference_id: file:PSEPK/rpoS/rpoS-deep-research-falcon.md
      supporting_text: 'RpoS-dependent regulons typically include genes that increase tolerance to oxidative stress, osmotic stress, temperature and pH extremes, and other stationary-phase threats.'
- term:
    id: GO:0006950
    label: response to stress
  evidence_type: IMP
  original_reference_id: file:PSEPK/rpoS/rpoS-notes.md
  review:
    summary: RpoS is the master transcriptional regulator of the bacterial general stress response, and in KT2440 its loss reduces cross-protection against multiple stresses in starved cells. This general stress response role is the defining function of RpoS-subfamily sigma factors and complements the more specific response to starvation annotation. Treated as a core downstream process driven by RpoS-dependent promoter reprogramming.
    action: NEW
    reason: The general stress response is the canonical RpoS function (master regulator of the stationary phase and general stress response) and is not represented in the seeded GOA set.
    supported_by:
    - reference_id: file:PSEPK/rpoS/rpoS-uniprot.txt
      supporting_text: 'This sigma factor is the master transcriptional regulator of the stationary phase and the general stress response.'
    - reference_id: file:PSEPK/rpoS/rpoS-deep-research-falcon.md
      supporting_text: 'RpoS-dependent regulons typically include genes that increase tolerance to oxidative stress, osmotic stress, temperature and pH extremes, and other stationary-phase threats.'
- term:
    id: GO:0042710
    label: biofilm formation
  evidence_type: IMP
  original_reference_id: file:PSEPK/rpoS/rpoS-notes.md
  review:
    summary: Multiple studies place RpoS upstream of biofilm-associated pathways in P. putida, and one recent paper showed direct binding of RpoS to the major wspA promoter with a requirement for tetracycline-induced biofilm formation. This is a justified new annotation, but it should be viewed as a conditional, non-core output of the broader RpoS regulon.
    action: NEW
    reason: The seeded GOA set misses a recurrent and directly supported RpoS-dependent lifestyle phenotype.
    supported_by:
    - reference_id: file:PSEPK/rpoS/rpoS-notes.md
      supporting_text: RpoS directly bound the major wspA promoter and was required for tetracycline to induce wspA activity and promote biofilm formation.
    - reference_id: file:PSEPK/rpoS/rpoS-notes.md
      supporting_text: Expression of cfcR is transcriptionally regulated by RpoS, and cfcR provides most free c-di-GMP during stationary phase in static conditions.
    - reference_id: file:PSEPK/rpoS/rpoS-deep-research-falcon.md
      supporting_text: 'lapF transcription is described as dependent on RpoS in KT2440 biofilm literature'
references:
- id: GO_REF:0000002
  title: Gene Ontology annotation through association of InterPro records with GO terms
  findings: []
- id: GO_REF:0000104
  title: Electronic Gene Ontology annotations created by transferring manual GO annotations between related proteins based on shared sequence features
  findings: []
- id: GO_REF:0000108
  title: Automatic assignment of GO terms using logical inference, based on on inter-ontology links
  findings: []
- id: GO_REF:0000120
  title: Combined Automated Annotation using Multiple IEA Methods
  findings: []
- id: PMID:9642197
  title: Cloning, sequencing, and phenotypic characterization of the rpoS gene from Pseudomonas putida KT2440.
- id: PMID:11371535
  title: 'Regulation of rpoS gene expression in Pseudomonas: involvement of a TetR family regulator.'
- id: PMID:11914368
  title: TetR family member psrA directly binds the Pseudomonas rpoS and psrA promoters.
- id: PMID:24488315
  title: Roles of cyclic Di-GMP and the Gac system in transcriptional control of the genes coding for the Pseudomonas putida adhesins LapA and LapF.
- id: PMID:28677348
  title: The Pseudomonas putida CsrA/RsmA homologues negatively affect c-di-GMP pools and biofilm formation through the GGDEF/EAL response regulator CfcR.
- id: PMID:28945818
  title: The promoter region of lapA and its transcriptional regulation by Fis in Pseudomonas putida.
- id: PMID:39589111
  title: Tetracycline induces wsp operon expression to promote biofilm formation in Pseudomonas putida.
- id: file:PSEPK/rpoS/rpoS-notes.md
  title: Curator notes for rpoS in Pseudomonas putida KT2440
  findings:
  - statement: RpoS is the stationary-phase sigma factor in KT2440 and its loss impairs starvation survival and starvation-associated cross-protection.
    supporting_text: 'In KT2440, the rpoS mutant showed reduced survival of carbon starvation and reduced cross-protection against other types of stress in cells starved for carbon, and RpoS controlled expression of more than 50 peptides after short carbon starvation.'
  - statement: PsrA directly activates rpoS transcription and binds the rpoS promoter.
    supporting_text: 'PsrA binds directly to the rpoS promoter from positions -59 to -35 relative to the transcription start site.'
