{ "annotationScore": 3.0, "comments": [ { "commentType": "FUNCTION", "texts": [ { "evidences": [ { "evidenceCode": "ECO:0000269", "id": "9237993", "source": "PubMed" } ], "value": "Binds to centromeric K-type repeat DNA and ARS3002 DNA. The CBH-binding consensus sequence is Py-Pu-A-T-A-T-Py-Pu-T-A" } ] }, { "commentType": "SUBCELLULAR LOCATION", "subcellularLocations": [ { "location": { "id": "SL-0191", "value": "Nucleus" } }, { "location": { "id": "SL-0047", "value": "Chromosome, centromere" } } ] } ], "entryAudit": { "entryVersion": 164, "firstPublicDate": "2001-01-11", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2000-10-01", "sequenceVersion": 2 }, "entryType": "UniProtKB reviewed (Swiss-Prot)", "extraAttributes": { "countByCommentType": { "FUNCTION": 1, "SUBCELLULAR LOCATION": 1 }, "countByFeatureType": { "Chain": 1, "Domain": 1, "Sequence conflict": 1 }, "uniParcId": "UPI000012718C" }, "features": [ { "description": "CENP-B homolog protein 1", "featureId": "PRO_0000126134", "location": { "end": { "modifier": "EXACT", "value": 514 }, "start": { "modifier": "EXACT", "value": 1 } }, "type": "Chain" }, { "description": "HTH CENPB-type", "evidences": [ { "evidenceCode": "ECO:0000255", "id": "PRU00583", "source": "PROSITE-ProRule" } ], "location": { "end": { "modifier": "EXACT", "value": 144 }, "start": { "modifier": "EXACT", "value": 69 } }, "type": "Domain" }, { "alternativeSequence": { "alternativeSequences": [ "M" ], "originalSequence": "I" }, "description": "in Ref. 1; AAB80698", "evidences": [ { "evidenceCode": "ECO:0000305" } ], "location": { "end": { "modifier": "EXACT", "value": 168 }, "start": { "modifier": "EXACT", "value": 168 } }, "type": "Sequence conflict" } ], "genes": [ { "geneName": { "value": "cbh1" }, "orfNames": [ { "value": "SPAC9E9.10c" } ], "synonyms": [ { "value": "cbh" } ] } ], "keywords": [ { "category": "Cellular component", "id": "KW-0137", "name": "Centromere" }, { "category": "Cellular component", "id": "KW-0158", "name": "Chromosome" }, { "category": "Technical term", "id": "KW-0903", "name": "Direct protein sequencing" }, { "category": "Molecular function", "id": "KW-0238", "name": "DNA-binding" }, { "category": "Cellular component", "id": "KW-0539", "name": "Nucleus" }, { "category": "Technical term", "id": "KW-1185", "name": "Reference proteome" } ], "organism": { "commonName": "Fission yeast", "lineage": [ "Eukaryota", "Fungi", "Dikarya", "Ascomycota", "Taphrinomycotina", "Schizosaccharomycetes", "Schizosaccharomycetales", "Schizosaccharomycetaceae", "Schizosaccharomyces" ], "scientificName": "Schizosaccharomyces pombe (strain 972 / ATCC 24843)", "taxonId": 284812 }, "primaryAccession": "O14423", "proteinDescription": { "recommendedName": { "fullName": { "value": "CENP-B homolog protein 1" }, "shortNames": [ { "value": "CBHP-1" } ] } }, "proteinExistence": "1: Evidence at protein level", "references": [ { "citation": { "authors": [ "Lee J.