{ "annotationScore": 5.0, "comments": [ { "commentType": "FUNCTION", "texts": [ { "evidences": [ { "evidenceCode": "ECO:0000269", "id": "15533439", "source": "PubMed" } ], "value": "Ubiquitin-protein hydrolase is involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin" } ] }, { "commentType": "CATALYTIC ACTIVITY", "reaction": { "ecNumber": "3.4.19.12", "name": "Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal)." } }, { "commentType": "SUBUNIT", "texts": [ { "evidences": [ { "evidenceCode": "ECO:0000269", "id": "15533439", "source": "PubMed" } ], "value": "Component of the 26S proteasome. Interacts with rpn10" } ] }, { "commentType": "SUBCELLULAR LOCATION", "subcellularLocations": [ { "location": { "evidences": [ { "evidenceCode": "ECO:0000269", "id": "10872838", "source": "PubMed" }, { "evidenceCode": "ECO:0000269", "id": "15533439", "source": "PubMed" } ], "id": "SL-0191", "value": "Nucleus" } } ] }, { "commentType": "SIMILARITY", "texts": [ { "evidences": [ { "evidenceCode": "ECO:0000305" } ], "value": "Belongs to the peptidase C12 family" } ] } ], "entryAudit": { "entryVersion": 146, "firstPublicDate": "2006-05-16", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2000-05-01", "sequenceVersion": 1 }, "entryType": "UniProtKB reviewed (Swiss-Prot)", "extraAttributes": { "countByCommentType": { "CATALYTIC ACTIVITY": 1, "FUNCTION": 1, "SIMILARITY": 1, "SUBCELLULAR LOCATION": 1, "SUBUNIT": 1 }, "countByFeatureType": { "Active site": 2, "Chain": 1, "Domain": 2, "Site": 2 }, "uniParcId": "UPI000006C0DD" }, "features": [ { "description": "Ubiquitin carboxyl-terminal hydrolase 2", "featureId": "PRO_0000234561", "location": { "end": { "modifier": "EXACT", "value": 300 }, "start": { "modifier": "EXACT", "value": 1 } }, "type": "Chain" }, { "description": "UCH catalytic", "evidences": [ { "evidenceCode": "ECO:0000255", "id": "PRU01393", "source": "PROSITE-ProRule" } ], "location": { "end": { "modifier": "EXACT", "value": 220 }, "start": { "modifier": "EXACT", "value": 2 } }, "type": "Domain" }, { "description": "ULD", "evidences": [ { "evidenceCode": "ECO:0000255", "id": "PRU01394", "source": "PROSITE-ProRule" } ], "location": { "end": { "modifier": "EXACT", "value": 290 }, "start": { "modifier": "EXACT", "value": 261 } }, "type": "Domain" }, { "description": "Nucleophile", "evidences": [ { "evidenceCode": "ECO:0000255", "id": "PRU01393", "source": "PROSITE-ProRule" } ], "location": { "end": { "modifier": "EXACT", "value": 83 }, "start": { "modifier": "EXACT", "value": 83 } }, "type": "Active site" }, { "description": "Proton donor", "evidences": [ { "evidenceCode": "ECO:0000255", "id": "PRU01393", "source": "PROSITE-ProRule" } ], "location": { "end": { "modifier": "EXACT", "value": 159 }, "start": { "modifier": "EXACT", "value": 159 } }, "type": "Active site" }, { "description": "Transition state stabilizer", "evidences": [ { "evidenceCode": "ECO:0000255", "id": "PRU01393", "source": "PROSITE-ProRule" } ], "location": { "end": { "modifier": "EXACT", "value": 77 }, "start": { "modifier": "EXACT", "value": 77 } }, "type": "Site" }, { "description": "Important for enzyme activity", "evidences": [ { "evidenceCode": "ECO:0000255", "id": "PRU01393", "source": "PROSITE-ProRule" } ], "location": { "end": { "modifier": "EXACT", "value": 174 }, "start": { "modifier": "EXACT", "value": 174 } }, "type": "Site" } ], "genes": [ { "geneName": { "value": "uch2" }, "orfNames": [ { "value": "SPBC409.06" } ] } ], "keywords": [ { "category": "Molecular function", "id": "KW-0378", "name": "Hydrolase" }, { "category": "Cellular component", "id": "KW-0539", "name": "Nucleus" }, { "category": "Molecular function", "id": "KW-0645", "name": "Protease" }, { "category": "Cellular component", "id": "KW-0647", "name": "Proteasome" }, { "category": "Technical term", "id": "KW-1185", "name": "Reference proteome" }, { "category": "Molecular function", "id": "KW-0788", "name": "Thiol protease" }, { "category": "Biological process", "id": "KW-0833", "name": "Ubl conjugation pathway" } ], "organism": { "commonName": "Fission yeast", "lineage": [ "Eukaryota", "Fungi", "Dikarya", "Ascomycota", "Taphrinomycotina", "Schizosaccharomycetes", "Schizosaccharomycetales", "Schizosaccharomycetaceae", "Schizosaccharomyces" ], "scientificName": "Schizosaccharomyces pombe (strain 972 / ATCC 24843)", "taxonId": 284812 }, "primaryAccession": "Q9UUB6", "proteinDescription": { "recommendedName": { "ecNumbers": [ { "value": "3.4.19.12" } ], "fullName": { "value": "Ubiquitin carboxyl-terminal hydrolase 2" } } }, "proteinExistence": "1: Evidence at protein level", "references": [ { "citation": { "authors": [ "Wood V.", "Gwilliam R.", "Rajandream M.A.", "Lyne M.H.", "Lyne R.", "Stewart A.", "Sgouros J.G.", "Peat N.", "Hayles J.", "Baker S.G.", "Basham D.", "Bowman S.", "Brooks K.", "Brown D.", "Brown S.", "Chillingworth T.", "Churcher C.M.", "Collins M.", "Connor R.", "Cronin A.", "Davis P.", "Feltwell T.", "Fraser A.", "Gentles S.", "Goble A.", "Hamlin N.", "Harris D.E.", "Hidalgo J.", "Hodgson G.", "Holroyd S.", "Hornsby T.", "Howarth S.", "Huckle E.J.", "Hunt S.", "Jagels K.", "James K.D.", "Jones L.", "Jones M.", "Leather S.", "McDonald S.", "McLean J.", "Mooney P.", "Moule S.", "Mungall K.L.", "Murphy L.D.", "Niblett D.", "Odell C.", "Oliver K.", "O'Neil S.", "Pearson D.", "Quail M.A.", "Rabbinowitsch E.", "Rutherford K.M.", "Rutter S.", "Saunders D.", "Seeger K.", "Sharp S.", "Skelton J.", "Simmonds M.N.", "Squares R.", "Squares S.", "Stevens K.", "Taylor K.", "Taylor R.G.", "Tivey A.", "Walsh S.V.", "Warren T.", "Whitehead S.", "Woodward J.R.", "Volckaert G.", "Aert R.", "Robben J.", "Grymonprez B.", "Weltjens I.", "Vanstreels E.", "Rieger M.", "Schaefer M.", "Mueller-Auer S.", "Gabel C.", "Fuchs M.", "Duesterhoeft A.", "Fritzc C.", "Holzer E.", "Moestl D.", "Hilbert H.", "Borzym K.", "Langer I.", "Beck A.", "Lehrach H.", "Reinhardt R.", "Pohl T.M.", "Eger P.", "Zimmermann W.", "Wedler H.", "Wambutt R.", "Purnelle B.", "Goffeau A.", "Cadieu E.", "Dreano S.", "Gloux S.", "Lelaure V.", "Mottier S.", "Galibert F.", "Aves S.J.", "Xiang Z.", "Hunt C.", "Moore K.", "Hurst S.M.", "Lucas M.", "Rochet M.", "Gaillardin C.", "Tallada V.A.", "Garzon A.", "Thode G.", "Daga R.R.", "Cruzado L.", "Jimenez J.", "Sanchez M.", "del Rey F.", "Benito J.", "Dominguez A.", "Revuelta J.L.", "Moreno S.", "Armstrong J.", "Forsburg S.L.", "Cerutti L.", "Lowe T.", "McCombie W.R.", "Paulsen I.", "Potashkin J.", "Shpakovski G.V.", "Ussery D.", "Barrell B.G.", "Nurse P." ], "citationCrossReferences": [ { "database": "PubMed", "id": "11859360" }, { "database": "DOI", "id": "10.1038/nature724" } ], "citationType": "journal