  - statement: RpoS participates in biofilm-associated pathways through wspA, cfcR, lapA, and lapF regulation.
    supporting_text: 'RpoS directly bound the major wspA promoter and was required for tetracycline to induce wspA activity and promote biofilm formation.'
- id: file:PSEPK/rpoS/rpoS-deep-research-codex.md
  title: Deep research report for rpoS in Pseudomonas putida KT2440
  findings:
  - statement: The core GO curation should center on sigma factor activity and transcription initiation rather than generic DNA-binding transcription factor terms.
    supporting_text: 'Accept GO:0006352 DNA-templated transcription initiation as the direct process executed by RpoS-containing holoenzyme.'
  - statement: Response to starvation is a justified new process annotation from the original KT2440 mutant phenotype.
    supporting_text: Add response to starvation as a justified new BP term supported by the KT2440 mutant phenotype.
- id: file:PSEPK/rpoS/rpoS-uniprot.txt
  title: UniProt entry Q88ME8
  findings:
  - statement: Q88ME8 is RNA polymerase sigma factor RpoS, a sigma-70 family RpoS-subfamily protein.
    supporting_text: 'CC   -!- SIMILARITY: Belongs to the sigma-70 factor family. RpoS subfamily.'
  - statement: UniProt describes RpoS as the master transcriptional regulator of the stationary phase and the general stress response, localized to the cytoplasm.
    supporting_text: 'This sigma factor is the master transcriptional regulator of the stationary phase and the general stress response.'
- id: file:PSEPK/rpoS/rpoS-deep-research-falcon.md
  title: Falcon deep research report for rpoS (Q88ME8) in Pseudomonas putida KT2440
  findings:
  - statement: RpoS is an alternative sigma-70 family (group 2) sigma factor that binds core RNA polymerase and redirects transcription to promoters supporting survival during stationary phase and the general stress response.
    supporting_text: 'RpoS is an alternative sigma factor** (sigma-70 family; “group 2” sigma) that binds the **core RNA polymerase** and redirects transcription to a broad set of promoters that support survival during **stationary phase** and diverse stresses—commonly termed the **general stress response (GSR)**'
  - statement: RpoS does not catalyze a biochemical reaction and is not a transporter; its primary function is sequence-specific transcription initiation control.
    supporting_text: 'RpoS does **not** catalyze a biochemical reaction and is **not** a transporter. Its primary function is **sequence-specific transcription initiation control**'
  - statement: As a group 2 sigma factor RpoS binds core RNAP and recognizes promoters similar to RpoD, supporting annotation as sigma S rather than an enzyme or transporter.
    supporting_text: 'as a group 2 sigma factor, it binds core RNAP and recognizes promoters similar to RpoD'
  - statement: RpoS competes with the housekeeping sigma RpoD for a limiting pool of core RNA polymerase (sigma competition), framing a growth-versus-survival tradeoff.
    supporting_text: 'A central concept is **sigma competition**: RpoS competes with the housekeeping sigma **RpoD (σ70)** and other alternative sigmas for a limiting pool of core RNAP.'
  - statement: RpoS is a cytosolic transcription factor that exerts its function by interacting with cytosolic RNA polymerase and promoter DNA.
    supporting_text: 'RpoS is a **cytosolic** transcription factor (sigma factor) that exerts its function by interacting with **cytosolic RNA polymerase** and promoter DNA.'
  - statement: RpoS-dependent regulons increase tolerance to oxidative, osmotic, temperature, and pH stress and other stationary-phase threats.
    supporting_text: 'RpoS-dependent regulons typically include genes that increase tolerance to oxidative stress, osmotic stress, temperature and pH extremes, and other stationary-phase threats.'
  - statement: In KT2440, RsmA directly binds the rpoS mRNA ribosome-binding site and start codon (confirmed by EMSA), supporting post-transcriptional control of RpoS levels via the Gac/Rsm network.
    supporting_text: 'binding of RsmA to an RNA fragment containing the **ribosome-binding site and start codon** of rpoS was confirmed by **EMSA**'
  - statement: In KT2440, lapF transcription is dependent on RpoS and cfcR expression is regulated by RpoS, embedding RpoS in the c-di-GMP-controlled biofilm circuit.
    supporting_text: 'lapF transcription is described as dependent on RpoS in KT2440 biofilm literature'
  - statement: Stationary-phase induction does not always imply RpoS activation; the KT2440 K1-T6SS is induced in stationary phase but is not RpoS-dependent and is indirectly repressed by RpoS, defining a boundary of the RpoS regulon.
    supporting_text: 'K1-T6SS is induced in stationary phase but is not RpoS-dependent and is indirectly repressed by RpoS'
core_functions:
- description: RpoS acts as the alternative sigma subunit that redirects RNA polymerase to stationary-phase and stress-associated promoters, thereby driving promoter-specific transcription initiation and transcription-initiation control during carbon starvation adaptation.
