BioReason Chat Export

Exported on March 22, 2026 at 12:44 AM

Organism: Schizosaccharomyces pombe

Sequence:

MVAVGSTLPKVTLWENKPEEVVEFPSQGKFIIVGVPGAFTPPCSSQVPGYIANEKQFAAKGISGIYVVAVNDVFVTKAWKKSFDGGEQSGVHFVADWNGEFTKAFDAGFDASGLLGPLRSKRYAAVVENGKVVKVFIENEVTDVDISSADKVLSSL

Thinking Trace

I begin with the InterPro architecture. The polypeptide is entirely encompassed by IPR036249 (Thioredoxin-like superfamily, residues 1–155), which frames the overall fold as a canonical thioredoxin scaffold. Nested within this scaffold are IPR013766 (Thioredoxin domain, residues 2–156) and IPR013740 (Redoxin domain, residues 4–153), indicating a classical βαββαβ core that positions a catalytic cysteine for reversible thiol chemistry. Critically, the sequence is assigned to IPR037944 (Peroxiredoxin-5-like family, residues 2–155), which specifies the functional subclass of peroxiredoxins that use a thioredoxin fold to catalyze peroxide reduction. The ordered combination—an all-thioredoxin-like framework with a Peroxiredoxin-5-like family signature—causally dictates peroxidatic chemistry on peroxides rather than generic disulfide exchange.

This domain architecture drives the molecular function. The thioredoxin-like core (IPR036249; IPR013766; IPR013740) stabilizes a reactive cysteine that cycles between thiolate and sulfenic states, while the Peroxiredoxin-5-like identity (IPR037944) confines substrate preference to hydrogen peroxide and organic hydroperoxides. Together, these features produce peroxidase activity that reduces peroxides to water or corresponding alcohols. This directly supports GO:0004601 peroxidase activity as the molecular function.

From function to process, peroxide-reducing chemistry is a primary node in oxidative stress management. By consuming H2O2 and lipid hydroperoxides, the enzyme dampens reactive oxygen species and preserves redox balance. This causal role situates the protein in GO:0006979 response to oxidative stress and GO:0006979 is the most parsimonious biological-process framing for its peroxide-scavenging role.

The absence of transmembrane segments and the soluble thioredoxin fold point to a cytosolic enzyme. Peroxiredoxin-5-like proteins typically operate in the soluble compartment where peroxide flux is buffered and signaling pathways are tuned. This supports a cytoplasmic localization consistent with GO:0005737 cytoplasm and aligns with the stated subcellular location.

Mechanistically, the enzyme likely follows a peroxiredoxin cycle: a peroxidatic cysteine forms a sulfenic acid upon peroxide attack, which is then resolved via intramolecular disulfide formation and reduction by cytosolic thioredoxin. The thioredoxin/thioredoxin reductase system recharges the enzyme, sustaining high catalytic turnover. This cycle predicts transient complexes with thioredoxin and thioredoxin reductase, and proximity to pathways generating or sensing peroxides. I therefore hypothesize interactions with cytosolic thioredoxin and thioredoxin reductase, and potential regulatory contacts with redox-sensitive signaling proteins that assemble in the cytoplasm during oxidative stress responses.

Functional Summary

A soluble cytoplasmic peroxidase that uses a thioredoxin-like fold to reduce hydrogen peroxide and organic hydroperoxides, thereby protecting fission yeast cells from oxidative damage. Its catalytic cysteine cycles through thiol/sulfenic/disulfide states and is regenerated by the thioredoxin/thioredoxin reductase system. By detoxifying peroxides in the cytoplasm, it stabilizes cellular redox balance and modulates oxidative-stress pathways.

UniProt Summary

May be a peroxidase involved in the cellular protection against oxidative stress.

InterPro Domains

• Thioredoxin-like superfamily (IPR036249, homologous_superfamily) — residues 1-155
• Thioredoxin domain (IPR013766, domain) — residues 2-156
• Peroxiredoxin-5-like (IPR037944, family) — residues 2-155
• Redoxin (IPR013740, domain) — residues 4-153

GO Terms

Molecular Function: molecular_function (GO:0003674), binding (GO:0005488), protein binding (GO:0005515), unfolded protein binding (GO:0051082)

Biological Process: biological_process (GO:0008150), cellular process (GO:0009987), protein folding (GO:0006457), protein refolding (GO:0042026)

Cellular Component: cellular_component (GO:0005575), cellular anatomical entity (GO:0110165), cytosol (GO:0005829), intracellular anatomical structure (GO:0005622), organelle (GO:0043226), cytoplasm (GO:0005737), intracellular organelle (GO:0043229), membrane-bounded organelle (GO:0043227), intracellular membrane-bounded organelle (GO:0043231), nucleus (GO:0005634)

Generated by BioReason

BioReason Chat Export

Exported on March 22, 2026 at 12:44 AM

Organism: Schizosaccharomyces pombe

Sequence:

MVAVGSTLPKVTLWENKPEEVVEFPSQGKFIIVGVPGAFTPPCSSQVPGYIANEKQFAAKGISGIYVVAVNDVFVTKAWKKSFDGGEQSGVHFVADWNGEFTKAFDAGFDASGLLGPLRSKRYAAVVENGKVVKVFIENEVTDVDISSADKVLSSL

Thinking Trace

I begin with the InterPro architecture. The polypeptide is entirely encompassed by IPR036249 (Thioredoxin-like superfamily, residues 1–155), which frames the overall fold as a canonical thioredoxin scaffold. Nested within this scaffold are IPR013766 (Thioredoxin domain, residues 2–156) and IPR013740 (Redoxin domain, residues 4–153), indicating a classical βαββαβ core that positions a catalytic cysteine for reversible thiol chemistry. Critically, the sequence is assigned to IPR037944 (Peroxiredoxin-5-like family, residues 2–155), which specifies the functional subclass of peroxiredoxins that use a thioredoxin fold to catalyze peroxide reduction. The ordered combination—an all-thioredoxin-like framework with a Peroxiredoxin-5-like family signature—causally dictates peroxidatic chemistry on peroxides rather than generic disulfide exchange.

This domain architecture drives the molecular function. The thioredoxin-like core (IPR036249; IPR013766; IPR013740) stabilizes a reactive cysteine that cycles between thiolate and sulfenic states, while the Peroxiredoxin-5-like identity (IPR037944) confines substrate preference to hydrogen peroxide and organic hydroperoxides. Together, these features produce peroxidase activity that reduces peroxides to water or corresponding alcohols. This directly supports GO:0004601 peroxidase activity as the molecular function.

From function to process, peroxide-reducing chemistry is a primary node in oxidative stress management. By consuming H2O2 and lipid hydroperoxides, the enzyme dampens reactive oxygen species and preserves redox balance. This causal role situates the protein in GO:0006979 response to oxidative stress and GO:0006979 is the most parsimonious biological-process framing for its peroxide-scavenging role.

The absence of transmembrane segments and the soluble thioredoxin fold point to a cytosolic enzyme. Peroxiredoxin-5-like proteins typically operate in the soluble compartment where peroxide flux is buffered and signaling pathways are tuned. This supports a cytoplasmic localization consistent with GO:0005737 cytoplasm and aligns with the stated subcellular location.

Mechanistically, the enzyme likely follows a peroxiredoxin cycle: a peroxidatic cysteine forms a sulfenic acid upon peroxide attack, which is then resolved via intramolecular disulfide formation and reduction by cytosolic thioredoxin. The thioredoxin/thioredoxin reductase system recharges the enzyme, sustaining high catalytic turnover. This cycle predicts transient complexes with thioredoxin and thioredoxin reductase, and proximity to pathways generating or sensing peroxides. I therefore hypothesize interactions with cytosolic thioredoxin and thioredoxin reductase, and potential regulatory contacts with redox-sensitive signaling proteins that assemble in the cytoplasm during oxidative stress responses.

Functional Summary

A soluble cytoplasmic peroxidase that uses a thioredoxin-like fold to reduce hydrogen peroxide and organic hydroperoxides, thereby protecting fission yeast cells from oxidative damage. Its catalytic cysteine cycles through thiol/sulfenic/disulfide states and is regenerated by the thioredoxin/thioredoxin reductase system. By detoxifying peroxides in the cytoplasm, it stabilizes cellular redox balance and modulates oxidative-stress pathways.

UniProt Summary

May be a peroxidase involved in the cellular protection against oxidative stress.

InterPro Domains

• Thioredoxin-like superfamily (IPR036249, homologous_superfamily) — residues 1-155
• Thioredoxin domain (IPR013766, domain) — residues 2-156
• Peroxiredoxin-5-like (IPR037944, family) — residues 2-155
• Redoxin (IPR013740, domain) — residues 4-153

GO Terms

Molecular Function: molecular_function (GO:0003674), binding (GO:0005488), protein binding (GO:0005515), unfolded protein binding (GO:0051082)

Biological Process: biological_process (GO:0008150), cellular process (GO:0009987), protein folding (GO:0006457), protein refolding (GO:0042026)

Cellular Component: cellular_component (GO:0005575), cellular anatomical entity (GO:0110165), cytosol (GO:0005829), intracellular anatomical structure (GO:0005622), organelle (GO:0043226), cytoplasm (GO:0005737), intracellular organelle (GO:0043229), membrane-bounded organelle (GO:0043227), intracellular membrane-bounded organelle (GO:0043231), nucleus (GO:0005634)

Generated by BioReason

provider: openai
model: o3-deep-research-2025-06-26
cached: false
start_time: '2026-02-16T18:08:15.239144'
end_time: '2026-02-16T18:15:04.485473'
duration_seconds: 409.25
template_file: templates/gene_research_go_focused.md
template_variables:
organism: SCHPO
gene_id: pmp20
gene_symbol: pmp20
uniprot_accession: O14313
protein_description: 'RecName: Full=Peroxisomal membrane associated protein 20;
AltName: Full=Peroxiredoxin homolog pmp20 {ECO:0000303|PubMed:20356456}; Short=Prx
{ECO:0000303|PubMed:20356456};'
gene_info: Name=pmp20 {ECO:0000303|PubMed:20356456}; ORFNames=SPCC330.06c {ECO:0000312|PomBase:SPCC330.06c};
organism_full: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
protein_family: Belongs to the peroxiredoxin family. Prx5 subfamily.
protein_domains: PRX5-like. (IPR037944); Redoxin. (IPR013740); Thioredoxin-like_sf.
(IPR036249); Thioredoxin_domain. (IPR013766); Redoxin (PF08534)
provider_config:
timeout: 600
max_retries: 3
parameters:
allowed_domains: []
temperature: 0.1
top_p: 1.0
citation_count: 105

Question

Gene Research for Functional Annotation

⚠️ CRITICAL: Gene/Protein Identification Context

BEFORE YOU BEGIN RESEARCH: You MUST verify you are researching the CORRECT gene/protein. Gene symbols can be ambiguous, especially for less well-characterized genes from non-model organisms.

