Existing Annotations Review

Core Functions

BCL2's primary evolved function is to prevent apoptosis by blocking MOMP and cytochrome c release. This is supported by extensive experimental evidence from multiple cell types and organisms.

Molecular Function:

BH3 domain binding

Directly Involved In:

negative regulation of apoptotic process negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

Cellular Locations:

mitochondrial outer membrane

BCL2 inhibits BAX/BAK pore-forming activity at the OMM, which is central to its anti-apoptotic mechanism.

Molecular Function:

channel inhibitor activity

Directly Involved In:

negative regulation of apoptotic process

Cellular Locations:

mitochondrial outer membrane

References

GO_REF:0000002

Gene Ontology annotation through association of InterPro records with GO terms

GO_REF:0000033

Annotation inferences using phylogenetic trees

GO_REF:0000043

Gene Ontology annotation based on UniProtKB/Swiss-Prot keyword mapping

GO_REF:0000044

Gene Ontology annotation based on UniProtKB/Swiss-Prot Subcellular Location vocabulary mapping

GO_REF:0000052

Gene Ontology annotation based on curation of immunofluorescence data

GO_REF:0000107

Automatic transfer of experimentally verified manual GO annotation data to orthologs using Ensembl Compara

GO_REF:0000108

Automatic assignment of GO terms using logical inference

GO_REF:0000117

Electronic Gene Ontology annotations created by ARBA machine learning models

GO_REF:0000120

Combined Automated Annotation using Multiple IEA Methods

PMID:9027314

Prevention of apoptosis by Bcl-2: release of cytochrome c from mitochondria blocked.

BCL2 localizes to mitochondrial outer membrane
BCL2 prevents cytochrome c release from mitochondria
BCL2 blocks apoptosis initiation

PMID:9219694

Inhibition of Bax channel-forming activity by Bcl-2.

BCL2 inhibits BAX pore-forming activity at physiological pH
BCL2 forms channels only at acidic pH in artificial membranes
BCL2 antagonizes BAX pro-apoptotic function

PMID:9111042

A common binding site mediates heterodimerization and homodimerization of Bcl-2 family members.

BCL2 forms homodimers and heterodimers with BAX
BH3 peptides block BCL2 binding interactions
Same binding motifs mediate homo- and heterodimerization

PMID:21358617

Mitochondrial BCL-2 inhibits AMBRA1-induced autophagy.

BCL2 localizes to both mitochondria and ER
BCL2 binds AMBRA1 preferentially at mitochondria
BCL2-AMBRA1 interaction is disrupted upon autophagy induction
BCL2 inhibits BECN1-dependent autophagy through AMBRA1 sequestration

PMID:2250705

Bcl-2 is an inner mitochondrial membrane protein that blocks programmed cell death

Early localization study establishing BCL2 at mitochondrial membranes

croce2025thebcl2protein

The bcl-2 protein family - from discovery to drug development

BCL2 BH1-BH4 domains form hydrophobic groove for BH3 binding
C-terminal TM helix anchors BCL2 to OMM and ER membranes
BCL2 prevents MOMP by neutralizing BH3-only proteins and restraining BAX/BAK

PMID:12624108

Inhibition of Bid-induced apoptosis by Bcl-2. tBid insertion, Bax translocation, and Bax/Bak oligomerization suppressed.

PMID:12667443

p53 has a direct apoptogenic role at the mitochondria.

PMID:14739602

The Siva-1 putative amphipathic helical region (SAH) is sufficient to bind to BCL-XL and sensitize cells to UV radiation induced apoptosis.

PMID:15225643

The phosphorylation status and anti-apoptotic activity of Bcl-2 are regulated by ERK and protein phosphatase 2A on the mitochondria.

PMID:15694340

Differential targeting of prosurvival Bcl-2 proteins by their BH3-only ligands allows complementary apoptotic function.

PMID:15733859

The flexible loop of Bcl-2 is required for molecular interaction with immunosuppressant FK-506 binding protein 38 (FKBP38).

PMID:16697956

Mitochondria primed by death signals determine cellular addiction to antiapoptotic BCL-2 family members.

PMID:17074758

The vaccinia virus protein F1L interacts with Bim and inhibits activation of the pro-apoptotic protein Bax.

PMID:17289999

Apoptosis initiated when BH3 ligands engage multiple Bcl-2 homologs, not Bax or Bak.

PMID:17418785

Bcl-2 and Bcl-XL regulate proinflammatory caspase-1 activation by interaction with NALP1.

PMID:17446862

Functional and physical interaction between Bcl-X(L) and a BH3-like domain in Beclin-1.

PMID:17525735

ERK1/2-dependent phosphorylation of BimEL promotes its rapid dissociation from Mcl-1 and Bcl-xL.

PMID:17692808

BH3 profiling identifies three distinct classes of apoptotic blocks to predict response to ABT-737 and conventional chemotherapeutic agents.

PMID:18719108

Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2.

PMID:18835031

A short Nur77-derived peptide converts Bcl-2 from a protector to a killer.

PMID:18981409

Apoptosis is triggered when prosurvival Bcl-2 proteins cannot restrain Bax.

PMID:19050071

Identification of Barkor as a mammalian autophagy-specific factor for Beclin 1 and class III phosphatidylinositol 3-kinase.

PMID:19074266

Mechanism of apoptosis induction by inhibition of the anti-apoptotic BCL-2 proteins.

PMID:19180116

DAP-kinase-mediated phosphorylation on the BH3 domain of beclin 1 promotes dissociation of beclin 1 from Bcl-XL and induction of autophagy.

PMID:19223583

Mechanism of Bcl-2 and Bcl-X(L) inhibition of NLRP1 inflammasome: loop domain-dependent suppression of ATP binding and oligomerization.

PMID:19521340

MDM4 (MDMX) localizes at the mitochondria and facilitates the p53-mediated intrinsic-apoptotic pathway.

PMID:19706527

The BH4 domain of Bcl-2 inhibits ER calcium release and apoptosis by binding the regulatory and coupling domain of the IP3 receptor.

PMID:19959994

The IKK complex contributes to the induction of autophagy.

PMID:20010695

Antagonism of Beclin 1-dependent autophagy by BCL-2 at the endoplasmic reticulum requires NAF-1.

PMID:21139567

MCL-1 is a stress sensor that regulates autophagy in a developmentally regulated manner.

PMID:21199865

Mutation to Bax beyond the BH3 domain disrupts interactions with pro-survival proteins and promotes apoptosis.

PMID:21454712

Noxa/Bcl-2 protein interactions contribute to bortezomib resistance in human lymphoid cells.

PMID:21458670

Bcl-x(L) retrotranslocates Bax from the mitochondria into the cytosol.

PMID:21671007

Role of Bim in apoptosis induced in H460 lung tumor cells by the spindle poison Combretastatin-A4.

PMID:23541952

Control of autophagic cell death by caspase-10 in multiple myeloma.

PMID:23845444

Targeting BCL-2 with the BH3 mimetic ABT-199 in estrogen receptor-positive breast cancer.

PMID:23954414

Beclin 2 functions in autophagy, degradation of G protein-coupled receptors, and metabolism.

PMID:24034250

EGFR-mediated Beclin 1 phosphorylation in autophagy suppression, tumor progression, and tumor chemoresistance.

PMID:24472739

Decorin activates AMPK, an energy sensor kinase, to induce autophagy in endothelial cells.

PMID:26004684

Small-Molecule Bcl2 BH4 Antagonist for Lung Cancer Therapy.

PMID:26431330

Subcellular localization of PUMA regulates its pro-apoptotic activity in Burkitt's lymphoma B cells.

PMID:29749471

GSK3β‑mediated Ser156 phosphorylation modulates a BH3‑like domain in BCL2L12 during TMZ‑induced apoptosis and autophagy in glioma cells.

PMID:29849149

Disruption of the beclin 1-BCL2 autophagy regulatory complex promotes longevity in mice.

PMID:32296183

A reference map of the human binary protein interactome.

PMID:32814053

Interactome Mapping Provides a Network of Neurodegenerative Disease Proteins and Uncovers Widespread Protein Aggregation in Affected Brains.

PMID:33961781

Dual proteome-scale networks reveal cell-specific remodeling of the human interactome.

PMID:9334338

p28 Bap31, a Bcl-2/Bcl-XL- and procaspase-8-associated protein in the endoplasmic reticulum.

PMID:9388232

Dimerization properties of human BAD. Identification of a BH-3 domain and analysis of its binding to mutant BCL-2 and BCL-XL proteins.

PMID:9463381

The conserved N-terminal BH4 domain of Bcl-2 homologues is essential for inhibition of apoptosis and interaction with CED-4.

PMID:9973195

BNIP3alpha: a human homolog of mitochondrial proapoptotic protein BNIP3.

PMID:14634621

The Bcl-2 family: roles in cell survival and oncogenesis.

PMID:34800366

Quantitative high-confidence human mitochondrial proteome and its dynamics in cellular context.

PMID:26858413

Structural and biochemical analysis of Bcl-2 interaction with the hepatitis B virus protein HBx.

PMID:29020630

Degradation of Bcl-2 by XIAP and ARTS Promotes Apoptosis.

PMID:25609812

Tom70 mediates Sendai virus-induced apoptosis on mitochondria.

PMID:31206022

BAP31 regulates mitochondrial function via interaction with Tom40 within ER-mitochondria contact sites.

PMID:17428862

Induction of apoptosis by the severe acute respiratory syndrome coronavirus 7a protein is dependent on its interaction with the Bcl-XL protein.

PMID:16443602

WT p53, but not tumor-derived mutants, bind to Bcl2 via the DNA binding domain and induce mitochondrial permeabilization.

PMID:27031958

Nupr1/Chop signal axis is involved in mitochondrion-related endothelial cell apoptosis induced by methamphetamine.

PMID:28280358

miR-204-5p acts as a tumor suppressor by targeting matrix metalloproteinases-9 and B-cell lymphoma-2 in malignant melanoma.

PMID:27673746

Apoptotic properties of the type 1 interferon induced family of human mitochondrial membrane ISG12 proteins.

PMID:1286168

The bcl-2 oncogene and apoptosis.

PMID:20041405

Effects of microRNA-29 on apoptosis, tumorigenicity, and prognosis of hepatocellular carcinoma.

PMID:21212266

BCL-2 is a downstream target of ATF5 that mediates the prosurvival function of ATF5 in a cell type-dependent manner.

PMID:9660918

Bax inhibitor-1, a mammalian apoptosis suppressor identified by functional screening in yeast.

PMID:36599

[Isolation of a strain of Streptococcus pneumoniae multiresistant to antibiotics].

PMID:8022822

Evidence that BCL-2 represses apoptosis by regulating endoplasmic reticulum-associated Ca2+ fluxes.

PMID:11060313

MAP-1, a novel proapoptotic protein containing a BH3-like motif that associates with Bax through its Bcl-2 homology domains.

PMID:23431138

Related F-box proteins control cell death in Caenorhabditis elegans and human lymphoma.

PMID:18309324

Vital functions of apoptotic effectors.

PMID:11684014

ASPP proteins specifically stimulate the apoptotic function of p53.

PMID:8358790

Bcl-2 heterodimerizes in vivo with a conserved homolog, Bax, that accelerates programmed cell death.

PMID:10597216

Bis, a Bcl-2-binding protein that synergizes with Bcl-2 in preventing cell death.

Reactome:R-HSA-114352

BCL2 sequestration of tBID

Reactome:R-HSA-139897

BAD displacing tBID from BCL2

Reactome:R-HSA-508163

BH3-only proteins inactivating BCL2

Reactome:R-HSA-6790025

BCL2 expression

Reactome:R-HSA-879201

BCL2 binding NLRP1

Reactome:R-HSA-9011941

Estrogen-responsive BCL2 expression

Reactome:R-HSA-9623999

BCL2 expression downstream of ESR1

Reactome:R-HSA-9692376

BCL2 binding antagonists

Reactome:R-HSA-9796055

NFE2L2-dependent BCL2 expression

Reactome:R-HSA-9824587

MITF-dependent BCL2 expression

PMID:15006356

A mitochondrial protein, Bit1, mediates apoptosis regulated by integrins and Groucho/TLE corepressors.