  molecular_function:
    id: GO:0016987
    label: sigma factor activity
  directly_involved_in:
  - id: GO:0006352
    label: DNA-templated transcription initiation
  - id: GO:2000142
    label: regulation of DNA-templated transcription initiation
  - id: GO:0042594
    label: response to starvation
  - id: GO:0006950
    label: response to stress
  locations:
  - id: GO:0005737
    label: cytoplasm
  supported_by:
  - reference_id: file:PSEPK/rpoS/rpoS-notes.md
    supporting_text: In KT2440, the rpoS mutant showed reduced survival of carbon starvation and reduced cross-protection against other types of stress in cells starved for carbon, and RpoS controlled expression of more than 50 peptides after short carbon starvation.
  - reference_id: file:PSEPK/rpoS/rpoS-deep-research-codex.md
    supporting_text: rpoS encodes the stationary-phase sigma factor RpoS (Sigma S, Sigma-38), an alternative sigma-70 family subunit that redirects RNA polymerase to promoters used during stationary phase and stress adaptation.
  - reference_id: file:PSEPK/rpoS/rpoS-deep-research-falcon.md
    supporting_text: 'RpoS is an alternative sigma factor** (sigma-70 family; “group 2” sigma) that binds the **core RNA polymerase** and redirects transcription to a broad set of promoters that support survival during **stationary phase** and diverse stresses—commonly termed the **general stress response (GSR)**'
- description: RpoS also feeds into condition-specific surface-associated lifestyle programs by activating transcription of biofilm-related targets such as wspA and cfcR, but this should be viewed as a non-core pleiotropic extension of the RpoS regulon rather than the primary evolved function of the protein.
  molecular_function:
    id: GO:0016987
    label: sigma factor activity
  directly_involved_in:
  - id: GO:0042710
    label: biofilm formation
  locations:
  - id: GO:0005737
    label: cytoplasm
  supported_by:
  - reference_id: file:PSEPK/rpoS/rpoS-notes.md
    supporting_text: RpoS directly bound the major wspA promoter and was required for tetracycline to induce wspA activity and promote biofilm formation.
  - reference_id: file:PSEPK/rpoS/rpoS-notes.md
    supporting_text: Expression of cfcR is transcriptionally regulated by RpoS, and cfcR provides most free c-di-GMP during stationary phase in static conditions.
  - reference_id: file:PSEPK/rpoS/rpoS-deep-research-falcon.md
    supporting_text: 'lapF transcription is described as dependent on RpoS in KT2440 biofilm literature'
proposed_new_terms:
- proposed_name: stationary-phase sigma factor activity
  proposed_definition: A sigma factor activity that redirects bacterial RNA polymerase to promoters used during stationary phase and general stress adaptation.
  justification: GO:0016987 captures sigma factor activity broadly, but does not distinguish RpoS-like alternative sigma factors dedicated to stationary-phase and general stress transcriptional programs.
  proposed_parent:
    id: GO:0016987
    label: sigma factor activity
  supported_by:
  - reference_id: file:PSEPK/rpoS/rpoS-deep-research-codex.md
    supporting_text: The core GO curation should center on sigma factor activity and transcription initiation rather than generic DNA-binding transcription factor terms.
suggested_questions:
- question: Which promoters constitute the direct core RpoS regulon in KT2440 during carbon starvation versus antibiotic stress?
- question: How broadly conserved is the direct RpoS control of biofilm genes such as wspA, cfcR, lapA, and lapF across environmental conditions relevant to soil and rhizosphere lifestyles?
- question: Which post-transcriptional regulators beyond PsrA most strongly tune RpoS abundance and activity in KT2440?
suggested_experiments:
- hypothesis: The direct KT2440 RpoS regulon during starvation is smaller than the full set of downstream stationary-phase phenotypes.
  description: Perform paired RNA-seq and ChIP-seq or ChIP-exo in wild-type and delta-rpoS cells during exponential growth, early carbon starvation, and stationary phase to separate direct promoter targets from indirect downstream effects.
  experiment_type: transcriptomics and DNA-binding profiling
- hypothesis: RpoS-dependent biofilm phenotypes arise from a condition-specific promoter subset rather than a universal biofilm program.
  description: Measure biofilm formation, c-di-GMP levels, and promoter activity of wspA, cfcR, lapA, and lapF in wild-type, delta-rpoS, and complemented strains under carbon limitation, tetracycline stress, and rhizosphere-mimicking conditions.
  experiment_type: targeted genetics and reporter assays
- hypothesis: Upstream regulators such as PsrA and post-transcriptional factors control RpoS at distinct stages of growth-phase transition.
  description: Combine translational rpoS reporter fusions with psrA, hfq, and polyphosphate-pathway perturbations to quantify how transcriptional versus post-transcriptional inputs shape RpoS accumulation across the growth curve.
  experiment_type: reporter fusion analysis