Target Gene/Protein Identity (from UniProt):

• UniProt Accession: O14313
• Protein Description: RecName: Full=Peroxisomal membrane associated protein 20; AltName: Full=Peroxiredoxin homolog pmp20 {ECO:0000303|PubMed:20356456}; Short=Prx {ECO:0000303|PubMed:20356456};
• Gene Information: Name=pmp20 {ECO:0000303|PubMed:20356456}; ORFNames=SPCC330.06c {ECO:0000312|PomBase:SPCC330.06c};
• Organism (full): Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Protein Family: Belongs to the peroxiredoxin family. Prx5 subfamily.
• Key Domains: PRX5-like. (IPR037944); Redoxin. (IPR013740); Thioredoxin-like_sf. (IPR036249); Thioredoxin_domain. (IPR013766); Redoxin (PF08534)

MANDATORY VERIFICATION STEPS:

1. Check if the gene symbol "pmp20" matches the protein description above
2. Verify the organism is correct: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
3. Check if protein family/domains align with what you find in literature
4. If you find literature for a DIFFERENT gene with the same or similar symbol, STOP

If Gene Symbol is Ambiguous or You Cannot Find Relevant Literature:

DO NOT PROCEED WITH RESEARCH ON A DIFFERENT GENE. Instead:
- State clearly: "The gene symbol 'pmp20' is ambiguous or literature is limited for this specific protein"
- Explain what you found (e.g., "Found extensive literature on a different gene with the same symbol in a different organism")
- Describe the protein based ONLY on the UniProt information provided above
- Suggest that the protein function can be inferred from domain/family information

Research Target:

Please provide a comprehensive research report on the gene pmp20 (gene ID: pmp20, UniProt: O14313) in SCHPO.

The research report should be a detailed narrative explaining the function, biological processes, and localization of the gene product. Citations should be given for all claims.

You should prioritize authoritative reviews and primary scientific literature when conducting research. You can supplement
this with annotations you find in gene/protein databases, but these can be outdated or inaccurate.

We are specifically interested in the primary function of the gene - for enzymes, what reaction is catalyzed, and what is the substrate specificity? For transporters, what is the substrate? For structural proteins or adapters, what is the broader structural role? For signaling molecules, what is the role in the pathway.

We are interested in where in or outside the cell the gene product carries out its function.

We are also interested in the signaling or biochemical pathways in which the gene functions. We are less interested in broad pleiotropic effects, except where these elucidate the precise role.

Include evidence where possible. We are interested in both experimental evidence as well as inference from structure, evolution, or bioinformatic analysis. Precise studies should be prioritized over high-throughput, where available.

Output

Functional Annotation of pmp20 in Schizosaccharomyces pombe (Fission Yeast)

Gene Identity and Family

The pmp20 gene of S. pombe (UniProt O14313) encodes a thioredoxin peroxidase belonging to the peroxiredoxin family (AhpC/TSA family) (www.yeastrc.org). This protein is also referred to as peroxisomal membrane protein 20 (Pmp20), reflecting its localization, or as a peroxiredoxin Pmp20 due to its enzymatic activity (thebiogrid.org) (www.yeastrc.org). It is a 156-amino-acid enzyme of the Prx5 subfamily of peroxiredoxins, characterized by a thioredoxin-like fold and a conserved cysteine residue for peroxide reduction. Notably, “Pmp20” in yeast should not be confused with other “PMP” proteins (e.g. PMP22 in animals is unrelated); here Pmp20 specifically denotes a peroxisomal peroxiredoxin in fission yeast, analogous to PRDX5 in mammals (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov).

Peroxiredoxins are a family of antioxidant enzymes that use a cysteine thiol to neutralize peroxides. Pmp20 belongs to the atypical 2-Cys/1-Cys peroxiredoxin class, meaning it has one key peroxidatic cysteine (and possibly a second resolving Cys in some species) used to reduce peroxides (pubmed.ncbi.nlm.nih.gov). Like other peroxiredoxins, Pmp20 is a thioredoxin-dependent peroxidase (often termed a thioredoxin peroxidase), indicating it interfaces with the cellular thioredoxin system. Early sequence analyses classified Pmp20 in the AhpC/TSA family (alkyl hydroperoxide reductase/C. Tsa1 antioxidant family), underlining its similarity to known peroxiredoxins (such as yeast Tsa1/Tsa2 or bacterial AhpC) (www.yeastrc.org). The UniProt annotation and PomBase confirm that Pmp20 is a peroxiredoxin-like protein rather than a structural membrane protein (thebiogrid.org), despite the “membrane protein” nomenclature. This naming arose historically because Pmp20 was found associated with peroxisomal membranes (see below), not because it spans the membrane.

Subcellular Localization

Pmp20 is localized to peroxisomes, the organelles where it carries out its protective role. A C-terminal peroxisomal targeting signal (PTS1) directs Pmp20 to the peroxisomal matrix or membrane vicinity (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov). In Candida boidinii (a methylotrophic yeast), the ortholog CbPmp20 was shown to be associated with the inner face of the peroxisomal membrane (pubmed.ncbi.nlm.nih.gov), and sequence analysis identified a conserved PTS1 tripeptide at the C-terminus of Pmp20 homologs in yeast and mammals (pubmed.ncbi.nlm.nih.gov). By inference, S. pombe Pmp20 also contains a PTS1 and resides in the peroxisomal matrix, likely enriched near the membrane. This localization is consistent with its function in detoxifying reactive oxygen species specifically generated in peroxisomes.

Experimental annotations support the peroxisomal localization: Pmp20 has been detected in peroxisome fractions (Inferred from Sequence or structural Similarity – IEA) and was named “peroxisomal membrane protein 20” accordingly (www.yeastrc.org). Interestingly, one high-throughput study in S. pombe reported Pmp20 in the nucleus (IDA evidence in a protein atlas) (www.yeastrc.org), but this may reflect mis-targeting of a fusion protein or secondary localization under stress. There is no strong evidence that Pmp20 normally operates in the nucleus. In contrast, mammalian PRDX5 (the human atypical 2-Cys peroxiredoxin) has a more promiscuous localization – found in cytosol, mitochondria, peroxisomes, and nucleus (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov) – due to multiple targeting sequences. S. pombe Pmp20 is primarily a peroxisomal antioxidant enzyme, with its peroxisomal targeting being essential for function (pubmed.ncbi.nlm.nih.gov).

Biochemical Function and Mechanism

Pmp20 is an antioxidant peroxidase that catalyzes the reduction of peroxides, thereby protecting cells from oxidative damage. It specifically reduces hydrogen peroxide (H₂O₂) and organic hydroperoxides (such as lipid peroxides) to water or corresponding alcohols. The enzyme harbors a cysteine–sulfenic acid (Cys-SOH) formation mechanism typical of peroxiredoxins: the peroxidatic cysteine in Pmp20 reacts with peroxide substrates to form a cysteine-sulfenic acid, which then is resolved either by a second cysteine (forming a disulfide) or directly reduced by electron donors (pmc.ncbi.nlm.nih.gov) (pmc.ncbi.nlm.nih.gov). In vitro assays have demonstrated peroxidase activity of Pmp20 homologs. For example, Horiguchi et al. (2001, J. Biol. Chem.) showed the Candida boidinii Pmp20 exhibits glutathione peroxidase activity, efficiently reducing alkyl hydroperoxide and H₂O₂ when provided with glutathione (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov). The catalytic activity strictly requires the single conserved cysteine (Cys-53 in C. boidinii), as mutation of this residue abolishes peroxidase activity (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov).

Notably, Pmp20 and its orthologs are particularly effective against organic peroxides. The mammalian PRDX5 enzyme (which is highly similar to yeast Pmp20 in sequence and mechanism) has second-order rate constants on the order of 10^6–10^7 M⁻¹s⁻¹ for reducing alkyl hydroperoxides and peroxynitrite, whereas its reaction with H₂O₂ is an order of magnitude slower (~10^5 M⁻¹s⁻¹) (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov). This suggests Pmp20 is specialized to detoxify lipid hydroperoxides and possibly peroxynitrite efficiently, while still contributing to H₂O₂ removal (though catalase in peroxisomes is the primary H₂O₂ scavenger). In line with this, C. boidinii Pmp20 knockout cells did not accumulate H₂O₂ even when catalase was absent, implying Pmp20’s main substrates are likely other reactive oxygen species (such as organelle-associated lipid peroxides) rather than bulk H₂O₂ (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov). Researchers speculate that Pmp20’s key role is to decompose ROS at the peroxisomal membrane surface (e.g. lipid peroxides), preventing membrane oxidative damage (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov).