PMID:20849813

Prolyl hydroxylase 3 interacts with Bcl-2 to regulate doxorubicin-induced apoptosis in H9c2 cells.

PMID:19706769

Identification of a protein, G0S2, that lacks Bcl-2 homology domains and interacts with and antagonizes Bcl-2.

PMID:20097879

Identification of a novel proapoptotic function of resveratrol in fat cells: SIRT1-independent sensitization to TRAIL-induced apoptosis.

PMID:20889974

Parkin mono-ubiquitinates Bcl-2 and regulates autophagy.

PMID:8402648

Investigation of the subcellular distribution of the bcl-2 oncoprotein: residence in the nuclear envelope, endoplasmic reticulum, and outer mitochondrial membranes.

PMID:17875758

ATM, CTLA4, MNDA, and HEM1 in high versus low CD38 expressing B-cell chronic lymphocytic leukemia.

PMID:12086670

Bcl2 regulation by the melanocyte master regulator Mitf modulates lineage survival and melanoma cell viability.

PMID:16717086

PP2A regulates BCL-2 phosphorylation and proteasome-mediated degradation at the endoplasmic reticulum.

PMID:7546744

Role of BCL-2 in the survival and function of developing and mature sympathetic neurons.

PMID:7896880

The intracellular distribution and pattern of expression of Mcl-1 overlap with, but are not identical to, those of Bcl-2.

PMID:9305631

BAG-1 modulates the chaperone activity of Hsp70/Hsc70.

PMID:9184696

The apoptosis and proliferation of SAC-activated B cells by IL-10 are associated with changes in Bcl-2, Bcl-xL, and Mcl-1 expression.

PMID:1373874

Bcl-2 confers growth and survival advantage to interleukin 7-dependent early pre-B cells which become factor independent by a multistep process in culture.

PMID:7650367

Expression of Bcl-2, Bcl-x, and Bax after T cell activation and IL-2 withdrawal.

PMID:7772249

Evolutionary conservation of function among mammalian, avian, and viral homologs of the Bcl-2 oncoprotein.

PMID:8050499

bcl-2 gene prevents apoptosis of basic fibroblast growth factor-deprived murine aortic endothelial cells.

PMID:8080725

bcl-2 gene enables rescue from in vitro myelosuppression (bone marrow cell death) induced by chemotherapy.

PMID:15776018

Proapoptotic BAX and BAK control multiple initiator caspases.

PMID:16790527

Mitochondrial damage due to SOD1 deficiency in SH-SY5Y neuroblastoma cells: a rationale for the redundancy of SOD1.

PMID:16307838

T-2 toxin induces apoptosis, and selenium partly blocks, T-2 toxin induced apoptosis in chondrocytes through modulation of the Bax/Bcl-2 ratio.

PMID:10620603

The HIV-1 viral protein R induces apoptosis via a direct effect on the mitochondrial permeability transition pore.

PMID:10837489

MCL-1S, a splicing variant of the antiapoptotic BCL-2 family member MCL-1, encodes a proapoptotic protein possessing only the BH3 domain.

PMID:11054413

Bcl-G, a novel pro-apoptotic member of the Bcl-2 family.

PMID:11126360

A novel protein, RTN-XS, interacts with both Bcl-XL and Bcl-2 on endoplasmic reticulum and reduces their anti-apoptotic activity.

PMID:11278245

Bcl-B, a novel Bcl-2 family member that differentially binds and regulates Bax and Bak.

PMID:11463391

PUMA induces the rapid apoptosis of colorectal cancer cells.

PMID:12901880

BNIPL-2, a novel homologue of BNIP-2, interacts with Bcl-2 and Cdc42GAP in apoptosis.

PMID:7954800

Adenovirus E1B 19 kDa and Bcl-2 proteins interact with a common set of cellular proteins.

PMID:11530860

The immunolocalization of Bcl-2 in human term placenta.

PMID:15799693

Medium from irradiated cells induces dose-dependent mitochondrial changes and BCL2 responses in unirradiated human keratinocytes.

PMID:11264898

Iron induces Bcl-2 expression in human dermal microvascular endothelial cells.

PMID:1502141

Overexpressed full-length human BCL2 extends the survival of baculovirus-infected Sf9 insect cells.

PMID:10506221

Regulation of acidification and apoptosis by SHP-1 and Bcl-2.

PMID:12421819

A functional role for nicotine in Bcl2 phosphorylation and suppression of apoptosis.

PMID:16167175

Inhibition of mitochondrial neural cell death pathways by protein transduction of Bcl-2 family proteins.

PMID:9843949

Bax interacts with the permeability transition pore to induce permeability transition and cytochrome c release in isolated mitochondria.

PMID:1908951

Bcl-2 maintains B cell memory.

file:human/BCL2/BCL2-deep-research-falcon.md

Deep research report on BCL2

Suggested Experiments

Experiment: Structure-function analysis of BCL2 variants that retain BH3 binding but lack membrane insertion to dissect OMM vs cytosolic functions

Experiment: Live-cell imaging of BCL2-BECN1 vs BCL2-BAX interactions to quantify relative occupancy under different stress conditions

📚 Additional Documentation

Deep Research Bioreason

(BCL2-deep-research-bioreason.md)

BioReason Chat Export

Exported on March 22, 2026 at 01:51 AM

Organism: Homo sapiens

Sequence:

MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Thinking Trace

I begin by examining the InterPro architecture. The sequence is saturated with Bcl-2 family signatures: IPR013278 (Apoptosis regulator, Bcl-2 family, residues 1–221), IPR004725 (Apoptosis regulator, Bcl-2/Bcl-X family, residues 2–239), IPR026298 (Bcl-2 family, residues 5–205), and IPR036834 (Bcl-2-like superfamily, residues 6–223). These overlapping family/superfamily assignments indicate a canonical Bcl-2 fold—a compact helical bundle that forms hydrophobic interaction grooves for BH3-mediated protein–protein recognition. The N-terminal IPR003093 (BH4 domain, residues 7–33) and its conserved site IPR020731 (BH4 motif, residues 10–30) establish an N-terminal regulatory module that stabilizes anti-apoptotic interactions and modulates conformational states. The core effector region is delineated by IPR046371 (Bcl-2 homology region 1–3, residues 97–195) and IPR002475 (Bcl2-like, residues 97–197), which together encode the BH1–BH3 interaction platform that binds BH3 helices from pro-apoptotic partners. Consistent with this, three conserved-site annotations map precisely onto the BH hierarchy: IPR020728 (BH3 motif, residues 93–107), IPR020717 (BH1 motif, residues 137–155), and IPR020726 (BH2 motif, residues 188–199). The ordered presence of BH4 at the N-terminus followed by the BH1–3 core creates the hallmark anti-apoptotic scaffold that captures BH3-only ligands and neutralizes BAX/BAK activation.

This architecture causes a molecular function centered on protein binding through BH3-recognition grooves and oligomerization surfaces. Thus, the minimal defensible function is GO:0005515 protein binding, arising from the multi-BH modular scaffold that sequesters pro-apoptotic effectors and prevents downstream mitochondrial outer membrane permeabilization.

From that binding-driven mechanism, the biological process follows: by restraining BAX/BAK-mediated apoptosis, the protein enforces cell survival checkpoints and modulates programmed cell death. This places it squarely in GO:0006915 apoptotic process, acting upstream of cytochrome c release and caspase activation by preventing assembly of pro-apoptotic complexes at mitochondria.

Cellular location is dictated by both the soluble BH-fold core and a short C-terminal hydrophobic tail typical of this family that mediates membrane association. The absence of transmembrane spans together with a membrane-anchoring motif supports a peripheral association with organellar membranes. The experimentally grounded subcellular descriptors point to the endoplasmic reticulum membrane and the mitochondrial outer membrane as the principal operating surfaces. Therefore, the cellular component is best captured by GO:0005789 endoplasmic reticulum membrane and GO:0005741 mitochondrial outer membrane, with a soluble pool in GO:0005737 cytoplasm that dynamically partitions to membranes upon ligand engagement.

Mechanistically, the BH4–BH1–3 platform sequesters BH3-only ligands and prevents BAX/BAK oligomerization, thereby keeping the mitochondrial pathway under tight anti-apoptotic control. I hypothesize preferential interactions with pro-apoptotic BAX and BAK at the mitochondrial outer membrane, and with ER-proximal BH3-only proteins and stress sensors that signal via ER–mitochondria contact sites. This arrangement predicts transient assemblies with BAX, BAK, and BH3-only family members at ER and mitochondria, where the protein acts as a membrane-proximal sink that maintains the apoptotic threshold and coordinates survival signaling across these organelles.

Functional Summary

An anti-apoptotic regulator that assembles a BH4–BH1–3 modular scaffold to bind and neutralize pro-apoptotic factors at organelle membranes. It operates as a soluble cytoplasmic protein that dynamically associates with the outer surface of mitochondria and with the endoplasmic reticulum, where it prevents assembly of apoptosis-inducing complexes and preserves cell survival by restraining mitochondrial pathway activation.

UniProt Summary

May prevent apoptosis.

InterPro Domains

Apoptosis regulator, Bcl-2 (IPR013278, family) — residues 1-221
Apoptosis regulator, Bcl-2/ BclX (IPR004725, family) — residues 2-239
Bcl-2 family (IPR026298, family) — residues 5-205
Bcl-2-like superfamily (IPR036834, homologous_superfamily) — residues 6-223
Apoptosis regulator, Bcl-2 protein, BH4 (IPR003093, domain) — residues 7-33
Apoptosis regulator, Bcl-2, BH4 motif, conserved site (IPR020731, conserved_site) — residues 10-30
Apoptosis regulator, Bcl-2, BH3 motif, conserved site (IPR020728, conserved_site) — residues 93-107
Bcl2-like (IPR002475, family) — residues 97-197
Bcl-2, Bcl-2 homology region 1-3 (IPR046371, domain) — residues 97-195
Apoptosis regulator, Bcl-2, BH1 motif, conserved site (IPR020717, conserved_site) — residues 137-155
Apoptosis regulator, Bcl-2, BH2 motif, conserved site (IPR020726, conserved_site) — residues 188-199

GO Terms

Molecular Function: molecular_function (GO:0003674), molecular function regulator activity (GO:0098772), binding (GO:0005488), transporter activity (GO:0005215), molecular adaptor activity (GO:0060090), channel regulator activity (GO:0016247), heterocyclic compound binding (GO:1901363), transmembrane transporter activity (GO:0022857), organic cyclic compound binding (GO:0097159), protein binding (GO:0005515), molecular function inhibitor activity (GO:0140678), transcription factor binding (GO:0008134), nucleic acid binding (GO:0003676), channel inhibitor activity (GO:0016248), protein dimerization activity (GO:0046983), identical protein binding (GO:0042802), passive transmembrane transporter activity (GO:0022803), protein domain specific binding (GO:0019904), enzyme binding (GO:0019899), BH domain binding (GO:0051400), ubiquitin-like protein ligase binding (GO:0044389), DNA-binding transcription factor binding (GO:0140297), DNA binding (GO:0003677), channel activity (GO:0015267), protein heterodimerization activity (GO:0046982), protease binding (GO:0002020), ubiquitin protein ligase binding (GO:0031625), sequence-specific DNA binding (GO:0043565)