article", "firstPage": "871", "id": "11859360", "journal": "Nature", "lastPage": "880", "publicationDate": "2002", "title": "The genome sequence of Schizosaccharomyces pombe.", "volume": "415" }, "referenceComments": [ { "type": "STRAIN", "value": "972 / ATCC 24843" } ], "referenceNumber": 1, "referencePositions": [ "NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]" ] }, { "citation": { "authors": [ "Stone M.", "Hartmann-Petersen R.", "Seeger M.", "Bech-Otschir D.", "Wallace M.", "Gordon C." ], "citationCrossReferences": [ { "database": "PubMed", "id": "15533439" }, { "database": "DOI", "id": "10.1016/j.jmb.2004.09.057" } ], "citationType": "journal article", "firstPage": "697", "id": "15533439", "journal": "J. Mol. Biol.", "lastPage": "706", "publicationDate": "2004", "title": "Uch2/Uch37 is the major deubiquitinating enzyme associated with the 26S proteasome in fission yeast.", "volume": "344" }, "referenceNumber": 2, "referencePositions": [ "FUNCTION", "INTERACTION WITH RPN10", "SUBCELLULAR LOCATION" ] }, { "citation": { "authors": [ "Li T.", "Naqvi N.I.", "Yang H.", "Teo T.S." ], "citationCrossReferences": [ { "database": "PubMed", "id": "10872838" }, { "database": "DOI", "id": "10.1006/bbrc.2000.2767" } ], "citationType": "journal article", "firstPage": "270", "id": "10872838", "journal": "Biochem. Biophys. Res. Commun.", "lastPage": "275", "publicationDate": "2000", "title": "Identification of a 26S proteasome-associated UCH in fission yeast.", "volume": "272" }, "referenceNumber": 3, "referencePositions": [ "SUBCELLULAR LOCATION" ] } ], "sequence": { "crc64": "93B13076EF2EDB80", "length": 300, "md5": "C3BC8B09A47106E7189DFE212C0E2920", "molWeight": 34196, "value": "MSWTTIESDAGVFTDLIENLGVKDVEVDELYSLDVDSLRQFPDIYGIIFLFKWNSKVDKPDGTMDYDSMDNIFFAKQVINNACATQALLSVLLNHSDEIDLGTTLSEFKDFSKTLPPELKGEALGNSEHIRCCHNSFARSDPFISEEVRAATDEDEVYHFIAYTNINNVFYELDGLQAAPINHGSCTKEEFAEKAVSVIQARIANYDPAEIRFNLMVICKDKKASLLTREDLTDEEKAASIAVEDEKRLRWKRENQLRRHNFVGLFVELSKLLVKDRIDKNTWNSTLETAKAKYASQKRP" }, "uniProtKBCrossReferences": [ { "database": "EMBL", "id": "CU329671", "properties": [ { "key": "ProteinId", "value": "CAB52608.1" }, { "key": "Status", "value": "-" }, { "key": "MoleculeType", "value": "Genomic_DNA" } ] }, { "database": "PIR", "id": "T40434", "properties": [ { "key": "EntryName", "value": "T40434" } ] }, { "database": "RefSeq", "id": "NP_595456.1", "properties": [ { "key": "NucleotideSequenceId", "value": "NM_001021366.3" } ] }, { "database": "AlphaFoldDB", "id": "Q9UUB6", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "SMR", "id": "Q9UUB6", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "BioGRID", "id": "277472", "properties": [ { "key": "Interactions", "value": "67" } ] }, { "database": "ComplexPortal", "id": "CPX-9077", "properties": [ { "key": "EntryName", "value": "26S proteasome complex" } ] }, { "database": "FunCoup", "id": "Q9UUB6", "properties": [ { "key": "Number of interactors", "value": "946" } ] }, { "database": "IntAct", "id": "Q9UUB6", "properties": [ { "key": "Interactions", "value": "1" } ] }, { "database": "STRING", "id": "284812.Q9UUB6", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "MEROPS", "id": "C12.009", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "iPTMnet", "id": "Q9UUB6", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "PaxDb", "id": "284812-Q9UUB6", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "GeneID", "id": "2540956", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "KEGG", "id": "spo:2540956", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "PomBase", "id": "SPBC409.06", "properties": [ { "key": "GeneName", "value": "uch2" } ] }, { "database": "VEuPathDB", "id": "FungiDB:SPBC409.06", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "eggNOG", "id": "KOG2778", "properties": [ { "key": "ToxonomicScope", "value": "Eukaryota" } ] }, { "database": "HOGENOM", "id": "CLU_018316_1_0_1", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "InParanoid", "id": "Q9UUB6", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "OMA", "id": "YIQYEIQ", "properties": [ { "key": "Fingerprint", "value": "-" } ] }, { "database": "PhylomeDB", "id": "Q9UUB6", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "Reactome", "id": "R-SPO-5689603", "properties": [ { "key": "PathwayName", "value": "UCH proteinases" } ] }, { "database": "PRO", "id": "PR:Q9UUB6", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "Proteomes", "id": "UP000002485", "properties": [ { "key": "Component", "value": "Chromosome II" } ] }, { "database": "GO", "evidences": [ { "evidenceCode": "ECO:0007005", "id": "20838651", "source": "PubMed" } ], "id": "GO:0034399", "properties": [ { "key": "GoTerm", "value": "C:nuclear periphery" }, { "key": "GoEvidenceType", "value": "HDA:PomBase" } ] }, { "database": "GO", "evidences": [ { "evidenceCode": "ECO:0007005", "id": "16823372", "source": "PubMed" }, { "evidenceCode": "ECO:0007005", "id": "20838651", "source": "PubMed" } ], "id": "GO:0005634", "properties": [ { "key": "GoTerm", "value": "C:nucleus" }, { "key": "GoEvidenceType", "value": "HDA:PomBase" } ] }, { "database": "GO", "evidences": [ { "evidenceCode": "ECO:0007005", "id": "20838651", "source": "PubMed" } ], "id": "GO:0000502", "properties": [ { "key": "GoTerm", "value": "C:proteasome complex" }, { "key": "GoEvidenceType", "value": "HDA:PomBase" } ] }, { "database": "GO", "evidences": [ { "evidenceCode": "ECO:0000316", "id": "28765280", "source": "PubMed" } ], "id": "GO:0004843", "properties": [ { "key": "GoTerm", "value": "F:cysteine-type deubiquitinase activity" }, { "key": "GoEvidenceType", "value": "IGI:PomBase" } ] }, { "database": "GO", "evidences": [ { "evidenceCode": "ECO:0000314", "id": "23496905", "source": "PubMed" } ], "id": "GO:0019784", "properties": [ { "key": "GoTerm", "value": "F:deNEDDylase activity" }, { "key": "GoEvidenceType", "value": "IDA:PomBase" } ] }, { "database": "GO", "evidences": [ { "evidenceCode": "ECO:0007005", "id": "20838651", "source": "PubMed" } ], "id": "GO:0140492", "properties": [ { "key": "GoTerm", "value": "F:metal-dependent deubiquitinase activity" }, { "key": "GoEvidenceType", "value": "HDA:PomBase" } ] }, { "database": "GO", "evidences": [ { "evidenceCode": "ECO:0000316", "id": "28765280", "source": "PubMed" } ], "id": "GO:0071629", "properties": [ { "key": "GoTerm", "value": "P:cytoplasm protein quality control by the ubiquitin-proteasome system" }, { "key": "GoEvidenceType", "value": "IGI:PomBase" } ] }, { "database": "GO", "evidences": [ { "evidenceCode": "ECO:0000303", "id": "20838651", "source": "PubMed" } ], "id": "GO:0010498", "properties": [ { "key": "GoTerm", "value": "P:proteasomal protein catabolic process" }, { "key": "GoEvidenceType", "value": "NAS:ComplexPortal" } ] }, { "database": "GO", "evidences": [ { "evidenceCode": "ECO:0000314", "id": "23496905", "source": "PubMed" } ], "id": "GO:0000338", "properties": [ { "key": "GoTerm", "value": "P:protein deneddylation" }, { "key": "GoEvidenceType", "value": "IDA:PomBase" } ] }, { "database": "GO", "id": "GO:0016579", "properties": [ { "key": "GoTerm", "value": "P:protein deubiquitination" }, { "key": "GoEvidenceType", "value": "IEA:InterPro" } ] }, { "database": "CDD", "id": "cd09617", "properties": [ { "key": "EntryName", "value": "Peptidase_C12_UCH37_BAP1" }, { "key": "MatchStatus", "value": "1" } ] }, { "database": "FunFam", "id": "3.40.532.10:FF:000003", "properties": [ { "key": "EntryName", "value": "Ubiquitin carboxyl-terminal hydrolase" }, { "key": "MatchStatus", "value": "1" } ] }, { "database": "Gene3D", "id": "1.20.58.860", "properties": [ { "key": "EntryName", "value": "-" }, { "key": "MatchStatus", "value": "1" } ] }, { "database": "Gene3D", "id": "3.40.532.10", "properties": [ { "key": "EntryName", "value": "Peptidase C12, ubiquitin carboxyl-terminal hydrolase" }, { "key": "MatchStatus", "value": "1" } ] }, { "database": "InterPro", "id": "IPR038765", "properties": [ { "key": "EntryName", "value": "Papain-like_cys_pep_sf" } ] }, { "database": "InterPro", "id": "IPR001578", "properties": [ { "key": "EntryName", "value": "Peptidase_C12_UCH" } ] }, { "database": "InterPro", "id": "IPR036959", "properties": [ { "key": "EntryName", "value": "Peptidase_C12_UCH_sf" } ] }, { "database": "InterPro", "id": "IPR017390", "properties": [ { "key": "EntryName", "value": "Ubiquitinyl_hydrolase_UCH37" } ] }, { "database": "InterPro", "id": "IPR041507", "properties": [ { "key": "EntryName", "value": "UCH_C" } ] }, { "database": "PANTHER", "id": "PTHR10589", "properties": [ { "key": "EntryName", "value": "UBIQUITIN CARBOXYL-TERMINAL HYDROLASE" }, { "key": "MatchStatus", "value": "1" } ] }, { "database": "PANTHER", "id": "PTHR10589:SF16", "properties": [ { "key": "EntryName", "value": "UBIQUITIN CARBOXYL-TERMINAL HYDROLASE ISOZYME L5" }, { "key": "MatchStatus", "value": "1" } ] }, { "database": "Pfam", "id": "PF01088", "properties": [ { "key": "EntryName", "value": "Peptidase_C12" }, { "key": "MatchStatus", "value": "1" } ] }, { "database": "Pfam", "id": "PF18031", "properties": [ { "key": "EntryName", "value": "UCH_C" }, { "key": "MatchStatus", "value": "1" } ] }, { "database": "PIRSF", "id": "PIRSF038120", "properties": [ { "key": "EntryName", "value": "Ubiquitinyl_hydrolase_UCH37" }, { "key": "MatchStatus", "value": "1" } ] }, { "database": "PRINTS", "id": "PR00707", "properties": [ { "key": "EntryName", "value": "UBCTHYDRLASE" } ] }, { "database": "SUPFAM", "id": "SSF54001", "properties": [ { "key": "EntryName", "value": "Cysteine proteinases" }, { "key": "MatchStatus", "value": "1" } ] }, { "database": "PROSITE", "id": "PS52048", "properties": [ { "key": "EntryName", "value": "UCH_DOMAIN" }, { "key": "MatchStatus", "value": "1" } ] }, { "database": "PROSITE", "id": "PS52049", "properties": [ { "key": "EntryName", "value": "ULD" }, { "key": "MatchStatus", "value": "1" } ] } ], "uniProtkbId": "UBLH2_SCHPO" }