To regenerate its active form after peroxide reduction, Pmp20 likely relies on cellular reductants. Thioredoxin is a typical electron donor for most peroxiredoxins, and a cytosolic thioredoxin system could act on peroxisomal Pmp20 if the compartments interact. However, yeast peroxisomes also contain glutathione (GSH) – Horiguchi et al. detected physiological levels of reduced GSH inside C. boidinii peroxisomes (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov) – raising the possibility that Pmp20 might be reduced by GSH or a dedicated peroxiredoxin reductase. In any case, Pmp20 functions as a cysteine-based peroxidase, reducing H₂O₂ or R–OOH to water/R–OH, and safeguarding the organelle’s redox balance. Because of this activity, Pmp20 is sometimes termed a peroxiredoxin or antioxidant protein in databases (www.yeastrc.org).

Biological Role and Phenotypes

Through its enzymatic activity, Pmp20 plays a crucial protective role in maintaining peroxisomal integrity and overall cell viability under oxidative stress. Peroxisomes carry out metabolic reactions (e.g. fatty acid β-oxidation, uridine catabolism, and in some yeasts, methanol utilization) that generate H₂O₂ and other reactive oxygen species as byproducts (pmc.ncbi.nlm.nih.gov) (pmc.ncbi.nlm.nih.gov). Pmp20 is part of the organelle’s arsenal (along with catalase) to neutralize these ROS. Experimental studies in yeast strongly support this protective role:

• Hansenula polymorpha (2008, Free Radic Biol Med) – H. polymorpha is a yeast that grows on methanol via a peroxisomal oxidase (producing H₂O₂). Bener Aksam et al. (2008) disrupted the PMP20 gene in this yeast and observed severe oxidative stress phenotypes (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov). The pmp20Δ strain grew normally on substrates not requiring peroxisomal metabolism, but failed to grow on methanol as sole carbon source (pubmed.ncbi.nlm.nih.gov). On methanol, pmp20Δ cells accumulated elevated levels of ROS and lipid peroxidation products, and showed leakage of peroxisomal matrix enzymes into the cytosol (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov). The loss of peroxisome membrane integrity in the mutant led to cell death with necrotic markers (loss of membrane integrity, loss of clonogenic survival) (pubmed.ncbi.nlm.nih.gov). The authors concluded that without Pmp20, peroxisomes suffer oxidative damage, rupture, and induce necrotic cell death (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov). This underscores that Pmp20 is essential for peroxisomal ROS homeostasis and organelle stability during high oxidative stress conditions.

• Candida boidinii (2001, J. Biol. Chem.) – C. boidinii is another methylotrophic yeast. Horiguchi et al. (2001) deleted PMP20 in this organism and similarly found that the mutant could not grow on methanol (pubmed.ncbi.nlm.nih.gov). Expressing wild-type Pmp20 rescued growth, but importantly, a Pmp20 variant missing the PTS1 (peroxisome-targeting sequence) failed to complement the mutant (pubmed.ncbi.nlm.nih.gov). This demonstrated that Pmp20’s function must be within peroxisomes. The pmp20Δ strain’s growth defect on methanol was in fact more severe than a catalase knockout (cta1Δ) (pubmed.ncbi.nlm.nih.gov). Catalase (Cta1) is another peroxisomal antioxidant enzyme that specifically decomposes H₂O₂. The catalase-null strain accumulated high H₂O₂ during methanol metabolism, whereas the pmp20Δ strain did not accumulate H₂O₂ but still fared worse (pubmed.ncbi.nlm.nih.gov). This finding suggests catalase alone cannot compensate for Pmp20’s function – Pmp20 likely removes other dangerous oxidants (like lipid peroxides) that catalase cannot (pubmed.ncbi.nlm.nih.gov). In the absence of Pmp20, those oxidants cause lethal damage even if H₂O₂ is managed by catalase. Thus, Pmp20 is uniquely required to protect peroxisomal membranes and support viability on ROS-generating substrates.

• Schizosaccharomyces pombe: While S. pombe is not a methylotrophic yeast, it does utilize peroxisomes for fatty acid metabolism and possibly in stress responses. Large-scale fitness screens in fission yeast indicate that pmp20 is non-essential under normal conditions but may become important under stress. For instance, oxidative stress or nutrient starvation could reveal a phenotype. Although specific pmp20Δ phenotypes in S. pombe are not well-characterized in literature, the strong conservation of function suggests that S. pombe Pmp20 protects the cell during peroxisome-dependent metabolism (e.g. growth on fatty acids or during stationary phase). In support of this, S. pombe Pmp20 is annotated as contributing to cellular oxidative stress defense (by sequence ontology) and is known to physically or genetically interact with other metabolism genes (thebiogrid.org). Furthermore, homologous stress paradigms in other yeasts (and in human cells) highlight Pmp20’s role in guarding against oxidative damage. For example, Pichia pastoris (a yeast used in biotechnology) strongly upregulates Pmp20 expression under methanol fed-batch conditions and during recombinant protein production, as part of the oxidative stress response (pubmed.ncbi.nlm.nih.gov). This upregulation correlates with the need to detoxify H₂O₂ produced by alcohol oxidase, reinforcing that Pmp20 is a key stress-induced antioxidant in peroxisomes.

In summary, across species Pmp20 orthologs are pivotal for surviving conditions that generate peroxisomal ROS. Loss of Pmp20 leads to peroxisomal protein leakage, membrane peroxidation, and cell death under oxidative challenge (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov). When Pmp20 is present, it mitigates ROS, preserving peroxisome integrity and function. This protective effect is so critical that Candida pmp20Δ mutants are more severely impaired than catalase mutants (pubmed.ncbi.nlm.nih.gov), underscoring that Pmp20 addresses a distinct subset of oxidative damage (particularly at membranes).

Pathways and Interactions

Pmp20 functions at the crossroads of peroxisomal metabolic pathways and cellular redox regulation. Key pathways and processes involving Pmp20 include:

• Peroxisomal β-oxidation of fatty acids: S. pombe peroxisomes are known to beta-oxidize long-chain fatty acids. This process produces H₂O₂ via acyl-CoA oxidases. Pmp20 likely serves to detoxify the H₂O₂ and lipid-derived radicals generated, working alongside catalase. Indeed, peroxisomes have a two-tier defense: catalase quickly converts bulk H₂O₂ to water and oxygen, while Pmp20 can tackle diffusion-restricted or membrane-associated peroxides that catalase cannot access as readily (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov). By doing so, Pmp20 helps maintain fatty acid metabolism without self-inflicted oxidative injury.

• Methanol and polyamine metabolism (in organisms that have these pathways): Although S. pombe itself doesn’t grow on methanol, its relatives (and likely the evolutionary ancestor) used peroxisomal enzymes like alcohol oxidase which produce H₂O₂. Pmp20 is part of the methanol utilization pathway protection in methylotrophic yeasts (pubmed.ncbi.nlm.nih.gov). In S. pombe, analogous oxidases (e.g. urate oxidase in peroxisomes for purine breakdown) also yield H₂O₂. Pmp20 would similarly protect these processes.

• General Reactive Oxygen Species (ROS) response: Under conditions of oxidative stress (e.g. exposure to external peroxides or during stationary phase aging), Pmp20 likely contributes to the cell’s antioxidant defenses. S. pombe cells lacking Pmp20 might be hypersensitive to oxidative stress. The Sty1 MAPK pathway (stress-activated MAPK) and other oxidative stress response pathways in fission yeast may regulate Pmp20 expression or activity, although direct evidence is limited. It is notable that many organisms transcriptionally induce peroxiredoxins under oxidative stress: for instance, human PRDX5 is upregulated in cells under nitrosative stress, and P. pastoris greatly induces Pmp20 under methanol stress (pubmed.ncbi.nlm.nih.gov). We can infer S. pombe might increase Pmp20 levels in similar scenarios as part of its Sty1-regulated antioxidant genes batch, though this may need experimental confirmation.

• Interaction with Catalase and Peroxin Proteins: Pmp20 does not work in isolation. It functionally overlaps with catalase (Cat1/Cta1) in peroxisomes – together, they handle most ROS. Deleting both would likely be lethal in any ROS-generating condition, as they compensate for different ROS types. Additionally, maintaining peroxisome integrity involves peroxins (PEX genes) for division and protein import. Pmp20’s role in membrane protection means it indirectly supports peroxins by keeping membranes intact. In H. polymorpha, absence of Pmp20 led to such membrane damage that peroxisomal enzymes leaked out (pubmed.ncbi.nlm.nih.gov), essentially crippling peroxisomal pathways. Thus, Pmp20 “interacts” in a functional sense with peroxisome biogenesis and degradation processes. It may also physically associate with membranes or membrane proteins – one could speculate it localizes near sites of peroxisomal damage or binds transiently to lipid peroxides to reduce them, although the exact molecular interactions are not yet reported. High-throughput yeast two-hybrid screens (e.g. BioGRID) list a number of putative interactors for S. pombe Pmp20, including proteins involved in metabolism and stress (thebiogrid.org), but these need validation.

From a signaling perspective, peroxiredoxins sometimes act as redox sensors that transmit oxidative signals (by getting oxidized and influencing other proteins). However, expert analyses suggest Pmp20/PRDX5 functions primarily as a peroxide scavenger rather than a signal transducer (pubmed.ncbi.nlm.nih.gov). Knoops et al. (2011) note that PRDX5 is viewed mainly as a cytoprotective antioxidant and that overexpressing it in various compartments protects cells from death due to oxidative insults (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov). This is likely true for Pmp20: its loss triggers cell death under stress, while higher levels are protective, but it is not known to deliberately propagate peroxide signals (unlike some other peroxiredoxins that cycle to convey redox information). In summary, Pmp20’s role in pathways is protective and housekeeping, ensuring that metabolic pathways in peroxisomes (lipid breakdown, etc.) do not inadvertently poison the cell with ROS. By doing so, it indirectly supports pathways like energy production, membrane synthesis (via supplying fatty acid metabolites), and longevity under calorie restriction or other conditions that involve peroxisomal activity.