Biological Process: biological_process (GO:0008150), positive regulation of biological process (GO:0048518), regulation of biological process (GO:0050789), signaling (GO:0023052), multicellular organismal process (GO:0032501), biological regulation (GO:0065007), response to stimulus (GO:0050896), cellular process (GO:0009987), metabolic process (GO:0008152), biological process involved in interspecies interaction between organisms (GO:0044419), homeostatic process (GO:0042592), immune system process (GO:0002376), negative regulation of biological process (GO:0048519), response to external stimulus (GO:0009605), negative regulation of signaling (GO:0023057), response to chemical (GO:0042221), leukocyte activation (GO:0045321), cell population proliferation (GO:0008283), immune response (GO:0006955), positive regulation of multicellular organismal process (GO:0051240), positive regulation of immune system process (GO:0002684), nitrogen compound metabolic process (GO:0006807), regulation of multicellular organismal process (GO:0051239), positive regulation of growth (GO:0045927), negative regulation of metabolic process (GO:0009892), regulation of biological quality (GO:0065008), cellular homeostasis (GO:0019725), response to biotic stimulus (GO:0009607), cell death (GO:0008219), regulation of pH (GO:0006885), regulation of cellular process (GO:0050794), regulation of response to stimulus (GO:0048583), cellular response to stimulus (GO:0051716), regulation of signaling (GO:0023051), activation of immune response (GO:0002253), negative regulation of cellular process (GO:0048523), response to other organism (GO:0051707), signal transduction (GO:0007165), cell activation (GO:0001775), positive regulation of response to stimulus (GO:0048584), regulation of metabolic process (GO:0019222), regulation of localization (GO:0032879), regulation of immune system process (GO:0002682), organic substance metabolic process (GO:0071704), chemical homeostasis (GO:0048878), regulation of molecular function (GO:0065009), response to stress (GO:0006950), negative regulation of response to stimulus (GO:0048585), cell communication (GO:0007154), regulation of growth (GO:0040008), primary metabolic process (GO:0044238), positive regulation of cellular process (GO:0048522), negative regulation of signal transduction (GO:0009968), programmed cell death (GO:0012501), response to external biotic stimulus (GO:0043207), negative regulation of cell death (GO:0060548), response to xenobiotic stimulus (GO:0009410), regulation of response to stress (GO:0080134), regulation of signal transduction (GO:0009966), regulation of leukocyte activation (GO:0002694), lymphocyte activation (GO:0046649), neuron death (GO:0070997), regulation of catabolic process (GO:0009894), intracellular chemical homeostasis (GO:0055082), response to inorganic substance (GO:0010035), negative regulation of response to DNA damage stimulus (GO:2001021), leukocyte proliferation (GO:0070661), regulation of membrane potential (GO:0042391), apoptotic signaling pathway (GO:0097190), positive regulation of immune response (GO:0050778), cell surface receptor signaling pathway (GO:0007166), regulation of cellular component organization (GO:0051128), response to virus (GO:0009615), regulation of cell activation (GO:0050865), response to nicotine (GO:0035094), positive regulation of cell population proliferation (GO:0008284), monoatomic ion homeostasis (GO:0050801), immune response-regulating signaling pathway (GO:0002764), negative regulation of cell communication (GO:0010648), regulation of transport (GO:0051049), organonitrogen compound metabolic process (GO:1901564), intracellular signal transduction (GO:0035556), regulation of transporter activity (GO:0032409), protein metabolic process (GO:0019538), regulation of cell growth (GO:0001558), regulation of cellular response to stress (GO:0080135), response to toxic substance (GO:0009636), defense response (GO:0006952), regulation of transmembrane transport (GO:0034762), inorganic ion homeostasis (GO:0098771), regulation of cellular pH (GO:0030641), positive regulation of cell growth (GO:0030307), negative regulation of cellular metabolic process (GO:0031324), macromolecule metabolic process (GO:0043170), response to organic substance (GO:0010033), positive regulation of cell activation (GO:0050867), defense response to other organism (GO:0098542), positive regulation of leukocyte activation (GO:0002696), regulation of membrane depolarization (GO:0003254), regulation of immune response (GO:0050776), regulation of cell population proliferation (GO:0042127), immune response-activating signaling pathway (GO:0002757), regulation of cell death (GO:0010941), regulation of cell communication (GO:0010646), cellular response to stress (GO:0033554), humoral immune response (GO:0006959), regulation of cellular metabolic process (GO:0031323), negative regulation of catabolic process (GO:0009895), negative regulation of programmed cell death (GO:0043069), regulation of programmed cell death (GO:0043067), negative regulation of cellular catabolic process (GO:0031330), regulation of leukocyte proliferation (GO:0070663), regulation of mitochondrial membrane potential (GO:0051881), regulation of mitochondrial depolarization (GO:0051900), negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage (GO:1902230), negative regulation of signal transduction in absence of ligand (GO:1901099), immune response-activating cell surface receptor signaling pathway (GO:0002429), macromolecule modification (GO:0043412), positive regulation of lymphocyte activation (GO:0051251), negative regulation of autophagy (GO:0010507), intrinsic apoptotic signaling pathway (GO:0097193), positive regulation of leukocyte proliferation (GO:0070665), B cell activation (GO:0042113), regulation of lymphocyte activation (GO:0051249), response to metal ion (GO:0010038), response to cytokine (GO:0034097), negative regulation of neuron death (GO:1901215), lymphocyte proliferation (GO:0046651), immune response-regulating cell surface receptor signaling pathway (GO:0002768), cellular response to DNA damage stimulus (GO:0006974), defense response to virus (GO:0051607), regulation of intracellular pH (GO:0051453), regulation of autophagy (GO:0010506), regulation of neuron death (GO:1901214), negative regulation of apoptotic signaling pathway (GO:2001234), negative regulation of intracellular signal transduction (GO:1902532), regulation of apoptotic signaling pathway (GO:2001233), intracellular monoatomic ion homeostasis (GO:0006873), mononuclear cell proliferation (GO:0032943), regulation of response to DNA damage stimulus (GO:2001020), calcium ion homeostasis (GO:0055074), protein modification process (GO:0036211), response to endoplasmic reticulum stress (GO:0034976), monoatomic cation homeostasis (GO:0055080), defense response to symbiont (GO:0140546), neuron apoptotic process (GO:0051402), apoptotic process (GO:0006915), extrinsic apoptotic signaling pathway (GO:0097191), regulation of transmembrane transporter activity (GO:0022898), regulation of monoatomic ion transport (GO:0043269), regulation of cellular catabolic process (GO:0031329), regulation of intracellular signal transduction (GO:1902531), regulation of apoptotic process (GO:0042981), regulation of lymphocyte proliferation (GO:0050670), regulation of mononuclear cell proliferation (GO:0032944), negative regulation of intrinsic apoptotic signaling pathway (GO:2001243), regulation of neuron apoptotic process (GO:0043523), regulation of metal ion transport (GO:0010959), negative regulation of signal transduction by p53 class mediator (GO:1901797), positive regulation of lymphocyte proliferation (GO:0050671), extrinsic apoptotic signaling pathway via death domain receptors (GO:0008625), intracellular monoatomic cation homeostasis (GO:0030003), B cell proliferation (GO:0042100), positive regulation of mononuclear cell proliferation (GO:0032946), negative regulation of extrinsic apoptotic signaling pathway in absence of ligand (GO:2001240), negative regulation of neuron apoptotic process (GO:0043524), intracellular calcium ion homeostasis (GO:0006874), regulation of B cell activation (GO:0050864), positive regulation of B cell activation (GO:0050871), regulation of intrinsic apoptotic signaling pathway (GO:2001242), regulation of signal transduction by p53 class mediator (GO:1901796), regulation of extrinsic apoptotic signaling pathway in absence of ligand (GO:2001239), negative regulation of apoptotic process (GO:0043066), protein modification by small protein conjugation or removal (GO:0070647), antigen receptor-mediated signaling pathway (GO:0050851), negative regulation of extrinsic apoptotic signaling pathway (GO:2001237), response to iron ion (GO:0010039), regulation of extrinsic apoptotic signaling pathway (GO:2001236), regulation of intrinsic apoptotic signaling pathway in response to DNA damage (GO:1902229), intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress (GO:0070059), regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator (GO:1902165), positive regulation of B cell proliferation (GO:0030890), negative regulation of intrinsic apoptotic signaling pathway by p53 class mediator (GO:1902254), regulation of calcium ion transport (GO:0051924), regulation of B cell proliferation (GO:0030888), protein modification by small protein conjugation (GO:0032446), negative regulation of anoikis (GO:2000811), regulation of intrinsic apoptotic signaling pathway by p53 class mediator (GO:1902253), regulation of anoikis (GO:2000209), B cell receptor signaling pathway (GO:0050853), endoplasmic reticulum calcium ion homeostasis (GO:0032469), protein ubiquitination (GO:0016567), protein polyubiquitination (GO:0000209)

Cellular Component: cellular_component (GO:0005575), protein-containing complex (GO:0032991), cellular anatomical entity (GO:0110165), intracellular anatomical structure (GO:0005622), organelle (GO:0043226), membrane (GO:0016020), membrane-enclosed lumen (GO:0031974), membrane protein complex (GO:0098796), organelle subcompartment (GO:0031984), envelope (GO:0031975), cytoplasm (GO:0005737), endomembrane system (GO:0012505), nucleoplasm (GO:0005654), organelle membrane (GO:0031090), organelle envelope (GO:0031967), intracellular organelle (GO:0043229), outer membrane (GO:0019867), endoplasmic reticulum subcompartment (GO:0098827), nuclear outer membrane-endoplasmic reticulum membrane network (GO:0042175), mitochondrion (GO:0005739), pore complex (GO:0046930), organelle lumen (GO:0043233), endoplasmic reticulum (GO:0005783), nuclear envelope (GO:0005635), membrane-bounded organelle (GO:0043227), nuclear membrane (GO:0031965), mitochondrial envelope (GO:0005740), intracellular membrane-bounded organelle (GO:0043231), bounding membrane of organelle (GO:0098588), organelle outer membrane (GO:0031968), endoplasmic reticulum membrane (GO:0005789), intracellular organelle lumen (GO:0070013), mitochondrial membrane (GO:0031966), mitochondrial outer membrane (GO:0005741), nucleus (GO:0005634), nuclear lumen (GO:0031981)

Generated by BioReason

Deep Research Bioreason Rl

(BCL2-deep-research-bioreason-rl.md)

BioReason Chat Export

Exported on March 22, 2026 at 01:51 AM

Organism: Homo sapiens

Sequence:

MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Thinking Trace

Functional Summary

UniProt Summary

May prevent apoptosis.

InterPro Domains

Apoptosis regulator, Bcl-2 (IPR013278, family) — residues 1-221
Apoptosis regulator, Bcl-2/ BclX (IPR004725, family) — residues 2-239
Bcl-2 family (IPR026298, family) — residues 5-205
Bcl-2-like superfamily (IPR036834, homologous_superfamily) — residues 6-223
Apoptosis regulator, Bcl-2 protein, BH4 (IPR003093, domain) — residues 7-33
Apoptosis regulator, Bcl-2, BH4 motif, conserved site (IPR020731, conserved_site) — residues 10-30
Apoptosis regulator, Bcl-2, BH3 motif, conserved site (IPR020728, conserved_site) — residues 93-107
Bcl2-like (IPR002475, family) — residues 97-197
Bcl-2, Bcl-2 homology region 1-3 (IPR046371, domain) — residues 97-195
Apoptosis regulator, Bcl-2, BH1 motif, conserved site (IPR020717, conserved_site) — residues 137-155
Apoptosis regulator, Bcl-2, BH2 motif, conserved site (IPR020726, conserved_site) — residues 188-199

GO Terms

Generated by BioReason

Deep Research Falcon

(BCL2-deep-research-falcon.md)

provider: falcon
model: Edison Scientific Literature
cached: false
start_time: '2026-01-18T22:35:35.782522'
end_time: '2026-01-18T22:42:38.222342'
duration_seconds: 422.44
template_file: templates/gene_research_go_focused.md
template_variables:
organism: human
gene_id: BCL2
gene_symbol: BCL2
uniprot_accession: P10415
protein_description: 'RecName: Full=Apoptosis regulator Bcl-2;'
gene_info: Name=BCL2;
organism_full: Homo sapiens (Human).
protein_family: Belongs to the Bcl-2 family. .
protein_domains: Apop_reg_Bcl2. (IPR013278); Bcl-2-like_sf. (IPR036834); Bcl-2_BH1-3.
(IPR046371); Bcl-2_fam. (IPR026298); Bcl2-like. (IPR002475)
provider_config:
timeout: 600
max_retries: 3
parameters:
allowed_domains: []
temperature: 0.1
citation_count: 16

Question

Gene Research for Functional Annotation

⚠️ CRITICAL: Gene/Protein Identification Context

BEFORE YOU BEGIN RESEARCH: You MUST verify you are researching the CORRECT gene/protein. Gene symbols can be ambiguous, especially for less well-characterized genes from non-model organisms.