-K.", "Huberman J.A.", "Hurwitz J." ], "citationCrossReferences": [ { "database": "PubMed", "id": "9237993" }, { "database": "DOI", "id": "10.1073/pnas.94.16.8427" } ], "citationType": "journal article", "firstPage": "8427", "id": "9237993", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "lastPage": "8432", "publicationDate": "1997", "title": "Purification and characterization of a CENP-B homologue protein that binds to the centromeric K-type repeat DNA of Schizosaccharomyces pombe.", "volume": "94" }, "referenceComments": [ { "type": "STRAIN", "value": "972 / ATCC 24843" } ], "referenceNumber": 1, "referencePositions": [ "NUCLEOTIDE SEQUENCE [MRNA]", "PARTIAL PROTEIN SEQUENCE", "FUNCTION" ] }, { "citation": { "authors": [ "Wood V.", "Gwilliam R.", "Rajandream M.A.", "Lyne M.H.", "Lyne R.", "Stewart A.", "Sgouros J.G.", "Peat N.", "Hayles J.", "Baker S.G.", "Basham D.", "Bowman S.", "Brooks K.", "Brown D.", "Brown S.", "Chillingworth T.", "Churcher C.M.", "Collins M.", "Connor R.", "Cronin A.", "Davis P.", "Feltwell T.", "Fraser A.", "Gentles S.", "Goble A.", "Hamlin N.", "Harris D.E.", "Hidalgo J.", "Hodgson G.", "Holroyd S.", "Hornsby T.", "Howarth S.", "Huckle E.J.", "Hunt S.", "Jagels K.", "James K.D.", "Jones L.", "Jones M.", "Leather S.", "McDonald S.", "McLean J.", "Mooney P.", "Moule S.", "Mungall K.L.", "Murphy L.D.", "Niblett D.", "Odell C.", "Oliver K.", "O'Neil S.", "Pearson D.", "Quail M.A.", "Rabbinowitsch E.", "Rutherford K.M.", "Rutter S.", "Saunders D.", "Seeger K.", "Sharp S.", "Skelton J.", "Simmonds M.N.", "Squares R.", "Squares S.", "Stevens K.", "Taylor K.", "Taylor R.G.", "Tivey A.", "Walsh S.V.", "Warren T.", "Whitehead S.", "Woodward J.R.", "Volckaert G.", "Aert R.", "Robben J.", "Grymonprez B.", "Weltjens I.", "Vanstreels E.", "Rieger M.", "Schaefer M.", "Mueller-Auer S.", "Gabel C.", "Fuchs M.", "Duesterhoeft A.", "Fritzc C.", "Holzer E.", "Moestl D.", "Hilbert H.", "Borzym K.", "Langer I.", "Beck A.", "Lehrach H.", "Reinhardt R.", "Pohl T.M.", "Eger P.", "Zimmermann W.", "Wedler H.", "Wambutt R.", "Purnelle B.", "Goffeau A.", "Cadieu E.", "Dreano S.", "Gloux S.", "Lelaure V.", "Mottier S.", "Galibert F.", "Aves S.J.", "Xiang Z.", "Hunt C.", "Moore K.", "Hurst S.M.", "Lucas M.", "Rochet M.", "Gaillardin C.", "Tallada V.A.", "Garzon A.", "Thode G.", "Daga R.R.", "Cruzado L.", "Jimenez J.", "Sanchez M.", "del Rey F.", "Benito J.", "Dominguez A.", "Revuelta J.L.", "Moreno S.", "Armstrong J.", "Forsburg S.L.", "Cerutti L.", "Lowe T.", "McCombie W.R.", "Paulsen I.", "Potashkin J.", "Shpakovski G.V.", "Ussery D.", "Barrell B.G.", "Nurse P." ], "citationCrossReferences": [ { "database": "PubMed", "id": "11859360" }, { "database": "DOI", "id": "10.1038/nature724" } ], "citationType": "journal article", "firstPage": "871", "id": "11859360", "journal": "Nature", "lastPage": "880", "publicationDate": "2002", "title": "The genome sequence of Schizosaccharomyces pombe.", "volume": "415" }, "referenceComments": [ { "type": "STRAIN", "value": "972 / ATCC 24843" } ], "referenceNumber": 2, "referencePositions": [ "NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]" ] } ], "secondaryAccessions": [ "O14294" ], "sequence": { "crc64": "A48102EBAD0BB1E3", "length": 514, "md5": "DB4D11D03CED9D24E1FD9DB60058D36E", "molWeight": 