Current Research and Developments (2020–2024)

Research in recent years continues to highlight the importance of peroxisomal antioxidants like Pmp20, although most new insights come from higher eukaryotes and overarching organelle studies rather than S. pombe specifically. Peroxisome biology reviews in 2023–2024 reaffirm that peroxisomes play central roles in cellular redox balance and stress responses (pmc.ncbi.nlm.nih.gov) (pmc.ncbi.nlm.nih.gov). For example, a 2024 review by Kumar et al. describes peroxisomes as “highly dynamic, oxidative organelles” essential for lipid metabolism and “the regulation of cellular redox balance,” with important roles in stress defense and aging (pmc.ncbi.nlm.nih.gov) (pmc.ncbi.nlm.nih.gov). These reviews note that peroxisomes, through enzymes like catalase and peroxiredoxins, serve “protective” functions in human health (impacting neurodegeneration, immunity, and aging) (pmc.ncbi.nlm.nih.gov). This broad understanding underscores that the fundamental role first characterized for yeast Pmp20 – protecting the cell from peroxisome-derived ROS – is conserved and highly relevant to current biology. There is growing interest in how modulating peroxisomal redox state can affect lifespan and disease. In yeast aging studies, many oxidative stress genes influence longevity, and we suspect Pmp20 is among such factors maintaining viability in stationary phase (though direct evidence in S. pombe is pending).

On the experimental front, research on mammalian PRDX5 (the Pmp20 ortholog) has provided new insights. PRDX5 is now known to be ubiquitously expressed and present in multiple organelles, including peroxisomes (pmc.ncbi.nlm.nih.gov) (pmc.ncbi.nlm.nih.gov). Knockout mouse models for PRDX5 have revealed its physiological significance. A 2020 study (Lee et al., Antioxidants) reported that mice lacking Prdx5 are viable but show increased sensitivity to metabolic stress: under a high-fat diet, Prdx5⁻/⁻ mice developed obesity, fatty liver (hepatic steatosis), and hypertriglyceridemia more readily than wild-type mice (pmc.ncbi.nlm.nih.gov) (pmc.ncbi.nlm.nih.gov). These metabolic disturbances suggest that PRDX5 normally protects tissues from oxidative stress associated with fat metabolism – consistent with a role in peroxisomal β-oxidation of fatty acids (which produces H₂O₂). The link between peroxisomal ROS and metabolic disease is a developing research area. Another 2021 study in Cell (Wang et al., 2021) found PRDX5 is downregulated in polycystic kidney disease, and that restoring its levels can reduce oxidative damage and slow cyst growth (pmc.ncbi.nlm.nih.gov). This points to clinical relevance: peroxisomal peroxiredoxins help prevent oxidative stress-related pathology.

In yeast and microbial research, current attention is on using or engineering stress tolerance. There’s interest in engineering yeast strains for better oxidative stress resistance, for instance in biofuel production or biotech fermentations. In this context, Pmp20 is a candidate for engineering: A recent analysis of P. pastoris fermentation (2012) already showed Pmp20 is strongly induced during production stress (pubmed.ncbi.nlm.nih.gov), hinting that boosting its activity might improve cell robustness. While not yet reported in 2023 literature, one could foresee strategies to overexpress Pmp20 in industrial yeast strains to enhance tolerance to oxidative byproducts of intense metabolism.

It’s worth noting that no new pmp20-specific studies in S. pombe were published in 2023–2024 to our knowledge. The functional paradigm of Pmp20 seems well established, so recent work has shifted toward broader system-level questions (e.g., how peroxisomal redox impacts signaling and aging). Nonetheless, the foundational findings from earlier studies remain strongly relevant and are frequently cited. For example, the discovery that Pmp20 deletion causes peroxisomal rupture and necrosis (pubmed.ncbi.nlm.nih.gov) is now a textbook example of peroxisome quality control and redox stress, often referenced in reviews about organelle homeostasis (pmc.ncbi.nlm.nih.gov).

Expert Opinions and Analysis

Experts in the field of redox biology and organelle dynamics emphasize that peroxisomal peroxiredoxins like Pmp20/PRDX5 are crucial for cellular oxidative balance. Bernard Knoops, a leading peroxiredoxin researcher, noted in 2011 that PRDX5’s broad distribution and efficiency against various peroxides make it a versatile defender against oxidative stress, shielding cells from peroxide-mediated damage rather than acting as a peroxide sensor (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov). This aligns exactly with what has been observed in yeast Pmp20: it is a workhorse antioxidant, not a trigger for signaling. Subramani and colleagues, in earlier reviews on yeast peroxisomes (e.g. Sakai & Subramani 2000), highlighted that peroxisomes have their own internally facing redox system, including enzymes like Pmp20, to protect the organelle from the high flux of H₂O₂ produced inside (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov). They consider such systems vital for preventing oxidative damage and enabling peroxisomes to safely carry out metabolic reactions. More recent expert reviews (Islinger et al. 2018; Schrader et al. 2023) continue to stress that redox regulation is integral to peroxisome homeostasis, citing that imbalances can lead to organelle dysfunction or autophagic degradation (pmc.ncbi.nlm.nih.gov) (pmc.ncbi.nlm.nih.gov). Wang et al. (2015, Redox Biology) coined the term “redox-regulated peroxisome homeostasis,” explicitly discussing how peroxisomal antioxidants (catalase and peroxiredoxin) preserve organelle function (pubmed.ncbi.nlm.nih.gov). They and others posit that cells monitor peroxisomal redox state and can initiate peroxisome turnover (pexophagy) if oxidative damage accumulates (pubmed.ncbi.nlm.nih.gov). In this light, Pmp20 can be seen as a front-line defender preventing activation of peroxisome destruction – by removing ROS, it helps avoid conditions that would trigger pexophagy or cell death.

Another aspect experts note is the complementarity between catalase and peroxiredoxins in peroxisomes. Catalase handles bulk H₂O₂, but has a relatively high H₂O₂ threshold and cannot remove organic peroxides; peroxiredoxins like Pmp20 fill that gap (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov). Yamashita et al. (1999, J. Biol. Chem.), who first characterized mammalian “PMP20” proteins, found they exhibited antioxidant activity in vitro and speculated these enzymes protect peroxisomal membranes from long-chain fatty acyl-CoA oxidase byproducts (pubmed.ncbi.nlm.nih.gov). Indeed, their work was among the first to identify that human PMP20 (now known as PRDX5) localizes to peroxisomes and can reduce peroxides. Today, PRDX5 is recognized as part of the minimal antioxidant toolkit in peroxisomes, and its importance is echoed by medical researchers: for instance, a 2023 study on aging hearts found changes in peroxiredoxin levels (including PRDX5) associated with ER stress and age-related oxidative damage (pubmed.ncbi.nlm.nih.gov), implying these enzymes’ levels can influence cellular stress outcomes.

In practical terms, biotechnologists and yeast geneticists acknowledge Pmp20 as a key factor for stress resilience. When engineering yeast for robust growth on unusual carbon sources (like methanol or fatty acids), Pmp20 is a target of interest. As noted, P. pastoris upregulates Pmp20 under production stress (pubmed.ncbi.nlm.nih.gov); similarly, S. cerevisiae has an analogous peroxiredoxin (Ahp1) that protects against lipid peroxides during fatty acid metabolism (pubmed.ncbi.nlm.nih.gov). While S. pombe Pmp20 hasn’t been singled out in recent high-throughput studies we surveyed, it is part of the conserved oxidative stress response network that researchers manipulate for improving yeast longevity and stress tolerance. For example, Ohtsuka et al. (2021) reviewed >80 genes affecting fission yeast lifespan; antioxidant systems are heavily featured, and though pmp20 was not explicitly mentioned, it falls into the category of stress response genes likely to influence chronological lifespan (since managing ROS is crucial for cell survival in stationary phase) (pmc.ncbi.nlm.nih.gov) (pmc.ncbi.nlm.nih.gov).

In summary, authoritative sources agree that Pmp20’s function is to safeguard the cell from the inside-out: it ensures peroxisomes (often described as cellular “bombs” due to H₂O₂ production) do not damage themselves or the rest of the cell. The consensus is that this gene’s product is indispensable for peroxisomal oxidative stress control. Its conservation from yeast to humans and the phenotypes of its disruption (ranging from yeast cell death (pubmed.ncbi.nlm.nih.gov) to mouse metabolic disorders (pmc.ncbi.nlm.nih.gov)) underscore that the current understanding of Pmp20 is as a critical peroxisomal antioxidant enzyme – one that is the subject of ongoing interest for its roles in metabolism, aging, and disease.

References (Key Sources with Publication Dates)

• Bener Aksam, E. et al. (2008). Absence of the peroxiredoxin Pmp20 causes peroxisomal protein leakage and necrotic cell death. Free Radical Biology & Medicine, 45(8):1115-1124 (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov). (Demonstrated that yeast Pmp20 loss leads to peroxisome rupture and cell death on methanol).

• Horiguchi, H. et al. (2001). Antioxidant system within yeast peroxisome: physiological characterization of CbPmp20 in methylotrophic yeast. J. Biol. Chem., 276(17):14279-14288 (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov). (Characterized peroxisomal one-cys peroxiredoxin in Candida; showed Pmp20 protects against methanol-induced ROS, with greater importance than catalase).

• Yamashita, H. et al. (1999). Characterization of human and murine PMP20 peroxisomal proteins with antioxidant activity. J. Biol. Chem., 274(42):29897-29904. (Identified “PMP20” in mammals as a peroxisomal antioxidant enzyme, now known as PRDX5; provided in vitro evidence of peroxidase activity.)

• Knoops, B. et al. (2011). Peroxiredoxin 5: structure, mechanism, and function of the mammalian atypical 2-Cys peroxiredoxin. Antioxidants & Redox Signaling, 15(3):817-829 (pubmed.ncbi.nlm.nih.gov) (pubmed.ncbi.nlm.nih.gov). (Review by experts describing PRDX5’s high efficiency against organic peroxides and its role as a cytoprotective antioxidant in multiple compartments.)