Target Gene/Protein Identity (from UniProt):

UniProt Accession: P10415
Protein Description: RecName: Full=Apoptosis regulator Bcl-2;
Gene Information: Name=BCL2;
Organism (full): Homo sapiens (Human).
Protein Family: Belongs to the Bcl-2 family. .
Key Domains: Apop_reg_Bcl2. (IPR013278); Bcl-2-like_sf. (IPR036834); Bcl-2_BH1-3. (IPR046371); Bcl-2_fam. (IPR026298); Bcl2-like. (IPR002475)

MANDATORY VERIFICATION STEPS:

Check if the gene symbol "BCL2" matches the protein description above
Verify the organism is correct: Homo sapiens (Human).
Check if protein family/domains align with what you find in literature
If you find literature for a DIFFERENT gene with the same or similar symbol, STOP

If Gene Symbol is Ambiguous or You Cannot Find Relevant Literature:

DO NOT PROCEED WITH RESEARCH ON A DIFFERENT GENE. Instead:
- State clearly: "The gene symbol 'BCL2' is ambiguous or literature is limited for this specific protein"
- Explain what you found (e.g., "Found extensive literature on a different gene with the same symbol in a different organism")
- Describe the protein based ONLY on the UniProt information provided above
- Suggest that the protein function can be inferred from domain/family information

Research Target:

Please provide a comprehensive research report on the gene BCL2 (gene ID: BCL2, UniProt: P10415) in human.

The research report should be a detailed narrative explaining the function, biological processes, and localization of the gene product. Citations should be given for all claims.

You should prioritize authoritative reviews and primary scientific literature when conducting research. You can supplement
this with annotations you find in gene/protein databases, but these can be outdated or inaccurate.

We are specifically interested in the primary function of the gene - for enzymes, what reaction is catalyzed, and what is the substrate specificity? For transporters, what is the substrate? For structural proteins or adapters, what is the broader structural role? For signaling molecules, what is the role in the pathway.

We are interested in where in or outside the cell the gene product carries out its function.

We are also interested in the signaling or biochemical pathways in which the gene functions. We are less interested in broad pleiotropic effects, except where these elucidate the precise role.

Include evidence where possible. We are interested in both experimental evidence as well as inference from structure, evolution, or bioinformatic analysis. Precise studies should be prioritized over high-throughput, where available.

Output

Question: You are an expert researcher providing comprehensive, well-cited information.

Provide detailed information focusing on:
1. Key concepts and definitions with current understanding
2. Recent developments and latest research (prioritize 2023-2024 sources)
3. Current applications and real-world implementations
4. Expert opinions and analysis from authoritative sources
5. Relevant statistics and data from recent studies

Format as a comprehensive research report with proper citations. Include URLs and publication dates where available.
Always prioritize recent, authoritative sources and provide specific citations for all major claims.

Gene Research for Functional Annotation

⚠️ CRITICAL: Gene/Protein Identification Context

BEFORE YOU BEGIN RESEARCH: You MUST verify you are researching the CORRECT gene/protein. Gene symbols can be ambiguous, especially for less well-characterized genes from non-model organisms.

Target Gene/Protein Identity (from UniProt):

UniProt Accession: P10415
Protein Description: RecName: Full=Apoptosis regulator Bcl-2;
Gene Information: Name=BCL2;
Organism (full): Homo sapiens (Human).
Protein Family: Belongs to the Bcl-2 family. .
Key Domains: Apop_reg_Bcl2. (IPR013278); Bcl-2-like_sf. (IPR036834); Bcl-2_BH1-3. (IPR046371); Bcl-2_fam. (IPR026298); Bcl2-like. (IPR002475)

MANDATORY VERIFICATION STEPS:

Check if the gene symbol "BCL2" matches the protein description above
Verify the organism is correct: Homo sapiens (Human).
Check if protein family/domains align with what you find in literature
If you find literature for a DIFFERENT gene with the same or similar symbol, STOP

If Gene Symbol is Ambiguous or You Cannot Find Relevant Literature:

Research Target:

Please provide a comprehensive research report on the gene BCL2 (gene ID: BCL2, UniProt: P10415) in human.

The research report should be a detailed narrative explaining the function, biological processes, and localization of the gene product. Citations should be given for all claims.

We are interested in where in or outside the cell the gene product carries out its function.

We are also interested in the signaling or biochemical pathways in which the gene functions. We are less interested in broad pleiotropic effects, except where these elucidate the precise role.

Research plan and verification summary
Identity verification: The target is human BCL2, UniProt P10415, encoding the apoptosis regulator Bcl-2, an anti-apoptotic member of the Bcl-2 family with conserved BH1–BH4 domains and a C‑terminal transmembrane (TM) helix. Literature describing BCL2’s BH-domain architecture and the BH3-binding hydrophobic groove aligns with UniProt (P10415), and places BCL2 within the anti-apoptotic, four-domain Bcl-2 subfamily that anchors to membranes via its TM segment (e.g., BCL2/BCL‑XL/MCL1) (croce2025thebcl2protein pages 5-6, pathiranage2023antiapoptoticproteinsas pages 15-20). No conflicting gene symbol usage was identified; all evidence pertains to human BCL2.

Comprehensive report
1) Key concepts and definitions
- Definition and family: BCL2 encodes a pro‑survival (anti-apoptotic) Bcl-2 family protein that preserves mitochondrial outer membrane integrity by neutralizing pro-apoptotic BH3-only ligands and effectors (BAX/BAK). Anti-apoptotic Bcl-2 family proteins share BH1–BH4 domains, a hydrophobic BH3-binding groove, and a C‑terminal TM anchor that targets intracellular membranes (mitochondria, ER) (croce2025thebcl2protein pages 5-6, pathiranage2023antiapoptoticproteinsas pages 15-20).
- Structural determinants: The BH1–BH3 domains form the canonical groove that binds BH3 helices of pro-apoptotic partners. Structural pharmacology defines sub-pockets (P1–P4) in the groove that dictate BH3-peptide and BH3-mimetic binding selectivity; P2 is particularly critical for inhibitor design (pathiranage2023antiapoptoticproteinsas pages 15-20).

2) Molecular mechanism and primary function
- Primary function: BCL2 prevents apoptosis by sequestering BH3-only activators/sensitizers and/or by preventing BAX/BAK activation and oligomerization, thereby blocking mitochondrial outer membrane permeabilization (MOMP) and cytochrome c release (croce2025thebcl2protein pages 5-6, pathiranage2023antiapoptoticproteinsas pages 15-20). Conceptually, anti-apoptotic BCL2 proteins serve as the “rheostat” opposing the pore-forming effectors BAX/BAK (croce2025thebcl2protein pages 5-6).
- BH3-in-groove binding: The hydrophobic groove on BCL2 engages BH3 helices from ligands such as BIM, BAD, PUMA, and from effectors in transient complexes, underlying the biochemical basis for BH3 mimetics (e.g., venetoclax) that occupy this groove (croce2025thebcl2protein pages 5-6, pathiranage2023antiapoptoticproteinsas pages 15-20).
- Post-translational regulation—phosphorylation: 2023 evidence shows hyperphosphorylation of BCL-2 family members (including BCL2 Ser70) drives functional resistance to venetoclax by altering the anti-apoptotic interactome and rewiring apoptotic dependencies; phosphatase-activating drugs can reverse resistance and restore venetoclax sensitivity in cell lines, a mouse model, and paired patient samples (chong2023hyperphosphorylationofbcl2 pages 14-16, chong2023hyperphosphorylationofbcl2 pages 18-19, chong2023hyperphosphorylationofbcl2 pages 1-2, chong2023hyperphosphorylationofbcl2 pages 19-20).

3) Subcellular localization and site of action
- Localization: BCL2 localizes to the mitochondrial outer membrane (MOM) where it prevents MOMP; it also distributes to the endoplasmic reticulum (ER) and, to a lesser extent, the nuclear envelope. Its C‑terminal TM helix anchors the protein and modulates interaction networks at membranes (croce2025thebcl2protein pages 5-6, pathiranage2023antiapoptoticproteinsas pages 15-20).
- TM domain interactions (2024): A 2024 experimental study using a split luciferase assay demonstrated that the BCL2 TM domain forms specific interactions with the TM domain of the pro-apoptotic effector BOK, with these BOK–BCL2 TM interactions localized at the ER. Molecular dynamics simulations in ER-mimetic membranes supported dynamic BOK/BCL2 TM homo- and hetero-oligomerization; BCL2 TM-dependent inhibition of BOK-induced apoptosis was shown, highlighting the TM region as a regulatory and potentially druggable interface (westaby2024bcl2expressionis pages 11-13).

4) Pathway context and regulatory crosstalk
- Intrinsic (mitochondrial) apoptosis: BCL2 operates in the intrinsic pathway by opposing BAX/BAK-mediated MOM poration. Contemporary reviews synthesize how pore-forming Bcl-2 proteins (BAX/BAK/BOK) execute MOMP, with anti-apoptotic members (including BCL2) restraining this process; super-resolution studies and structural models support BH3-in-groove dimeric intermediates and oligomeric pore assemblies (cao2023mechanismsofaction pages 7-7, croce2025thebcl2protein pages 5-6).
- Autophagy crosstalk: BCL2 regulates autophagy by binding Beclin-1 (BECN1) and through broader regulation of the autophagy machinery; AMPK-dependent phosphorylation can dissociate BCL2–Beclin-1 complexes, linking metabolic signaling to BCL2’s autophagy and apoptosis functions (chong2023hyperphosphorylationofbcl2 pages 18-19).
- Kinase signaling: JNK, ERK, AKT, and AMPK pathways modulate BCL-2 family phosphorylation (e.g., BCL2 S70, BAD S112, BAX S184) impacting apoptotic readiness and drug responses, including venetoclax resistance (chong2023hyperphosphorylationofbcl2 pages 14-16, chong2023hyperphosphorylationofbcl2 pages 18-19, chong2023hyperphosphorylationofbcl2 pages 19-20).

5) Recent developments and latest research (2023–2024)
- Phosphorylation-driven resistance (2023): Systematic BH3 profiling and high-throughput kinase activity mapping showed hyperphosphorylation of BCL2 (S70), MCL1 (T163), BAD (S112), and BAX (S184) underlies intrinsic and acquired resistance to venetoclax in lymphoid malignancies; phosphatase-activating drugs re-sensitized resistant cells and in vivo models, nominating phosphorylation state as a targetable resistance node (Nov 2023; J Clin Invest; https://doi.org/10.1172/jci170169) (chong2023hyperphosphorylationofbcl2 pages 14-16, chong2023hyperphosphorylationofbcl2 pages 18-19, chong2023hyperphosphorylationofbcl2 pages 1-2, chong2023hyperphosphorylationofbcl2 pages 19-20).
- Transmembrane (TM) interactome (2024): BCL2’s TM helix engages BOK’s TM helix at the ER, forming hetero-oligomeric complexes that specifically suppress BOK-mediated apoptosis—expanding the canonical BH3-groove-centric view and highlighting TM–TM interfaces as regulatory elements (Jul 2024; EMBO Reports; https://doi.org/10.1038/s44319-024-00206-6) (westaby2024bcl2expressionis pages 11-13).
- Disease context expansion (2024): In metastatic, AR-negative castration-resistant prostate cancer (mCRPC) with lineage plasticity features, BCL2 expression is enriched, linked to DNA methylation and the neuronal transcription factor ASCL1. Functional studies revealed partial sensitivity to BCL2 inhibition alone and enhanced apoptosis upon cotargeting multiple anti-apoptotic family members, underscoring redundancy and combination needs (Sep 2024; J Clin Invest; https://doi.org/10.1172/jci179998) (westaby2024bcl2expressionis pages 11-13).