59865, "value": "MPPIRQAVSLAEKKAIRDYYNQSAHRIPQKEVTEWFRKTYNKDLSQSTISEILSPKYSYLDDGSVRLGDIKKIRAPKFPLLDNAVYEWLQQREVEGLPISGDMIKQAATRFWSKIPAYASLPLPDFSNGWLDKFRRRHYIQQSAVNQALESIKFEVFREYPVHIQEFIRPYAQKDIFCVGGTSLFWKLTPNKQNLDYQEIQGMKRGKAKVSLIMCCNADGSERLPLWIVGYAQNPRSFEQCGIFPKSMNFEWKWNGRASISPIIMEEWLRWFDTRMQGRKVLLMLESNDTYQFGVESVRRFKGGFQNTSVFRIPEKTLDIKSPFEQGIVDTFKANYRRYWLQYSLNQINILRDPLKAVNVLKAIRWMLWSWNFGVSEKTIQASFLRSGLLGPHSEAEGQGMESYQKAIMEIGNLISSKGSEAVKQINEYIRPSEEDETKLHQDAVDTVAAEFLEERRFESDEEEDVEPQISNVEAAMAFEVLIKYFEQHENGDPSFVLDLYRRQRVIAPNNLIA" }, "uniProtKBCrossReferences": [ { "database": "EMBL", "id": "U86754", "properties": [ { "key": "ProteinId", "value": "AAB80698.1" }, { "key": "Status", "value": "-" }, { "key": "MoleculeType", "value": "mRNA" } ] }, { "database": "EMBL", "id": "CU329670", "properties": [ { "key": "ProteinId", "value": "CAB16408.1" }, { "key": "Status", "value": "-" }, { "key": "MoleculeType", "value": "Genomic_DNA" } ] }, { "database": "PIR", "id": "T39217", "properties": [ { "key": "EntryName", "value": "T39217" } ] }, { "database": "RefSeq", "id": "NP_594583.1", "properties": [ { "key": "NucleotideSequenceId", "value": "NM_001020012.3" } ] }, { "database": "AlphaFoldDB", "id": "O14423", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "SMR", "id": "O14423", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "BioGRID", "id": "279715", "properties": [ { "key": "Interactions", "value": "81" } ] }, { "database": "FunCoup", "id": "O14423", "properties": [ { "key": "Number of interactors", "value": "288" } ] }, { "database": "IntAct", "id": "O14423", "properties": [ { "key": "Interactions", "value": "3" } ] }, { "database": "STRING", "id": "284812.O14423", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "iPTMnet", "id": "O14423", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "PaxDb", "id": "284812-O14423", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "GeneID", "id": "2543290", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "KEGG", "id": "spo:2543290", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "PomBase", "id": "SPAC9E9.10c", "properties": [ { "key": "GeneName", "value": "cbh1" } ] }, { "database": "VEuPathDB", "id": "FungiDB:SPAC9E9.10c", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "eggNOG", "id": "KOG3105", "properties": [ { "key": "ToxonomicScope", "value": "Eukaryota" } ] }, { "database": "HOGENOM", "id": "CLU_018294_0_3_1", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "InParanoid", "id": "O14423", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "OMA", "id": "WIKTEWP", "properties": [ { "key": "Fingerprint", "value": "-" } ] }, { "database": "PhylomeDB", "id": "O14423", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "PRO", "id": "PR:O14423", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "Proteomes", "id": "UP000002485", "properties": [ { "key": "Component", "value": "Chromosome I" } ] }, { "database": "GO", "id": "GO:0000785", "properties": [ { "key": "GoTerm", "value": "C:chromatin" }, { "key": "GoEvidenceType", "value": "NAS:PomBase" } ] }, { "database": "GO", "evidences": [ { "evidenceCode": "ECO:0000314", "id": "10733588", "source": "PubMed" }, { "evidenceCode": "ECO:0000314", "id": "9237993", "source": "PubMed" } ], "id": "GO:0000779", "properties": [ { "key": "GoTerm", "value": "C:condensed chromosome, centromeric region" }, { "key": "GoEvidenceType", "value": "IDA:PomBase" } ] }, { "database": "GO", "evidences": [ { "evidenceCode": "ECO:0007005", "id": "16823372", "source": "PubMed" } ], "id": "GO:0005634", "properties": [ { "key": "GoTerm", "value": "C:nucleus" }, { "key": "GoEvidenceType", "value": "HDA:PomBase" } ] }, { "database": "GO", "evidences": [ { "evidenceCode": "ECO:0000314", "id": "10733588", "source": "PubMed" }, { "evidenceCode": "ECO:0000314", "id": "9237993", "source": "PubMed" } ], "id": "GO:0019237", "properties": [ { "key": "GoTerm", "value": "F:centromeric DNA binding" }, { "key": "GoEvidenceType", "value": "IDA:PomBase" } ] }, { "database": "GO", "id": "GO:0003677", "properties": [ { "key": "GoTerm", "value": "F:DNA binding" }, { "key": "GoEvidenceType", "value": "IBA:GO_Central" } ] }, { "database": "FunFam", "id": "1.10.10.60:FF:000313", "properties": [ { "key": "EntryName", "value": "major centromere autoantigen B" }, { "key": "MatchStatus", "value": "1" } ] }, { "database": "Gene3D", "id": "1.10.10.60", "properties": [ { "key": "EntryName", "value": "Homeodomain-like" }, { "key": "MatchStatus", "value": "2" } ] }, { "database": "InterPro", "id": "IPR050863", "properties": [ { "key": "EntryName", "value": "CenT-Element_Derived" } ] }, { "database": "InterPro", "id": "IPR004875", "properties": [ { "key": "EntryName", "value": "DDE_SF_endonuclease_dom" } ] }, { "database": "InterPro", "id": "IPR009057", "properties": [ { "key": "EntryName", "value": "Homeodomain-like_sf" } ] }, { "database": "InterPro", "id": "IPR041188", "properties": [ { "key": "EntryName", "value": "HTH_ABP1_N" } ] }, { "database": "InterPro", "id": "IPR006600", "properties": [ { "key": "EntryName", "value": "HTH_CenpB_DNA-bd_dom" } ] }, { "database": "PANTHER", "id": "PTHR19303:SF73", "properties": [ { "key": "EntryName", "value": "PROTEIN PDC2" }, { "key": "MatchStatus", "value": "1" } ] }, { "database": "PANTHER", "id": "PTHR19303", "properties": [ { "key": "EntryName", "value": "TRANSPOSON" }, { "key": "MatchStatus", "value": "1" } ] }, { "database": "Pfam", "id": "PF03184", "properties": [ { "key": "EntryName", "value": "DDE_1" }, { "key": "MatchStatus", "value": "1" } ] }, { "database": "Pfam", "id": "PF18107", "properties": [ { "key": "EntryName", "value": "HTH_ABP1_N" }, { "key": "MatchStatus", "value": "1" } ] }, { "database": "Pfam", "id": "PF03221", "properties": [ { "key": "EntryName", "value": "HTH_Tnp_Tc5" }, { "key": "MatchStatus", "value": "1" } ] }, { "database": "SMART", "id": "SM00674", "properties": [ { "key": "EntryName", "value": "CENPB" }, { "key": "MatchStatus", "value": "1" } ] }, { "database": "SUPFAM", "id": "SSF46689", "properties": [ { "key": "EntryName", "value": "Homeodomain-like" }, { "key": "MatchStatus", "value": "2" } ] }, { "database": "PROSITE", "id": "PS51253", "properties": [ { "key": "EntryName", "value": "HTH_CENPB" }, { "key": "MatchStatus", "value": "1" } ] } ], "uniProtkbId": "CBH1_SCHPO" }