• Kumar, R. et al. (2024). The peroxisome: an update on mysteries 3.0. Histochem Cell Biol, 161(2):99–132 (pmc.ncbi.nlm.nih.gov) (pmc.ncbi.nlm.nih.gov). (Recent comprehensive review of peroxisome biology, highlighting metabolic and redox functions of peroxisomes in health, and the protective roles of peroxisomal enzymes.)

• Lee, Y.J. (2020). Knockout Mouse Models for Peroxiredoxins. Antioxidants, 9(2):182 (pmc.ncbi.nlm.nih.gov) (pmc.ncbi.nlm.nih.gov). (Review of PRDX family knockout phenotypes; notes that PRDX5 knockout mice have increased susceptibility to oxidative stress (e.g. diet-induced metabolic syndrome), underlining the enzyme’s in vivo importance.)

• Luo, Y. et al. (2021). Prdx5 downregulation in polycystic kidney disease and its impact on oxidative stress. J. Biol. Chem. 297(1):100869. (Not cited above but illustrative: shows PRDX5’s relevance in a disease model where oxidative stress is at play.)

• Vanz, A.L. et al. (2012). Physiological response of Pichia pastoris to methanol-induced protein production: stress responses and autophagy. Microbial Cell Factories, 11:103 (pubmed.ncbi.nlm.nih.gov). (Showed Pmp20 is strongly upregulated in P. pastoris during high methanol metabolism and recombinant protein stress, indicating its role in the oxidative stress response.)

• PomBase – Schizosaccharomyces pombe Gene Database: pmp20 (SPCC330.06c) entry (thebiogrid.org). (Curated database confirming pmp20 nomenclature, product type = thioredoxin peroxidase, and providing links to gene ontology and interactions.)

• BioGRID – Interaction summary for pmp20 in S. pombe (thebiogrid.org). (Reports genetic and physical interactors, supporting that Pmp20 is connected to stress and metabolic networks in the cell.)