6) Current applications and real-world implementations
- BH3 mimetic therapy: Venetoclax (ABT‑199) is the FDA-approved BH3 mimetic targeting BCL2. Reviews and translational analyses detail how BCL2 dependence can be profiled and how combinations with hypomethylating agents (HMAs) or low-dose cytarabine have reshaped AML therapy; in CLL, time-limited venetoclax plus anti‑CD20 antibodies is a standard chemo‑free regimen in many settings (mechanistic/clinical overview; 2023–2025) (glaviano2025apoptosistargetingbh3mimetics pages 1-2, cao2023mechanismsofaction pages 7-7, chong2023hyperphosphorylationofbcl2 pages 19-20).
- Safety and AE management: Recent clinical syntheses emphasize tumor lysis syndrome (TLS) risk, cytopenias (notably neutropenia), and infection risk with venetoclax-based regimens, with mitigation through dose ramp-up, TLS prophylaxis, and growth factor support; resistance is managed by combination strategies and sequence optimization (overviewed in 2023–2024 reviews cited above) (cao2023mechanismsofaction pages 7-7, chong2023hyperphosphorylationofbcl2 pages 19-20).

7) Expert opinions and authoritative analyses
- Family-to-therapy narrative: A 2025 consensus review by pioneers in the field integrates historical discovery, structural biology, and the clinical maturation of BH3 mimetics, reiterating BCL2’s anti-apoptotic role, BH3-in-groove mechanism, membrane anchoring via the TM helix, and therapeutic translation culminating in venetoclax (Apr 2025; Cell Death Differ; https://doi.org/10.1038/s41418-025-01481-z) (croce2025thebcl2protein pages 5-6).
- Mechanistic execution context: Conceptual frameworks from 2023 reviews define how pore-forming Bcl‑2 family members (BAX/BAK/BOK) drive MOM poration in apoptosis while anti-apoptotic members restrain these events, updating models of poration intermediates and regulation (2023; BioEssays; https://doi.org/10.1002/bies.202200221; 2023; Nat Rev Mol Cell Biol; https://doi.org/10.1038/s41580-022-00564-w) (cao2023mechanismsofaction pages 7-7).

8) Relevant statistics and data from recent studies (with URLs/dates)
- AML (R/R) meta-analysis of venetoclax combinations (2024): Across 7 studies, pooled complete remission (CR) 15.4%; composite CRc 35.7%; MRD‑CRc 39.4%; MLFS 10.3%. Notable adverse events: febrile neutropenia 39.6%, thrombocytopenia 28.4%, diarrhea 10.0%, hypokalemia 16.4%. Subgroup: venetoclax+azacitidine showed higher CR (31.3%) and CRc (62.7%) compared with other combinations (Oct 2024; BMC Cancer; https://doi.org/10.1186/s12885-024-13000-3) (mohan2024bclproteinand pages 2-4).
- Phosphorylation-mediated venetoclax resistance (2023): Functionally linked S70p‑BCL2, T163p‑MCL1, S112p‑BAD, S184p‑BAX to resistance; phosphatase activators (e.g., FTY720) decreased S70p‑BCL2 and restored venetoclax sensitivity in resistant lines, a mouse model, and paired patient samples (Nov 2023; J Clin Invest; https://doi.org/10.1172/jci170169) (chong2023hyperphosphorylationofbcl2 pages 14-16, chong2023hyperphosphorylationofbcl2 pages 18-19, chong2023hyperphosphorylationofbcl2 pages 1-2, chong2023hyperphosphorylationofbcl2 pages 19-20).
- Prostate cancer lineage plasticity (2024): BCL2 is enriched in AR‑negative/NE‑like mCRPC, associated with adverse outcomes; pharmacologic analyses suggest partial activity of BCL2 inhibitors and stronger effects with combined targeting of BCL2, MCL1, and BCL‑XL (Sep 2024; J Clin Invest; https://doi.org/10.1172/jci179998) (westaby2024bcl2expressionis pages 11-13).

9) Cellular localization, domains, and mechanistic specifics (precise statements)
- BH-domain architecture and groove: Anti-apoptotic BCL2 bears BH1–BH4; the groove composed of BH1‑3 receives BH3 helices. Structural pharmacology identifies pockets critical for peptide/small‑molecule binding (pathiranage2023antiapoptoticproteinsas pages 15-20).
- Membrane anchoring: A C‑terminal TM helix anchors BCL2 to the MOM/ER, positioning it to intercept BH3 signals and regulate MOMP at mitochondria and autophagy signaling at ER; newer data demonstrate TM–TM contacts modulating effector activity (BOK) at the ER (croce2025thebcl2protein pages 5-6, westaby2024bcl2expressionis pages 11-13).

10) Disease associations and translational relevance
- Hematologic malignancies: BCL2 overexpression and dependency are hallmarks of CLL and present in AML subsets, forming the basis for venetoclax-based regimens; resistance mechanisms include BCL2 mutations (e.g., G101V, previously) and the 2023-described hyperphosphorylation state that rewires dependencies (glaviano2025apoptosistargetingbh3mimetics pages 1-2, chong2023hyperphosphorylationofbcl2 pages 19-20).
- Solid tumors: Beyond hematology, the 2024 JCI study implicates BCL2 as a marker and potential vulnerability in lineage-plastic, AR‑independent mCRPC, but redundancy with MCL1/BCL‑XL often necessitates combinations (westaby2024bcl2expressionis pages 11-13).

Key citations (URLs, dates)
- BCL2 family discovery-to-therapy overview (anti-apoptotic mechanism, domains, membranes): Croce CM et al., Cell Death Differ. 2025-04; https://doi.org/10.1038/s41418-025-01481-z (croce2025thebcl2protein pages 5-6).
- Structural/biophysical basis of BH3-in-groove and inhibitor design (pockets P1–P4): Pathiranage AIV & Lawtrakul L, 2023; details on BH motif positions and groove architecture; (source includes UniProt P10415 reference) (pathiranage2023antiapoptoticproteinsas pages 15-20).
- Mechanistic execution by pore-formers and MOM poration context: Moldoveanu T, BioEssays, 2023-01; https://doi.org/10.1002/bies.202200221; and Vandenabeele P et al., Nat Rev Mol Cell Biol, 2023-12; https://doi.org/10.1038/s41580-022-00564-w (cao2023mechanismsofaction pages 7-7).
- Phosphorylation-driven venetoclax resistance and reversal: Chong SJF et al., J Clin Invest, 2023-11; https://doi.org/10.1172/jci170169 (chong2023hyperphosphorylationofbcl2 pages 14-16, chong2023hyperphosphorylationofbcl2 pages 18-19, chong2023hyperphosphorylationofbcl2 pages 1-2, chong2023hyperphosphorylationofbcl2 pages 19-20).
- TM domain interactions regulating apoptosis at ER: Beigl TB et al., EMBO Reports, 2024-07; https://doi.org/10.1038/s44319-024-00206-6 (westaby2024bcl2expressionis pages 11-13).
- Disease context—prostate cancer lineage plasticity with BCL2 enrichment: Westaby D et al., J Clin Invest, 2024-09; https://doi.org/10.1172/jci179998 (westaby2024bcl2expressionis pages 11-13).
- Clinical statistics—AML R/R meta-analysis of venetoclax combos (efficacy, safety): Jiao N et al., BMC Cancer, 2024-10; https://doi.org/10.1186/s12885-024-13000-3 (mohan2024bclproteinand pages 2-4).

Conclusion
Human BCL2 (UniProt P10415) is a membrane-anchored, anti-apoptotic protein whose BH1–BH4 domains form a BH3-binding groove to sequester pro-apoptotic ligands and prevent BAX/BAK-mediated MOMP at mitochondria. Recent work in 2023–2024 extends this canonical model by (i) defining phosphorylation-driven, functional venetoclax resistance that can be pharmacologically reversed, and (ii) uncovering TM-domain–mediated interactions (e.g., with BOK at the ER) that modulate apoptosis independently of the BH3 groove. Clinically, venetoclax-based regimens yield meaningful responses in AML and are standards in CLL; however, resistance, hematologic toxicities, and anti-apoptotic redundancy (notably in solid tumors such as lineage-plastic mCRPC) shape ongoing combination strategies and biomarker-guided patient selection (croce2025thebcl2protein pages 5-6, pathiranage2023antiapoptoticproteinsas pages 15-20, chong2023hyperphosphorylationofbcl2 pages 14-16, chong2023hyperphosphorylationofbcl2 pages 18-19, chong2023hyperphosphorylationofbcl2 pages 1-2, chong2023hyperphosphorylationofbcl2 pages 19-20, cao2023mechanismsofaction pages 7-7, westaby2024bcl2expressionis pages 11-13, mohan2024bclproteinand pages 2-4).

References

(croce2025thebcl2protein pages 5-6): Carlo M. Croce, David Vaux, Andreas Strasser, Joseph T. Opferman, Peter E. Czabotar, and Stephen W. Fesik. The bcl-2 protein family: from discovery to drug development. Cell Death and Differentiation, 32:1369-1381, Apr 2025. URL: https://doi.org/10.1038/s41418-025-01481-z, doi:10.1038/s41418-025-01481-z. This article has 20 citations and is from a domain leading peer-reviewed journal.
(pathiranage2023antiapoptoticproteinsas pages 15-20): AIV Pathiranage and L Lawtrakul. Antiapoptotic proteins as targets for bioactive compounds: structural parameters and molecular design. Unknown journal, 2023.
(chong2023hyperphosphorylationofbcl2 pages 14-16): Stephen Jun Fei Chong, Fen Zhu, Olga Dashevsky, Rin Mizuno, Jolin X.H. Lai, Liam Hackett, Christine E. Ryan, Mary C. Collins, J. Bryan Iorgulescu, Romain Guièze, Johany Penailillo, Ruben Carrasco, Yeonjoo C. Hwang, Denise P. Muñoz, Mehdi Bouhaddou, Yaw Chyn Lim, Catherine J. Wu, John N. Allan, Richard R. Furman, Boon Cher Goh, Shazib Pervaiz, Jean-Philippe Coppé, Constantine S. Mitsiades, and Matthew S. Davids. Hyperphosphorylation of bcl-2 family proteins underlies functional resistance to venetoclax in lymphoid malignancies. Journal of Clinical Investigation, Nov 2023. URL: https://doi.org/10.1172/jci170169, doi:10.1172/jci170169. This article has 38 citations and is from a highest quality peer-reviewed journal.
(chong2023hyperphosphorylationofbcl2 pages 18-19): Stephen Jun Fei Chong, Fen Zhu, Olga Dashevsky, Rin Mizuno, Jolin X.H. Lai, Liam Hackett, Christine E. Ryan, Mary C. Collins, J. Bryan Iorgulescu, Romain Guièze, Johany Penailillo, Ruben Carrasco, Yeonjoo C. Hwang, Denise P. Muñoz, Mehdi Bouhaddou, Yaw Chyn Lim, Catherine J. Wu, John N. Allan, Richard R. Furman, Boon Cher Goh, Shazib Pervaiz, Jean-Philippe Coppé, Constantine S. Mitsiades, and Matthew S. Davids. Hyperphosphorylation of bcl-2 family proteins underlies functional resistance to venetoclax in lymphoid malignancies. Journal of Clinical Investigation, Nov 2023. URL: https://doi.org/10.1172/jci170169, doi:10.1172/jci170169. This article has 38 citations and is from a highest quality peer-reviewed journal.
(chong2023hyperphosphorylationofbcl2 pages 1-2): Stephen Jun Fei Chong, Fen Zhu, Olga Dashevsky, Rin Mizuno, Jolin X.H. Lai, Liam Hackett, Christine E. Ryan, Mary C. Collins, J. Bryan Iorgulescu, Romain Guièze, Johany Penailillo, Ruben Carrasco, Yeonjoo C. Hwang, Denise P. Muñoz, Mehdi Bouhaddou, Yaw Chyn Lim, Catherine J. Wu, John N. Allan, Richard R. Furman, Boon Cher Goh, Shazib Pervaiz, Jean-Philippe Coppé, Constantine S. Mitsiades, and Matthew S. Davids. Hyperphosphorylation of bcl-2 family proteins underlies functional resistance to venetoclax in lymphoid malignancies. Journal of Clinical Investigation, Nov 2023. URL: https://doi.org/10.1172/jci170169, doi:10.1172/jci170169. This article has 38 citations and is from a highest quality peer-reviewed journal.
(chong2023hyperphosphorylationofbcl2 pages 19-20): Stephen Jun Fei Chong, Fen Zhu, Olga Dashevsky, Rin Mizuno, Jolin X.H. Lai, Liam Hackett, Christine E. Ryan, Mary C. Collins, J. Bryan Iorgulescu, Romain Guièze, Johany Penailillo, Ruben Carrasco, Yeonjoo C. Hwang, Denise P. Muñoz, Mehdi Bouhaddou, Yaw Chyn Lim, Catherine J. Wu, John N. Allan, Richard R. Furman, Boon Cher Goh, Shazib Pervaiz, Jean-Philippe Coppé, Constantine S. Mitsiades, and Matthew S. Davids. Hyperphosphorylation of bcl-2 family proteins underlies functional resistance to venetoclax in lymphoid malignancies. Journal of Clinical Investigation, Nov 2023. URL: https://doi.org/10.1172/jci170169, doi:10.1172/jci170169. This article has 38 citations and is from a highest quality peer-reviewed journal.
(westaby2024bcl2expressionis pages 11-13): Daniel Westaby, Juan M. Jiménez-Vacas, Ines Figueiredo, Jan Rekowski, Claire Pettinger, Bora Gurel, Arian Lundberg, Denisa Bogdan, Lorenzo Buroni, Antje Neeb, Ana Padilha, Joe Taylor, Wanting Zeng, Souvik Das, Emily Hobern, Ruth Riisnaes, Mateus Crespo, Susana Miranda, Ana Ferreira, Brian P. Hanratty, Daniel Nava Rodrigues, Claudia Bertan, George Seed, Maria de Los Dolores Fenor de La Maza, Christina Guo, Juliet Carmichael, Rafael Grochot, Khobe Chandran, Anastasia Stavridi, Andreas Varkaris, Nataly Stylianou, Brett G. Hollier, Nina Tunariu, Steven P. Balk, Suzanne Carreira, Wei Yuan, Peter S. Nelson, Eva Corey, Michael Haffner, Johann de Bono, and Adam Sharp. Bcl2 expression is enriched in advanced prostate cancer with features of lineage plasticity. The Journal of Clinical Investigation, Sep 2024. URL: https://doi.org/10.1172/jci179998, doi:10.1172/jci179998. This article has 20 citations.
(cao2023mechanismsofaction pages 7-7): Qiang Cao, Xinyan Wu, Qi Zhang, Junling Gong, Yuquan Chen, Yanwei You, Jun Shen, Yi Qiang, and Guangzhu Cao. Mechanisms of action of the bcl-2 inhibitor venetoclax in multiple myeloma: a literature review. Frontiers in Pharmacology, Nov 2023. URL: https://doi.org/10.3389/fphar.2023.1291920, doi:10.3389/fphar.2023.1291920. This article has 36 citations and is from a poor quality or predatory journal.
(glaviano2025apoptosistargetingbh3mimetics pages 1-2): Antonino Glaviano, Ellen Weisberg, Hiu Y. Lam, Donavan J. J. Tan, Andrew J. Innes, Yubin Ge, Catherine E. Lai, Wendy Stock, Christina Glytsou, Linda Smit, Tatsushi Yoshida, Tian Y. Zhang, Vanessa E. Kennedy, B. Douglas Smith, Thomas Mercher, Stéphane de Botton, Patrizia Diana, Marina Konopleva, Michael J. Mauro, James D. Griffin, Courtney D. DiNardo, and Alan P. Kumar. Apoptosis-targeting bh3 mimetics: transforming treatment for patients with acute myeloid leukaemia. Nature Reviews Clinical Oncology, 22:847-868, Sep 2025. URL: https://doi.org/10.1038/s41571-025-01068-0, doi:10.1038/s41571-025-01068-0. This article has 7 citations and is from a domain leading peer-reviewed journal.
(mohan2024bclproteinand pages 2-4): Lishaleni Mohan, Mohomed Faizal Umair Ahamed, Charles Arvind Sethuraman Vairavan, and Nagaraja Suryadevara. Bcl protein and it’s intrinsic apoptotic pathway: a literature review. Current Trends in Biotechnology and Pharmacy, 18:2071-2084, Nov 2024. URL: https://doi.org/10.5530/ctbp.2024.4.52, doi:10.5530/ctbp.2024.4.52. This article has 4 citations.

Citations

pathiranage2023antiapoptoticproteinsas pages 15-20
cao2023mechanismsofaction pages 7-7
mohan2024bclproteinand pages 2-4
https://doi.org/10.1172/jci170169
https://doi.org/10.1038/s44319-024-00206-6
https://doi.org/10.1172/jci179998
https://doi.org/10.1038/s41418-025-01481-z
https://doi.org/10.1002/bies.202200221;
https://doi.org/10.1038/s41580-022-00564-w
https://doi.org/10.1186/s12885-024-13000-3
https://doi.org/10.1038/s41418-025-01481-z,
https://doi.org/10.1172/jci170169,
https://doi.org/10.1172/jci179998,
https://doi.org/10.3389/fphar.2023.1291920,
https://doi.org/10.1038/s41571-025-01068-0,
https://doi.org/10.5530/ctbp.2024.4.52,

Bioreason Rl Review

(BCL2-bioreason-rl-review.md)

BioReason-Pro RL Review: BCL2 (human)

Source: BCL2-deep-research-bioreason-rl.md

Correctness: 5/5
Completeness: 4/5

Functional Summary Review

The BioReason functional summary states:

An anti-apoptotic regulator that assembles a BH4-BH1-3 modular scaffold to bind and neutralize pro-apoptotic factors at organelle membranes. It operates as a soluble cytoplasmic protein that dynamically associates with the outer surface of mitochondria and with the endoplasmic reticulum, where it prevents assembly of apoptosis-inducing complexes and preserves cell survival by restraining mitochondrial pathway activation.

This is an accurate and well-structured summary. The identification of BCL2 as an anti-apoptotic regulator with BH1-4 domains that sequesters pro-apoptotic BH3-only proteins and prevents BAX/BAK oligomerization is correct. The localization to mitochondrial outer membrane and ER membrane is supported by the curated review and experimental evidence. The curated review confirms BCL2's role in negative regulation of apoptotic process (GO:0043066), negative regulation of intrinsic apoptotic signaling pathway (GO:2001243), and localization to mitochondrial outer membrane (GO:0005741) and ER membrane (GO:0005789).

The description of "soluble cytoplasmic protein that dynamically associates" with membranes is slightly misleading -- BCL2 has a C-terminal transmembrane anchor and is constitutively membrane-associated, unlike BAX which translocates. However, this is a minor inaccuracy in the context of an otherwise strong summary.

The summary does not mention BCL2's roles in calcium homeostasis regulation at the ER, B cell activation, or its non-apoptotic functions in autophagy regulation, which the curated review covers extensively. These are secondary functions but represent a completeness gap.

Comparison with interpro2go:

The curated review references GO_REF:0000002 for interpro2go annotations. BioReason's reasoning directly parallels the interpro2go pipeline: BH domain signatures map to apoptosis regulator functions, and BioReason arrives at the same conclusions (protein binding, apoptotic process, membrane localization). BioReason adds mechanistic narrative about BAX/BAK sequestration but does not provide genuinely novel functional insight beyond what interpro2go establishes.

Notes on thinking trace

The trace systematically walks through BH4, BH3, BH1, and BH2 motifs and their roles in the anti-apoptotic scaffold. The reasoning about membrane association via the C-terminal hydrophobic tail is correct, though the trace describes it as "peripheral association" rather than the tail-anchor insertion that BCL2 actually uses.

📄 View Raw YAML

id: P10415
gene_symbol: BCL2
product_type: PROTEIN
status: COMPLETE
taxon:
  id: NCBITaxon:9606
  label: Homo sapiens
description: >
  BCL2 is a founding member of the Bcl-2 family of apoptosis regulators, functioning
  as an anti-apoptotic
  protein that prevents mitochondrial outer membrane permeabilization (MOMP). BCL2
  contains four Bcl-2
  homology (BH1-BH4) domains that form a hydrophobic groove capable of binding BH3
  domains from
  pro-apoptotic family members (BIM, BAD, PUMA, BID) and the effectors BAX/BAK. By
  sequestering
  BH3-only proteins and restraining BAX/BAK activation, BCL2 prevents cytochrome c
  release and
  subsequent caspase activation. BCL2 localizes primarily to the mitochondrial outer
  membrane via
  a C-terminal transmembrane helix, with additional localization to the endoplasmic
  reticulum membrane.
  At the ER, BCL2 also modulates calcium homeostasis and interacts with BECN1 to regulate
  autophagy,
  though this latter function represents regulatory crosstalk rather than its evolved
  core function.
existing_annotations:
# ============================================================================
# IBA ANNOTATIONS (Phylogenetically inferred)
# ============================================================================
  - term:
      id: GO:0043065
      label: positive regulation of apoptotic process
    evidence_type: IBA
    original_reference_id: GO_REF:0000033
    review:
      summary: >
        BCL2 is an anti-apoptotic protein that prevents apoptosis, not promotes it.
        This annotation
        appears to be incorrectly propagated. While BCL2 family member genes are involved
        in apoptosis
        regulation broadly, BCL2 itself is a well-established negative regulator of
        apoptosis.
      action: REMOVE
      reason: >
        BCL2 functions as an anti-apoptotic protein that prevents MOMP and cytochrome
        c release.
        Multiple studies demonstrate BCL2 inhibits apoptosis (PMID:9027314, PMID:9219694).
        The IBA
        annotation appears to be a family-level annotation that does not distinguish
        between
        pro-apoptotic and anti-apoptotic members. This is incorrect for BCL2 specifically.
      supported_by:
        - reference_id: file:human/BCL2/BCL2-deep-research-falcon.md
          supporting_text: 'model: Edison Scientific Literature'
  - term:
      id: GO:0097192
      label: extrinsic apoptotic signaling pathway in absence of ligand
    evidence_type: IBA
    original_reference_id: GO_REF:0000033
    review:
      summary: >
        BCL2 regulates the intrinsic (mitochondrial) apoptotic pathway, not the extrinsic
        pathway.
        While BCL2 can influence outcomes of extrinsic signaling through crosstalk
        at the
        mitochondrial level, its primary evolved function is in the intrinsic pathway.
      action: MODIFY
      reason: >
        BCL2 primarily functions in the intrinsic apoptotic pathway at the mitochondrial
        outer
        membrane. The deep research confirms BCL2 operates in the intrinsic pathway
        by opposing
        BAX/BAK-mediated MOMP (croce2025thebcl2protein). The extrinsic pathway annotation
        is
        less accurate for the core function.
      proposed_replacement_terms:
        - id: GO:2001243
          label: negative regulation of intrinsic apoptotic signaling pathway
  - term:
      id: GO:0005741
      label: mitochondrial outer membrane
    evidence_type: IBA
    original_reference_id: GO_REF:0000033
    review:
      summary: >
        BCL2 localizes to the mitochondrial outer membrane via its C-terminal transmembrane
        helix.
        This is a well-established localization critical for its anti-apoptotic function.
      action: ACCEPT
      reason: >
        Multiple experimental studies confirm BCL2 localization to the OMM (PMID:9027314,
        PMID:21358617, PMID:2250705). UniProt annotation confirms this localization
        with
        experimental evidence. The IBA annotation is phylogenetically sound.
      supported_by:
        - reference_id: PMID:9027314
          supporting_text: "Bcl-2 is an integral membrane protein located mainly on
            the outer membrane of mitochondria."
  - term:
      id: GO:0008630
      label: intrinsic apoptotic signaling pathway in response to DNA damage
    evidence_type: IBA
    original_reference_id: GO_REF:0000033
    review:
      summary: >
        BCL2 negatively regulates the intrinsic apoptotic pathway, including in response
        to DNA
        damage. This is part of its core function as an anti-apoptotic regulator.
      action: MODIFY
      reason: >
        The annotation correctly captures BCL2's involvement in intrinsic apoptotic
        signaling
        in response to DNA damage, but BCL2 is a negative regulator rather than just
        a
        participant. A more specific term would better capture its function.
      proposed_replacement_terms:
        - id: GO:1902166
          label: negative regulation of intrinsic apoptotic signaling pathway in
            response to DNA damage by p53 class mediator
  - term:
      id: GO:0015267
      label: channel activity
    evidence_type: IBA
    original_reference_id: GO_REF:0000033
    review:
      summary: >
        Early studies showed BCL2 can form ion channels in artificial membranes at
        acidic pH,
        though the physiological relevance remains debated. More importantly, BCL2
        inhibits
        BAX channel-forming activity, which is its functional role.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        While PMID:9219694 showed BCL2 can form channels at acidic pH in artificial
        membranes,
        the same study emphasized BCL2's role in inhibiting BAX channel activity at
        physiological
        pH. The channel activity of BCL2 itself is not considered its primary functional
        role;
        rather its inhibition of BAX/BAK pore formation is the core function.
  - term:
      id: GO:0001836
      label: release of cytochrome c from mitochondria
    evidence_type: IBA
    original_reference_id: GO_REF:0000033
    review:
      summary: >
        BCL2 prevents cytochrome c release from mitochondria, which is a core mechanism
        of its
        anti-apoptotic function. However, the annotation should be more specific about
        the
        negative regulatory role.
      action: MODIFY
      reason: >
        PMID:9027314 definitively shows "Overexpression of Bcl-2 prevented the efflux
        of
        cytochrome c from the mitochondria." BCL2 negatively regulates this process,
        not
        positively. The term GO:0090201 (negative regulation of release of cytochrome
        c
        from mitochondria) would be more appropriate.
      proposed_replacement_terms:
        - id: GO:0090201
          label: negative regulation of release of cytochrome c from 
            mitochondria
      supported_by:
        - reference_id: PMID:9027314
          supporting_text: "Overexpression of Bcl-2 prevented the efflux of cytochrome
            c from the mitochondria and the initiation of apoptosis."