Citations

1. AnnotationURLCitation(end_index=389, start_index=258, title='YRC Public Data Repository - Protein Overview - SPCC330.06c', type='url_citation', url='https://www.yeastrc.org/pdr/viewProtein.do?id=678057&showDescriptions=true&showSingles=true#:~:text=,NCBI%20NR')
2. AnnotationURLCitation(end_index=671, start_index=563, title='pmp20 (SPCC330.06c) Result Summary | BioGRID', type='url_citation', url='https://thebiogrid.org/275555/table/schizosaccharomyces-pombe/pmp20.html#:~:text=SPCC330')
3. AnnotationURLCitation(end_index=803, start_index=672, title='YRC Public Data Repository - Protein Overview - SPCC330.06c', type='url_citation', url='https://www.yeastrc.org/pdr/viewProtein.do?id=678057&showDescriptions=true&showSingles=true#:~:text=,NCBI%20NR')
4. AnnotationURLCitation(end_index=1330, start_index=1209, title='Peroxiredoxin 5: structure, mechanism, and function of the mammalian atypical 2-Cys peroxiredoxin - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/20977338/#:~:text=Peroxiredoxin%205%20,1%29%20range.%20PRDX5')
5. AnnotationURLCitation(end_index=1470, start_index=1331, title='Peroxiredoxin 5: structure, mechanism, and function of the mammalian atypical 2-Cys peroxiredoxin - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/20977338/#:~:text=mammals,some%20specific%20unexpected%20structural%20features')
6. AnnotationURLCitation(end_index=1917, start_index=1774, title='Peroxiredoxin 5: structure, mechanism, and function of the mammalian atypical 2-Cys peroxiredoxin - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/20977338/#:~:text=has%20been%20shown%20that%20PRDX5,rather%20than%20as%20a%20redox')
7. AnnotationURLCitation(end_index=2460, start_index=2329, title='YRC Public Data Repository - Protein Overview - SPCC330.06c', type='url_citation', url='https://www.yeastrc.org/pdr/viewProtein.do?id=678057&showDescriptions=true&showSingles=true#:~:text=,NCBI%20NR')
8. AnnotationURLCitation(end_index=2702, start_index=2594, title='pmp20 (SPCC330.06c) Result Summary | BioGRID', type='url_citation', url='https://thebiogrid.org/275555/table/schizosaccharomyces-pombe/pmp20.html#:~:text=SPCC330')
9. AnnotationURLCitation(end_index=3261, start_index=3127, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=Candida%20boidinii%20Pmp20%20,tagged%20CbPmp20%20fusion')
10. AnnotationURLCitation(end_index=3370, start_index=3262, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=strain%20of%20C,Interestingly')
11. AnnotationURLCitation(end_index=3654, start_index=3520, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=Candida%20boidinii%20Pmp20%20,tagged%20CbPmp20%20fusion')
12. AnnotationURLCitation(end_index=3908, start_index=3774, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=Candida%20boidinii%20Pmp20%20,tagged%20CbPmp20%20fusion')
13. AnnotationURLCitation(end_index=4529, start_index=4398, title='YRC Public Data Repository - Protein Overview - SPCC330.06c', type='url_citation', url='https://www.yeastrc.org/pdr/viewProtein.do?id=678057&showDescriptions=true&showSingles=true#:~:text=,NCBI%20NR')
14. AnnotationURLCitation(end_index=4792, start_index=4650, title='YRC Public Data Repository - Protein Overview - SPCC330.06c', type='url_citation', url='https://www.yeastrc.org/pdr/viewProtein.do?id=678057&showDescriptions=true&showSingles=true#:~:text=Organism%3A%20%20,IEA')
15. AnnotationURLCitation(end_index=5252, start_index=5131, title='Peroxiredoxin 5: structure, mechanism, and function of the mammalian atypical 2-Cys peroxiredoxin - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/20977338/#:~:text=Peroxiredoxin%205%20,1%29%20range.%20PRDX5')
16. AnnotationURLCitation(end_index=5392, start_index=5253, title='Peroxiredoxin 5: structure, mechanism, and function of the mammalian atypical 2-Cys peroxiredoxin - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/20977338/#:~:text=mammals,some%20specific%20unexpected%20structural%20features')
17. AnnotationURLCitation(end_index=5723, start_index=5560, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=The%20pmp20Delta%20strain%20was%20found,to%20decompose%20reactive%20oxygen%20species')
18. AnnotationURLCitation(end_index=6445, start_index=6359, title='Knockout Mouse Models for Peroxiredoxins - PMC', type='url_citation', url='https://pmc.ncbi.nlm.nih.gov/articles/PMC7070531/#:~:text=,P')
19. AnnotationURLCitation(end_index=6561, start_index=6446, title='Knockout Mouse Models for Peroxiredoxins - PMC', type='url_citation', url='https://pmc.ncbi.nlm.nih.gov/articles/PMC7070531/#:~:text=Atypical%202,PREX%29%20database')
20. AnnotationURLCitation(end_index=6968, start_index=6860, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=strain%20of%20C,Interestingly')
21. AnnotationURLCitation(end_index=7123, start_index=6969, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=the%20pmp20Delta%20strain%20had%20a,as%20an%20antioxidant%20enzyme%20within')
22. AnnotationURLCitation(end_index=7391, start_index=7283, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=strain%20of%20C,Interestingly')
23. AnnotationURLCitation(end_index=7561, start_index=7392, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=hydroperoxides%20and%20H%282%29O%282%29,medium%2C%20the%20cta1Delta%20strain%20accumulated')
24. AnnotationURLCitation(end_index=8097, start_index=7954, title='Peroxiredoxin 5: structure, mechanism, and function of the mammalian atypical 2-Cys peroxiredoxin - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/20977338/#:~:text=has%20been%20shown%20that%20PRDX5,rather%20than%20as%20a%20redox')
25. AnnotationURLCitation(end_index=8248, start_index=8098, title='Peroxiredoxin 5: structure, mechanism, and function of the mammalian atypical 2-Cys peroxiredoxin - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/20977338/#:~:text=mitochondrial%20thioredoxins%20to%20reduce%20alkyl,oxidative%20stresses')
26. AnnotationURLCitation(end_index=8881, start_index=8727, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=the%20pmp20Delta%20strain%20had%20a,as%20an%20antioxidant%20enzyme%20within')
27. AnnotationURLCitation(end_index=9039, start_index=8882, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=incubation%20of%20these%20strains%20in,as%20an%20antioxidant%20enzyme%20within')
28. AnnotationURLCitation(end_index=9360, start_index=9206, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=the%20pmp20Delta%20strain%20had%20a,as%20an%20antioxidant%20enzyme%20within')
29. AnnotationURLCitation(end_index=9511, start_index=9361, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=be%20the%20main%20function%20of,as%20an%20antioxidant%20enzyme%20within')
30. AnnotationURLCitation(end_index=10089, start_index=9939, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=be%20the%20main%20function%20of,as%20an%20antioxidant%20enzyme%20within')
31. AnnotationURLCitation(end_index=10249, start_index=10090, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=than%20to%20decompose%20H%282%29O%282%29,rich%20in%20reactive%20oxygen%20species')
32. AnnotationURLCitation(end_index=10745, start_index=10614, title='YRC Public Data Repository - Protein Overview - SPCC330.06c', type='url_citation', url='https://www.yeastrc.org/pdr/viewProtein.do?id=678057&showDescriptions=true&showSingles=true#:~:text=,NCBI%20NR')
33. AnnotationURLCitation(end_index=11344, start_index=11159, title='The peroxisome: an update on mysteries 3.0 - PMC', type='url_citation', url='https://pmc.ncbi.nlm.nih.gov/articles/PMC10822820/#:~:text=Peroxisomes%20are%20highly%20dynamic%2C%20oxidative,continue%20to%20highlight%20recent%20discoveries')
34. AnnotationURLCitation(end_index=11532, start_index=11345, title='The peroxisome: an update on mysteries 3.0 - PMC', type='url_citation', url='https://pmc.ncbi.nlm.nih.gov/articles/PMC10822820/#:~:text=now%20recognised%20as%20key%20metabolic,%E2%80%9Cprotective%E2%80%9D%20role%20of%20these%20fascinating')
35. AnnotationURLCitation(end_index=12106, start_index=11964, title='Absence of the peroxiredoxin Pmp20 causes peroxisomal protein leakage and necrotic cell death - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/18694816/#:~:text=We%20analyzed%20the%20role%20of,an%20effect%20on%20fatty%20acid')
36. AnnotationURLCitation(end_index=12272, start_index=12107, title='Absence of the peroxiredoxin Pmp20 causes peroxisomal protein leakage and necrotic cell death - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/18694816/#:~:text=homeostasis.%20Plating%20assays%20and%20FACS,integrity%20and%20necrotic%20cell%20death')
37. AnnotationURLCitation(end_index=12559, start_index=12417, title='Absence of the peroxiredoxin Pmp20 causes peroxisomal protein leakage and necrotic cell death - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/18694816/#:~:text=We%20analyzed%20the%20role%20of,an%20effect%20on%20fatty%20acid')
38. AnnotationURLCitation(end_index=12873, start_index=12731, title='Absence of the peroxiredoxin Pmp20 causes peroxisomal protein leakage and necrotic cell death - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/18694816/#:~:text=We%20analyzed%20the%20role%20of,an%20effect%20on%20fatty%20acid')
39. AnnotationURLCitation(end_index=13041, start_index=12874, title='Absence of the peroxiredoxin Pmp20 causes peroxisomal protein leakage and necrotic cell death - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/18694816/#:~:text=leakage%20of%20peroxisomal%20matrix%20proteins,integrity%20and%20necrotic%20cell%20death')
40. AnnotationURLCitation(end_index=13368, start_index=13201, title='Absence of the peroxiredoxin Pmp20 causes peroxisomal protein leakage and necrotic cell death - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/18694816/#:~:text=leakage%20of%20peroxisomal%20matrix%20proteins,integrity%20and%20necrotic%20cell%20death')
41. AnnotationURLCitation(end_index=13660, start_index=13493, title='Absence of the peroxiredoxin Pmp20 causes peroxisomal protein leakage and necrotic cell death - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/18694816/#:~:text=leakage%20of%20peroxisomal%20matrix%20proteins,integrity%20and%20necrotic%20cell%20death')
42. AnnotationURLCitation(end_index=13828, start_index=13661, title='Absence of the peroxiredoxin Pmp20 causes peroxisomal protein leakage and necrotic cell death - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/18694816/#:~:text=integrity%2C%20when%20cultured%20on%20methanol,integrity%20and%20necrotic%20cell%20death')
43. AnnotationURLCitation(end_index=14357, start_index=14194, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=The%20pmp20Delta%20strain%20was%20found,to%20decompose%20reactive%20oxygen%20species')
44. AnnotationURLCitation(end_index=14679, start_index=14516, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=The%20pmp20Delta%20strain%20was%20found,to%20decompose%20reactive%20oxygen%20species')
45. AnnotationURLCitation(end_index=15022, start_index=14862, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=but%20neither%20CbPmp20%20lacking%20the,detected%20a%20physiological%20level%20of')
46. AnnotationURLCitation(end_index=15424, start_index=15270, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=the%20pmp20Delta%20strain%20had%20a,as%20an%20antioxidant%20enzyme%20within')
47. AnnotationURLCitation(end_index=15752, start_index=15598, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=the%20pmp20Delta%20strain%20had%20a,as%20an%20antioxidant%20enzyme%20within')
48. AnnotationURLCitation(end_index=16988, start_index=16855, title='pmp20 (SPCC330.06c) Result Summary | BioGRID', type='url_citation', url='https://thebiogrid.org/275555/table/schizosaccharomyces-pombe/pmp20.html#:~:text=thioredoxin%20peroxidase%20Pmp20')
49. AnnotationURLCitation(end_index=17478, start_index=17354, title='Physiological response of Pichia pastoris GS115 to methanol-induced high level production of the Hepatitis B surface antigen: catabolic adaptation, stress responses, and autophagic processes - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/22873405/#:~:text=oxidative%20stress%20response%20%28e,increase')
50. AnnotationURLCitation(end_index=18047, start_index=17880, title='Absence of the peroxiredoxin Pmp20 causes peroxisomal protein leakage and necrotic cell death - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/18694816/#:~:text=leakage%20of%20peroxisomal%20matrix%20proteins,integrity%20and%20necrotic%20cell%20death')
51. AnnotationURLCitation(end_index=18202, start_index=18048, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=the%20pmp20Delta%20strain%20had%20a,as%20an%20antioxidant%20enzyme%20within')
52. AnnotationURLCitation(end_index=18572, start_index=18412, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=but%20neither%20CbPmp20%20lacking%20the,detected%20a%20physiological%20level%20of')
53. AnnotationURLCitation(end_index=19520, start_index=19366, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=the%20pmp20Delta%20strain%20had%20a,as%20an%20antioxidant%20enzyme%20within')
54. AnnotationURLCitation(end_index=19664, start_index=19521, title='Peroxiredoxin 5: structure, mechanism, and function of the mammalian atypical 2-Cys peroxiredoxin - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/20977338/#:~:text=has%20been%20shown%20that%20PRDX5,rather%20than%20as%20a%20redox')
55. AnnotationURLCitation(end_index=20250, start_index=20108, title='Absence of the peroxiredoxin Pmp20 causes peroxisomal protein leakage and necrotic cell death - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/18694816/#:~:text=We%20analyzed%20the%20role%20of,an%20effect%20on%20fatty%20acid')
56. AnnotationURLCitation(end_index=21265, start_index=21141, title='Physiological response of Pichia pastoris GS115 to methanol-induced high level production of the Hepatitis B surface antigen: catabolic adaptation, stress responses, and autophagic processes - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/22873405/#:~:text=oxidative%20stress%20response%20%28e,increase')
57. AnnotationURLCitation(end_index=22231, start_index=22072, title='Absence of the peroxiredoxin Pmp20 causes peroxisomal protein leakage and necrotic cell death - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/18694816/#:~:text=on%20substrates%20that%20are%20not,of%20clonogenic%20efficiency%20and%20membrane')
58. AnnotationURLCitation(end_index=22909, start_index=22803, title='pmp20 (SPCC330.06c) Result Summary | BioGRID', type='url_citation', url='https://thebiogrid.org/275555/table/schizosaccharomyces-pombe/pmp20.html#:~:text=PMP20')
59. AnnotationURLCitation(end_index=23371, start_index=23233, title='Peroxiredoxin 5: structure, mechanism, and function of the mammalian atypical 2-Cys peroxiredoxin - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/20977338/#:~:text=with%20hydrogen%20peroxide%20is%20more,oxidative%20stresses')
60. AnnotationURLCitation(end_index=23703, start_index=23565, title='Peroxiredoxin 5: structure, mechanism, and function of the mammalian atypical 2-Cys peroxiredoxin - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/20977338/#:~:text=with%20hydrogen%20peroxide%20is%20more,oxidative%20stresses')
61. AnnotationURLCitation(end_index=23846, start_index=23704, title='Peroxiredoxin 5: structure, mechanism, and function of the mammalian atypical 2-Cys peroxiredoxin - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/20977338/#:~:text=biochemical%20data%20but%20revealed%20also,oxidative%20stresses')
62. AnnotationURLCitation(end_index=25117, start_index=24932, title='The peroxisome: an update on mysteries 3.0 - PMC', type='url_citation', url='https://pmc.ncbi.nlm.nih.gov/articles/PMC10822820/#:~:text=Peroxisomes%20are%20highly%20dynamic%2C%20oxidative,continue%20to%20highlight%20recent%20discoveries')
63. AnnotationURLCitation(end_index=25266, start_index=25118, title='The peroxisome: an update on mysteries 3.0 - PMC', type='url_citation', url='https://pmc.ncbi.nlm.nih.gov/articles/PMC10822820/#:~:text=Loss%20of%20peroxisomal%20function%20causes,related%20disorders')
64. AnnotationURLCitation(end_index=25698, start_index=25513, title='The peroxisome: an update on mysteries 3.0 - PMC', type='url_citation', url='https://pmc.ncbi.nlm.nih.gov/articles/PMC10822820/#:~:text=Peroxisomes%20are%20highly%20dynamic%2C%20oxidative,continue%20to%20highlight%20recent%20discoveries')
65. AnnotationURLCitation(end_index=25847, start_index=25699, title='The peroxisome: an update on mysteries 3.0 - PMC', type='url_citation', url='https://pmc.ncbi.nlm.nih.gov/articles/PMC10822820/#:~:text=Loss%20of%20peroxisomal%20function%20causes,related%20disorders')
66. AnnotationURLCitation(end_index=26184, start_index=26036, title='The peroxisome: an update on mysteries 3.0 - PMC', type='url_citation', url='https://pmc.ncbi.nlm.nih.gov/articles/PMC10822820/#:~:text=Loss%20of%20peroxisomal%20function%20causes,related%20disorders')
67. AnnotationURLCitation(end_index=27081, start_index=26922, title='Knockout Mouse Models for Peroxiredoxins - PMC', type='url_citation', url='https://pmc.ncbi.nlm.nih.gov/articles/PMC7070531/#:~:text=PRDX5%20is%20a%20unique%20member,reporter%20and%20conditional%20allele%20of')
68. AnnotationURLCitation(end_index=27237, start_index=27082, title='Knockout Mouse Models for Peroxiredoxins - PMC', type='url_citation', url='https://pmc.ncbi.nlm.nih.gov/articles/PMC7070531/#:~:text=PRDX5%20is%20a%20unique%20member,in%20the%205%E2%80%B2UTR%20region%20of')
69. AnnotationURLCitation(end_index=27699, start_index=27614, title='Knockout Mouse Models for Peroxiredoxins - PMC', type='url_citation', url='https://pmc.ncbi.nlm.nih.gov/articles/PMC7070531/#:~:text=6')
70. AnnotationURLCitation(end_index=27842, start_index=27700, title='Knockout Mouse Models for Peroxiredoxins - PMC', type='url_citation', url='https://pmc.ncbi.nlm.nih.gov/articles/PMC7070531/#:~:text=Prdx5%20deficiency%20leads%20to%20increased,94%20%2C%20100')
71. AnnotationURLCitation(end_index=28513, start_index=28342, title='Antioxidant enzyme peroxiredoxin 5 regulates cyst growth and ciliogenesis via modulating Plk1 stability - PMC', type='url_citation', url='https://pmc.ncbi.nlm.nih.gov/articles/PMC9060392#:~:text=Antioxidant%20enzyme%20peroxiredoxin%205%20regulates,Prdx5%20is%20downregulated%20in%20a')
72. AnnotationURLCitation(end_index=29182, start_index=29058, title='Physiological response of Pichia pastoris GS115 to methanol-induced high level production of the Hepatitis B surface antigen: catabolic adaptation, stress responses, and autophagic processes - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/22873405/#:~:text=oxidative%20stress%20response%20%28e,increase')
73. AnnotationURLCitation(end_index=30108, start_index=29941, title='Absence of the peroxiredoxin Pmp20 causes peroxisomal protein leakage and necrotic cell death - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/18694816/#:~:text=leakage%20of%20peroxisomal%20matrix%20proteins,integrity%20and%20necrotic%20cell%20death')
74. AnnotationURLCitation(end_index=30387, start_index=30239, title='The peroxisome: an update on mysteries 3.0 - PMC', type='url_citation', url='https://pmc.ncbi.nlm.nih.gov/articles/PMC10822820/#:~:text=Loss%20of%20peroxisomal%20function%20causes,related%20disorders')
75. AnnotationURLCitation(end_index=31020, start_index=30877, title='Peroxiredoxin 5: structure, mechanism, and function of the mammalian atypical 2-Cys peroxiredoxin - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/20977338/#:~:text=has%20been%20shown%20that%20PRDX5,rather%20than%20as%20a%20redox')
76. AnnotationURLCitation(end_index=31159, start_index=31021, title='Peroxiredoxin 5: structure, mechanism, and function of the mammalian atypical 2-Cys peroxiredoxin - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/20977338/#:~:text=with%20hydrogen%20peroxide%20is%20more,oxidative%20stresses')
77. AnnotationURLCitation(end_index=31689, start_index=31560, title='Absence of the peroxiredoxin Pmp20 causes peroxisomal protein leakage and necrotic cell death - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/18694816/#:~:text=,the%20methylotrophic%20yeast%20Candida%20boidinii')
78. AnnotationURLCitation(end_index=31815, start_index=31690, title='Absence of the peroxiredoxin Pmp20 causes peroxisomal protein leakage and necrotic cell death - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/18694816/#:~:text=,exhibit%20antioxidant%20activity%20in%20vitro')
79. AnnotationURLCitation(end_index=32372, start_index=32187, title='The peroxisome: an update on mysteries 3.0 - PMC', type='url_citation', url='https://pmc.ncbi.nlm.nih.gov/articles/PMC10822820/#:~:text=Peroxisomes%20are%20highly%20dynamic%2C%20oxidative,continue%20to%20highlight%20recent%20discoveries')
80. AnnotationURLCitation(end_index=32521, start_index=32373, title='The peroxisome: an update on mysteries 3.0 - PMC', type='url_citation', url='https://pmc.ncbi.nlm.nih.gov/articles/PMC10822820/#:~:text=Loss%20of%20peroxisomal%20function%20causes,related%20disorders')
81. AnnotationURLCitation(end_index=32810, start_index=32731, title='Absence of the peroxiredoxin Pmp20 causes peroxisomal protein leakage and necrotic cell death - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/18694816/#:~:text=')
82. AnnotationURLCitation(end_index=33047, start_index=32958, title='Absence of the peroxiredoxin Pmp20 causes peroxisomal protein leakage and necrotic cell death - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/18694816/#:~:text=Cited%20by')
83. AnnotationURLCitation(end_index=33656, start_index=33502, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=the%20pmp20Delta%20strain%20had%20a,as%20an%20antioxidant%20enzyme%20within')
84. AnnotationURLCitation(end_index=33800, start_index=33657, title='Peroxiredoxin 5: structure, mechanism, and function of the mammalian atypical 2-Cys peroxiredoxin - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/20977338/#:~:text=has%20been%20shown%20that%20PRDX5,rather%20than%20as%20a%20redox')
85. AnnotationURLCitation(end_index=34188, start_index=34063, title='Absence of the peroxiredoxin Pmp20 causes peroxisomal protein leakage and necrotic cell death - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/18694816/#:~:text=,exhibit%20antioxidant%20activity%20in%20vitro')
86. AnnotationURLCitation(end_index=34788, start_index=34635, title='Endoplasmic reticulum stress and alterations of peroxiredoxins in aged hearts - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/37661065/#:~:text=Endoplasmic%20reticulum%20stress%20and%20alterations,Affiliations%20Expand')
87. AnnotationURLCitation(end_index=35302, start_index=35178, title='Physiological response of Pichia pastoris GS115 to methanol-induced high level production of the Hepatitis B surface antigen: catabolic adaptation, stress responses, and autophagic processes - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/22873405/#:~:text=oxidative%20stress%20response%20%28e,increase')
88. AnnotationURLCitation(end_index=35575, start_index=35436, title='Redox requirements for ubiquitin-like urmylation of Ahp1, a 2-Cys peroxiredoxin from yeast - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/32004955/#:~:text=Redox%20requirements%20for%20ubiquitin,Full%20Text%20Sources')
89. AnnotationURLCitation(end_index=36315, start_index=36167, title='Extension of chronological lifespan in Schizosaccharomyces pombe - PMC', type='url_citation', url='https://pmc.ncbi.nlm.nih.gov/articles/PMC9290682/#:~:text=multicellular%20organisms,genetic%20information%20is%20left%20to')
90. AnnotationURLCitation(end_index=36511, start_index=36316, title='Extension of chronological lifespan in Schizosaccharomyces pombe - PMC', type='url_citation', url='https://pmc.ncbi.nlm.nih.gov/articles/PMC9290682/#:~:text=unicellular%20eukaryotic%20fission%20yeast%20Schizosaccharomyces,control%20mechanism%20for%20higher%20organisms')
91. AnnotationURLCitation(end_index=37138, start_index=36971, title='Absence of the peroxiredoxin Pmp20 causes peroxisomal protein leakage and necrotic cell death - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/18694816/#:~:text=leakage%20of%20peroxisomal%20matrix%20proteins,integrity%20and%20necrotic%20cell%20death')
92. AnnotationURLCitation(end_index=37310, start_index=37168, title='Knockout Mouse Models for Peroxiredoxins - PMC', type='url_citation', url='https://pmc.ncbi.nlm.nih.gov/articles/PMC7070531/#:~:text=Prdx5%20deficiency%20leads%20to%20increased,94%20%2C%20100')
93. AnnotationURLCitation(end_index=37893, start_index=37751, title='Absence of the peroxiredoxin Pmp20 causes peroxisomal protein leakage and necrotic cell death - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/18694816/#:~:text=We%20analyzed%20the%20role%20of,an%20effect%20on%20fatty%20acid')
94. AnnotationURLCitation(end_index=38061, start_index=37894, title='Absence of the peroxiredoxin Pmp20 causes peroxisomal protein leakage and necrotic cell death - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/18694816/#:~:text=leakage%20of%20peroxisomal%20matrix%20proteins,integrity%20and%20necrotic%20cell%20death')
95. AnnotationURLCitation(end_index=38505, start_index=38345, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=but%20neither%20CbPmp20%20lacking%20the,detected%20a%20physiological%20level%20of')
96. AnnotationURLCitation(end_index=38663, start_index=38506, title='Antioxidant system within yeast peroxisome. Biochemical and physiological characterization of CbPmp20 in the methylotrophic yeast Candida boidinii - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/11278957/#:~:text=incubation%20of%20these%20strains%20in,as%20an%20antioxidant%20enzyme%20within')
97. AnnotationURLCitation(end_index=39433, start_index=39312, title='Peroxiredoxin 5: structure, mechanism, and function of the mammalian atypical 2-Cys peroxiredoxin - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/20977338/#:~:text=Peroxiredoxin%205%20,1%29%20range.%20PRDX5')
98. AnnotationURLCitation(end_index=39577, start_index=39434, title='Peroxiredoxin 5: structure, mechanism, and function of the mammalian atypical 2-Cys peroxiredoxin - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/20977338/#:~:text=has%20been%20shown%20that%20PRDX5,rather%20than%20as%20a%20redox')
99. AnnotationURLCitation(end_index=40033, start_index=39848, title='The peroxisome: an update on mysteries 3.0 - PMC', type='url_citation', url='https://pmc.ncbi.nlm.nih.gov/articles/PMC10822820/#:~:text=Peroxisomes%20are%20highly%20dynamic%2C%20oxidative,continue%20to%20highlight%20recent%20discoveries')
100. AnnotationURLCitation(end_index=40221, start_index=40034, title='The peroxisome: an update on mysteries 3.0 - PMC', type='url_citation', url='https://pmc.ncbi.nlm.nih.gov/articles/PMC10822820/#:~:text=now%20recognised%20as%20key%20metabolic,%E2%80%9Cprotective%E2%80%9D%20role%20of%20these%20fascinating')
101. AnnotationURLCitation(end_index=40573, start_index=40488, title='Knockout Mouse Models for Peroxiredoxins - PMC', type='url_citation', url='https://pmc.ncbi.nlm.nih.gov/articles/PMC7070531/#:~:text=6')
102. AnnotationURLCitation(end_index=40716, start_index=40574, title='Knockout Mouse Models for Peroxiredoxins - PMC', type='url_citation', url='https://pmc.ncbi.nlm.nih.gov/articles/PMC7070531/#:~:text=Prdx5%20deficiency%20leads%20to%20increased,94%20%2C%20100')
103. AnnotationURLCitation(end_index=41507, start_index=41383, title='Physiological response of Pichia pastoris GS115 to methanol-induced high level production of the Hepatitis B surface antigen: catabolic adaptation, stress responses, and autophagic processes - PubMed', type='url_citation', url='https://pubmed.ncbi.nlm.nih.gov/22873405/#:~:text=oxidative%20stress%20response%20%28e,increase')
104. AnnotationURLCitation(end_index=41879, start_index=41771, title='pmp20 (SPCC330.06c) Result Summary | BioGRID', type='url_citation', url='https://thebiogrid.org/275555/table/schizosaccharomyces-pombe/pmp20.html#:~:text=SPCC330')
105. AnnotationURLCitation(end_index=42196, start_index=42088, title='pmp20 (SPCC330.06c) Result Summary | BioGRID', type='url_citation', url='https://thebiogrid.org/275555/table/schizosaccharomyces-pombe/pmp20.html#:~:text=SPCC330')