# ============================================================================
# IEA ANNOTATIONS (Electronically inferred)
# ============================================================================
  - term:
      id: GO:0055085
      label: transmembrane transport
    evidence_type: IEA
    original_reference_id: GO_REF:0000108
    review:
      summary: >
        BCL2 is a membrane protein but is not itself a transporter. While it may influence
        membrane permeability through its interactions with BAX/BAK, transmembrane
        transport
        is not its primary function.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        BCL2 functions by binding BH3-only proteins and preventing BAX/BAK oligomerization,
        rather than directly transporting molecules. The IEA inference from structural
        features is overly broad.
  - term:
      id: GO:0005737
      label: cytoplasm
    evidence_type: IEA
    original_reference_id: GO_REF:0000120
    review:
      summary: >
        BCL2 is found in the cytoplasm, though primarily membrane-associated at the
        OMM and
        ER. This is a broad but acceptable localization term.
      action: ACCEPT
      reason: >
        BCL2 is present in the cytoplasm, particularly associated with intracellular
        membranes.
        Multiple studies confirm cytoplasmic distribution (PMID:7546744, PMID:11530860).
  - term:
      id: GO:0005741
      label: mitochondrial outer membrane
    evidence_type: IEA
    original_reference_id: GO_REF:0000044
    review:
      summary: >
        BCL2 localizes to the mitochondrial outer membrane. This IEA annotation is
        consistent
        with experimental evidence and the IBA annotation above.
      action: ACCEPT
      reason: >
        Well-supported by experimental evidence (PMID:9027314, PMID:2250705, PMID:21358617).
        UniProt subcellular location annotation confirms this with multiple PubMed
        references.
  - term:
      id: GO:0005789
      label: endoplasmic reticulum membrane
    evidence_type: IEA
    original_reference_id: GO_REF:0000120
    review:
      summary: >
        BCL2 also localizes to the ER membrane where it interacts with BECN1 and IP3
        receptors,
        modulating autophagy and calcium homeostasis.
      action: ACCEPT
      reason: >
        PMID:21358617 demonstrates BCL2 localization at the ER membrane and interactions
        with
        AMBRA1 and BECN1 at this location. UniProt confirms ER localization with experimental
        evidence.
      supported_by:
        - reference_id: PMID:21358617
          supporting_text: "AMBRA1 can compete with both mitochondrial and endoplasmic
            reticulum-resident BCL-2 (mito-BCL-2 and ER-BCL-2, respectively)"
  - term:
      id: GO:0006914
      label: autophagy
    evidence_type: IEA
    original_reference_id: GO_REF:0000043
    review:
      summary: >
        BCL2 interacts with BECN1 and can modulate autophagy, but this represents
        regulatory
        crosstalk between apoptosis and autophagy pathways rather than an evolved
        autophagy
        function. BCL2's primary evolved role is in apoptosis regulation.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        The BCL2-BECN1 interaction represents crosstalk between cell death pathways.
        Deep
        research notes "AMPK-dependent phosphorylation can dissociate BCL2-Beclin-1
        complexes,
        linking metabolic signaling to BCL2's autophagy and apoptosis functions" but
        emphasizes
        apoptosis as the primary function. This annotation should not be considered
        a core
        function of BCL2.
  - term:
      id: GO:0006915
      label: apoptotic process
    evidence_type: IEA
    original_reference_id: GO_REF:0000120
    review:
      summary: >
        BCL2 is involved in the apoptotic process as a key negative regulator. This
        general
        term is acceptable though less informative than more specific terms.
      action: ACCEPT
      reason: >
        BCL2 is definitively involved in the apoptotic process. Multiple experimental
        studies
        confirm this (PMID:9027314, PMID:9219694). The term is broad but accurate.
  - term:
      id: GO:0016020
      label: membrane
    evidence_type: IEA
    original_reference_id: GO_REF:0000120
    review:
      summary: >
        BCL2 is a membrane protein with a C-terminal transmembrane anchor. This is
        a very
        general term but accurate.
      action: ACCEPT
      reason: >
        BCL2 is an integral membrane protein. More specific membrane terms (OMM, ER
        membrane)
        are more informative, but this general term is not incorrect.
  - term:
      id: GO:0031965
      label: nuclear membrane
    evidence_type: IEA
    original_reference_id: GO_REF:0000120
    review:
      summary: >
        BCL2 has been detected at the nuclear envelope, though this is not considered
        its
        primary site of action.
      action: KEEP_AS_NON_CORE
      reason: >
        PMID:2250705 and PMID:8402648 report BCL2 localization to the nuclear membrane.
        UniProt confirms this localization. While not the primary site of function,
        it
        is a validated localization.
  - term:
      id: GO:0042981
      label: regulation of apoptotic process
    evidence_type: IEA
    original_reference_id: GO_REF:0000002
    review:
      summary: >
        BCL2 regulates the apoptotic process. This is a core function, though the
        term is
        general and does not specify negative regulation.
      action: MODIFY
      reason: >
        BCL2 specifically negatively regulates apoptosis. The more specific term GO:0043066
        (negative regulation of apoptotic process) would be more appropriate and informative.
      proposed_replacement_terms:
        - id: GO:0043066
          label: negative regulation of apoptotic process
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IEA
    original_reference_id: GO_REF:0000120
    review:
      summary: >
        BCL2 negatively regulates apoptosis. This is a core function annotation that
        accurately describes BCL2's primary biological role.
      action: ACCEPT
      reason: >
        This is BCL2's core evolved function. Multiple experimental studies demonstrate
        BCL2 prevents apoptosis (PMID:9027314, PMID:1373874, PMID:7650367, PMID:7772249).
  - term:
      id: GO:0097136
      label: Bcl-2 family protein complex
    evidence_type: IEA
    original_reference_id: GO_REF:0000117
    review:
      summary: >
        BCL2 forms complexes with other Bcl-2 family members including homodimers
        and
        heterodimers with BAX, BAD, BAK, and BCL-XL.
      action: ACCEPT
      reason: >
        PMID:9111042 demonstrates BCL2 forms homodimers and heterodimers with other
        family
        members through the BH3-binding groove. This is well-established.
      supported_by:
        - reference_id: PMID:9111042
          supporting_text: "Bcl-2 forms protein-protein homodimers with itself and
            heterodimers with Bax"
  - term:
      id: GO:1902531
      label: regulation of intracellular signal transduction
    evidence_type: IEA
    original_reference_id: GO_REF:0000117
    review:
      summary: >
        BCL2 modulates intracellular signaling primarily through its role in the apoptotic
        signaling pathway. This is a very broad term.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        While technically true that BCL2 influences intracellular signaling, this
        term is
        too broad and does not capture the specific apoptotic signaling function.
        More
        specific apoptotic pathway terms are more informative.
  - term:
      id: GO:2001233
      label: regulation of apoptotic signaling pathway
    evidence_type: IEA
    original_reference_id: GO_REF:0000117
    review:
      summary: >
        BCL2 regulates apoptotic signaling. This is accurate but could be more specific
        as negative regulation.
      action: ACCEPT
      reason: >
        BCL2 is a key regulator of apoptotic signaling pathways. This term captures
        its
        function appropriately at a pathway level.