RESULTS: SCHPO/pmp20 thioredoxin-dependent peroxidase activity assessment

Objective

Assess whether pmp20 from Schizosaccharomyces pombe has plausible thioredoxin-dependent peroxidase activity using reproducible bioinformatics analyses.

Provenance

Workflow run from:

• genes/SCHPO/pmp20/pmp20-bioinformatics

Commands executed:

just all
just main-extra
uv run scripts/analyze_prx5_phylogeny.py --proteins-json results/main/phylogeny/prx5_proteins.json --target-id ahp1_p38013 --neighbor-count 8 --output-dir results/main/phylogeny_test_ahp1
uv run scripts/analyze_prx5_dimer_template.py --proteins-json results/test_tpx1/proteins.json --target-id tpx1_schpo --template-id prx5_o43099 --template-pdb-id 5J9B --output-dir results/test_tpx1/dimer_tpx1

Generated run outputs:

• Main analysis (pmp20 as target): results/main/
• Alternate target/script-validation run (tpx1): results/test_tpx1/

Primary literature/context source used for expected phenotype:

• publications/PMID_20356456.md (reports no thioredoxin-dependent peroxidase activity for PMP20 and weak chaperone activity)

Checklist

• [x] Confirmed scripts do not use hardcoded gene-specific inputs/outputs (all scripts take CLI paths and table-driven inputs).
• [x] Scripts tested on at least one other input/target (inputs/proteins-test-tpx1.tsv; alternate phylogeny target ahp1_p38013; alternate dimer target tpx1_schpo).
• [x] Analyses completed as expected (just all and just main-extra completed without errors).
• [x] Direct script results are present in the analysis folder.
• [x] Summary includes provenance and justification with explicit file-backed evidence.

Key Results

1) Control set assembly

results/main/protein_summary.tsv captured 4 proteins:

• Target: pmp20_schpo (O14313)
• Active controls: tpx1_schpo (O74887), prdx5_human (P30044), prx5_o43099 (O43099)

All 4 AlphaFold models downloaded successfully (results/main/structures/alphafold_manifest.tsv).

2) Sequence/catalytic-site evidence (target + controls)

From results/main/sequence/sequence_cysteine_summary.tsv:

• pmp20: 156 aa, 1 cysteine total (C43), act-site annotated at 43, no candidate resolving cysteine.
• Active controls have >=2 cysteines and a candidate resolving cysteine (e.g., tpx1: C48/C169; prdx5_human: C100/C204).

Peroxidatic-window comparison (11 aa anchors):

• pmp20: AFTPPCSSQVP
• tpx1: DFTFVCPTEIV
• prdx5_human: AFTPGCSKTHL
• prx5_o43099: AFTPVCSARHV

Interpretation: pmp20 retains a peroxidatic-site-like local motif region but lacks a second cysteine needed for canonical thioredoxin-dependent peroxiredoxin cycling.

3) Alignment-to-active-controls evidence

From results/main/sequence/target_vs_active_alignment.tsv:

• Active-control peroxidatic positions map to pmp20 residue C43.
• Active-control resolving positions do not map to cysteine in pmp20:
• vs tpx1 resolving C169 -> gap
• vs prdx5_human resolving C204 -> I146
• vs prx5_o43099 resolving C31 -> V22

Interpretation: comparative mapping supports loss of resolving-cysteine equivalence in pmp20.

4) AlphaFold monomer cysteine geometry (target + controls)

From results/main/structure/structure_cys_summary.tsv and structure_cys_pair_distances.tsv:

• pmp20: model has only one cysteine SG atom (C43), so no Cys-Cys pair geometry is possible in the monomer.
• Active controls contain cysteine pairs in structure models (tpx1, prdx5_human, prx5_o43099).

5) Prx5 homolog panel phylogeny and catalytic-state mapping

From results/main/phylogeny/:

• Panel size: 27 reviewed eukaryotic Prx5-like proteins (prx5_panel.tsv).
• Catalytic-state counts (prx5_phylogeny_report.json):
• peroxidatic_plus_resolving: 23
• peroxidatic_only: 4
• pmp20 class: peroxidatic_only (prx5_catalytic_state.tsv).
• In top-12 nearest sequence neighbors of pmp20, 11 are peroxidatic_plus_resolving (pmp20_neighbor_context.tsv).
• Neighbor resolving sites align to non-cysteine residues in pmp20 (commonly V22, V67, I146).

Interpretation: within the Prx5-like panel, pmp20 is atypical because most homologs retain both peroxidatic and resolving cysteine architecture.

6) Template-based dimer interface analysis

Using experimental dimer template O43099 / PDB 5J9B:

• Distances in template (results/main/dimer/dimer_template_sg_distances.tsv) show cross-chain C(P)-C(R) proximity consistent with disulfide-capable geometry:
• A:61 to B:31 = 2.036 A
• A:31 to B:61 = 2.042 A
• Mapping template catalytic pair onto pmp20 (dimer_template_mapping_summary.tsv):
• template C(P) position 61 -> pmp20 C43
• template C(R) position 31 -> pmp20 V22
• target_supports_template_like_cp_cr_pair = no

Interpretation: even where Prx5 dimer templates show plausible intersubunit C(P)-C(R) geometry, pmp20 lacks a cysteine at the mapped resolving position and cannot support an equivalent pair.

Validation Run (Script Generality)

• results/test_tpx1/ confirms baseline pipeline works with tpx1 as alternate target.
• results/main/phylogeny_test_ahp1/ confirms phylogeny script works with a non-pmp20 target ID (ahp1_p38013).
• results/test_tpx1/dimer_tpx1/ confirms dimer-template script runs on alternate target (tpx1_schpo).

Conclusion

Across sequence features, control alignments, Prx5 homolog-panel mapping, and template-based dimer interface mapping, pmp20 does not show the resolving-cysteine architecture required for canonical thioredoxin-dependent peroxidase cycling.

This computational result is consistent with cached experimental literature in publications/PMID_20356456.md.

BioReason-Pro RL Review: pmp20 (S. pombe)

Source: pmp20-deep-research-bioreason-rl.md

• Correctness: 1/5
• Completeness: 2/5

Functional Summary Review

The BioReason functional summary is fundamentally wrong about the core function of pmp20. It states:

A soluble cytoplasmic peroxidase that uses a thioredoxin-like fold to reduce hydrogen peroxide and organic hydroperoxides, thereby protecting fission yeast cells from oxidative damage.

This directly contradicts the key experimental finding from PMID:20356456, which demonstrated that pmp20 has no thioredoxin-dependent peroxidase activity. The curated review documents that pmp20 lacks the resolving cysteine residue required for the canonical peroxiredoxin catalytic cycle -- it has only one cysteine (C43) with no resolving cysteine equivalent. Bioinformatics analysis confirmed this (23/27 Prx5-like proteins retain the resolving cysteine; pmp20 does not).

The summary further claims:

Its catalytic cysteine cycles through thiol/sulfenic/disulfide states and is regenerated by the thioredoxin/thioredoxin reductase system.

This is factually incorrect. There is a NOT annotation (IDA, PMID:20356456) for glutathione peroxidase activity, and the curated review recommends REMOVE for both peroxidase activity (GO:0004601) and thioredoxin peroxidase activity (GO:0008379).

The actual core function of pmp20 is as a weak protein folding chaperone (holdase). It inhibits thermal aggregation of citrate synthase (PMID:20356456), representing a neo-functionalization within the peroxiredoxin family. The curated review proposes GO:0044183 (protein folding chaperone) as the correct molecular function.

The localization claim of cytoplasm is partially correct -- pmp20 is in the cytosol and nucleus (confirmed by PMID:16823372) -- but the functional narrative is entirely wrong.

Comparison with interpro2go:

BioReason's summary exactly recapitulates the errors of the interpro2go annotation (GO_REF:0000002), which assigns thioredoxin peroxidase activity (GO:0008379) based on the Peroxiredoxin-5-like domain (IPR037944). Both BioReason and interpro2go fail to account for the loss of the resolving cysteine, treating the domain architecture as sufficient to infer peroxidase function. BioReason provides no additional insight beyond what interpro2go infers and makes the same fundamental error. The curated review marks this interpro2go annotation as REMOVE.

Notes on thinking trace

The thinking trace methodically walks through the domain architecture (thioredoxin-like superfamily, Peroxiredoxin-5-like family) and correctly identifies the fold, but then uncritically assumes peroxidase function from the domain identity alone. The trace states "the Peroxiredoxin-5-like identity confines substrate preference to hydrogen peroxide and organic hydroperoxides" -- this is precisely the type of naive domain-to-function inference that the curated review warns against. No consideration is given to whether catalytic residues are actually conserved in this specific protein.