# ============================================================================
# IPI ANNOTATIONS (Protein binding - multiple entries)
# ============================================================================
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:12624108
    review:
      summary: >
        Generic protein binding is not informative for BCL2's specific molecular function.
        BCL2 binds BH3-domain containing proteins through its hydrophobic groove.
      action: MODIFY
      reason: >
        BCL2's protein binding is specifically through BH3 domain interactions. The
        term
        GO:0051434 (BH3 domain binding) would be more informative and accurate.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:12624108
          supporting_text: 2003 Mar 6. Inhibition of Bid-induced apoptosis by 
            Bcl-2.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:12667443
    review:
      summary: >
        Generic protein binding annotation based on BCL2-p53 interaction study.
      action: MODIFY
      reason: >
        More specific MF term should be used. BCL2 binds proteins through BH3 domain
        interactions primarily.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:12667443
          supporting_text: p53 has a direct apoptogenic role at the 
            mitochondria.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:14739602
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: BCL2 protein binding is primarily through BH3 domain interactions.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:14739602
          supporting_text: The Siva-1 putative amphipathic helical region (SAH) 
            is sufficient to bind to BCL-XL and sensitize cells to UV radiation 
            induced apoptosis.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:15225643
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: BCL2 protein binding is primarily through BH3 domain interactions.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:15225643
          supporting_text: The phosphorylation status and anti-apoptotic 
            activity of Bcl-2 are regulated by ERK and protein phosphatase 2A on
            the mitochondria.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:15694340
    review:
      summary: >
        This study on BH3-only protein binding to BCL2 family members directly supports
        BH3 domain binding as the specific function.
      action: MODIFY
      reason: >
        The reference specifically studies BH3 ligand binding to pro-survival BCL2
        proteins.
        GO:0051434 (BH3 domain binding) is the appropriate specific term.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:15694340
          supporting_text: Differential targeting of prosurvival Bcl-2 proteins 
            by their BH3-only ligands allows complementary apoptotic function.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:15733859
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: More specific MF term available.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:15733859
          supporting_text: The flexible loop of Bcl-2 is required for molecular 
            interaction with immunosuppressant FK-506 binding protein 38 
            (FKBP38).
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:16697956
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: BCL2 protein binding is primarily through BH3 domain interactions.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:16697956
          supporting_text: Mitochondria primed by death signals determine 
            cellular addiction to antiapoptotic BCL-2 family members.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:17074758
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: BCL2 protein binding is primarily through BH3 domain interactions.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:17074758
          supporting_text: 2006 Oct 30. The vaccinia virus protein F1L interacts
            with Bim and inhibits activation of the pro-apoptotic protein Bax.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:17289999
    review:
      summary: >
        Study on BH3 ligands engaging BCL2 homologs - directly demonstrates BH3 domain
        binding function.
      action: MODIFY
      reason: >
        The study title "Apoptosis initiated when BH3 ligands engage multiple Bcl-2
        homologs" directly supports BH3 domain binding annotation.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:17289999
          supporting_text: Apoptosis initiated when BH3 ligands engage multiple 
            Bcl-2 homologs, not Bax or Bak.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:17418785
    review:
      summary: >
        Study on BCL2 interaction with NLRP1 inflammasome component. This is a specific
        interaction through the loop between BH4 and BH3 domains.
      action: ACCEPT
      reason: >
        This specific interaction with NLRP1 is documented but represents a specialized
        protein binding function distinct from BH3 binding. Accept as documented
        interaction evidence.
      supported_by:
        - reference_id: PMID:17418785
          supporting_text: Bcl-2 and Bcl-XL regulate proinflammatory caspase-1 
            activation by interaction with NALP1.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:17446862
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: More specific MF term available for BCL2.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:17446862
          supporting_text: Apr 19. Functional and physical interaction between 
            Bcl-X(L) and a BH3-like domain in Beclin-1.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:17525735
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: BCL2 protein binding is primarily through BH3 domain interactions.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:17525735
          supporting_text: May 24. ERK1/2-dependent phosphorylation of BimEL 
            promotes its rapid dissociation from Mcl-1 and Bcl-xL.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:17692808
    review:
      summary: Generic protein binding annotation from BH3 profiling study.
      action: MODIFY
      reason: BH3 profiling study directly supports BH3 domain binding 
        annotation.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:17692808
          supporting_text: BH3 profiling identifies three distinct classes of 
            apoptotic blocks to predict response to ABT-737 and conventional 
            chemotherapeutic agents.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:18719108
    review:
      summary: >
        Study on BCL2-ASPP2 interaction. ASPP2 contains a BH3-like domain.
      action: MODIFY
      reason: BCL2 protein binding through BH3 domain interactions.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:18719108
          supporting_text: Molecular basis of the interaction between the 
            antiapoptotic Bcl-2 family proteins and the proapoptotic protein 
            ASPP2.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:18835031
    review:
      summary: >
        Study on Nur77-derived peptide binding to BCL2 and converting it from protector
        to killer.
      action: ACCEPT
      reason: >
        This specific interaction with Nur77-derived peptide is a documented protein
        binding interaction. The mechanism is distinct from typical BH3 binding.
      supported_by:
        - reference_id: PMID:18835031
          supporting_text: A short Nur77-derived peptide converts Bcl-2 from a 
            protector to a killer.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:18981409
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: BCL2 protein binding is primarily through BH3 domain interactions.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:18981409
          supporting_text: Apoptosis is triggered when prosurvival Bcl-2 
            proteins cannot restrain Bax.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:19050071
    review:
      summary: Study on BECN1-BCL2 interaction in autophagy regulation.
      action: ACCEPT
      reason: BCL2-BECN1 interaction is well-documented, though represents 
        autophagy crosstalk.
      supported_by:
        - reference_id: PMID:19050071
          supporting_text: Identification of Barkor as a mammalian 
            autophagy-specific factor for Beclin 1 and class III 
            phosphatidylinositol 3-kinase.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:19074266
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: BCL2 protein binding is primarily through BH3 domain interactions.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:19074266
          supporting_text: Mechanism of apoptosis induction by inhibition of the
            anti-apoptotic BCL-2 proteins.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:19180116
    review:
      summary: Study on BCL2-BECN1 interaction regulated by DAP-kinase 
        phosphorylation.
      action: ACCEPT
      reason: Specific protein interaction documented.
      supported_by:
        - reference_id: PMID:19180116
          supporting_text: DAP-kinase-mediated phosphorylation on the BH3 domain
            of beclin 1 promotes dissociation of beclin 1 from Bcl-XL and 
            induction of autophagy.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:19223583
    review:
      summary: Study on BCL2 inhibition of NLRP1 inflammasome.
      action: ACCEPT
      reason: Specific protein interaction with inflammasome component 
        documented.
      supported_by:
        - reference_id: PMID:19223583
          supporting_text: 'Mechanism of Bcl-2 and Bcl-X(L) inhibition of NLRP1 inflammasome:
            loop domain-dependent suppression of ATP binding and oligomerization.'
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:19521340
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: More specific MF term available.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:19521340
          supporting_text: MDM4 (MDMX) localizes at the mitochondria and 
            facilitates the p53-mediated intrinsic-apoptotic pathway.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:19706527
    review:
      summary: >
        Study on BH4 domain of BCL2 binding IP3 receptor to inhibit ER calcium release.
      action: ACCEPT
      reason: >
        This documents a specific protein interaction through the BH4 domain with
        IP3
        receptor, distinct from BH3-groove binding.
      supported_by:
        - reference_id: PMID:19706527
          supporting_text: The BH4 domain of Bcl-2 inhibits ER calcium release 
            and apoptosis by binding the regulatory and coupling domain of the 
            IP3 receptor.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:19959994
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: More specific MF term available.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:19959994
          supporting_text: The IKK complex contributes to the induction of 
            autophagy.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:20010695
    review:
      summary: Study on BCL2-BECN1 interaction requiring NAF-1 at ER.
      action: ACCEPT
      reason: Specific protein interaction documented.
      supported_by:
        - reference_id: PMID:20010695
          supporting_text: Antagonism of Beclin 1-dependent autophagy by BCL-2 
            at the endoplasmic reticulum requires NAF-1.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:21139567
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: More specific MF term available.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:21139567
          supporting_text: MCL-1 is a stress sensor that regulates autophagy in 
            a developmentally regulated manner.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:21199865
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: BCL2 protein binding is primarily through BH3 domain interactions.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:21199865
          supporting_text: 2011 Jan 3. Mutation to Bax beyond the BH3 domain 
            disrupts interactions with pro-survival proteins and promotes 
            apoptosis.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:21358617
    review:
      summary: >
        Study demonstrating BCL2 binding to AMBRA1 and BECN1 at mitochondria and ER.
      action: ACCEPT
      reason: >
        PMID:21358617 documents specific interactions: "AMBRA1 binds preferentially
        the
        mitochondrial pool of the antiapoptotic factor BCL-2".
      supported_by:
        - reference_id: PMID:21358617
          supporting_text: "AMBRA1 binds preferentially the mitochondrial pool of
            the antiapoptotic factor BCL-2, and that this interaction is disrupted
            following autophagy induction"
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:21454712
    review:
      summary: Generic protein binding - NOXA/BCL2 interactions.
      action: MODIFY
      reason: BCL2 protein binding through BH3 domain interactions with BH3-only
        proteins.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:21454712
          supporting_text: 2011 Mar 22. Noxa/Bcl-2 protein interactions 
            contribute to bortezomib resistance in human lymphoid cells.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:21458670
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: BCL2 protein binding is primarily through BH3 domain interactions.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:21458670
          supporting_text: Bcl-x(L) retrotranslocates Bax from the mitochondria 
            into the cytosol.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:21671007
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: More specific MF term available.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:21671007
          supporting_text: Role of Bim in apoptosis induced in H460 lung tumor 
            cells by the spindle poison Combretastatin-A4.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:23541952
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: More specific MF term available.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:23541952
          supporting_text: 2013 Mar 28. Control of autophagic cell death by 
            caspase-10 in multiple myeloma.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:23845444
    review:
      summary: Study on ABT-199 (venetoclax) targeting BCL2 in breast cancer.
      action: MODIFY
      reason: BCL2 binding through BH3 groove, which is targeted by BH3 
        mimetics.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:23845444
          supporting_text: Targeting BCL-2 with the BH3 mimetic ABT-199 in 
            estrogen receptor-positive breast cancer.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:23954414
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: More specific MF term available.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:23954414
          supporting_text: Aug 15. Beclin 2 functions in autophagy, degradation 
            of G protein-coupled receptors, and metabolism.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:24034250
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: More specific MF term available.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:24034250
          supporting_text: EGFR-mediated Beclin 1 phosphorylation in autophagy 
            suppression, tumor progression, and tumor chemoresistance.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:24472739
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: More specific MF term available.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:24472739
          supporting_text: Jan 26. Decorin activates AMPK, an energy sensor 
            kinase, to induce autophagy in endothelial cells.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:26004684
    review:
      summary: Study on small molecule BH4 antagonist for BCL2.
      action: ACCEPT
      reason: Documents protein binding through BH4 domain, a distinct 
        interaction mode.
      supported_by:
        - reference_id: PMID:26004684
          supporting_text: 2015 May 21. Small-Molecule Bcl2 BH4 Antagonist for 
            Lung Cancer Therapy.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:26431330
    review:
      summary: Generic protein binding - PUMA/BCL2 interaction.
      action: MODIFY
      reason: PUMA is a BH3-only protein, supporting BH3 domain binding 
        annotation.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:26431330
          supporting_text: Subcellular localization of PUMA regulates its 
            pro-apoptotic activity in Burkitt's lymphoma B cells.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:29749471
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: More specific MF term available.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:29749471
          supporting_text: May 11. GSK3β‑mediated Ser156 phosphorylation 
            modulates a BH3‑like domain in BCL2L12 during TMZ‑induced apoptosis 
            and autophagy in glioma cells.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:29849149
    review:
      summary: Study on BCL2-BECN1 interaction in autophagy and longevity.
      action: ACCEPT
      reason: Specific protein interaction documented.
      supported_by:
        - reference_id: PMID:29849149
          supporting_text: May 30. Disruption of the beclin 1-BCL2 autophagy 
            regulatory complex promotes longevity in mice.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:32296183
    review:
      summary: High-throughput interactome mapping study.
      action: ACCEPT
      reason: High-throughput study documenting protein-protein interactions.
      supported_by:
        - reference_id: PMID:32296183
          supporting_text: Apr 8. A reference map of the human binary protein 
            interactome.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:32814053
    review:
      summary: Interactome mapping in neurodegeneration context.
      action: ACCEPT
      reason: Protein interaction study.
      supported_by:
        - reference_id: PMID:32814053
          supporting_text: Interactome Mapping Provides a Network of 
            Neurodegenerative Disease Proteins and Uncovers Widespread Protein 
            Aggregation in Affected Brains.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:33961781
    review:
      summary: Proteome-scale network study.
      action: ACCEPT
      reason: High-throughput protein interaction study.
      supported_by:
        - reference_id: PMID:33961781
          supporting_text: 2021 May 6. Dual proteome-scale networks reveal 
            cell-specific remodeling of the human interactome.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:9334338
    review:
      summary: Study on BAP31 interaction with BCL2/BCL-XL.
      action: ACCEPT
      reason: Specific protein interaction documented at ER.
      supported_by:
        - reference_id: PMID:9334338
          supporting_text: p28 Bap31, a Bcl-2/Bcl-XL- and 
            procaspase-8-associated protein in the endoplasmic reticulum.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:9388232
    review:
      summary: >
        Study on BAD dimerization properties and BH3 domain binding to BCL2.
      action: MODIFY
      reason: >
        This study directly characterizes BH3 domain binding: "Identification of a
        BH-3
        domain and analysis of its binding to mutant BCL-2 and BCL-XL proteins."
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:9388232
          supporting_text: Dimerization properties of human BAD.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:9463381
    review:
      summary: >
        Study on BH4 domain required for CED-4 interaction and anti-apoptotic activity.
      action: ACCEPT
      reason: Documents specific protein interaction through BH4 domain.
      supported_by:
        - reference_id: PMID:9463381
          supporting_text: The conserved N-terminal BH4 domain of Bcl-2 
            homologues is essential for inhibition of apoptosis and interaction 
            with CED-4.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:9973195
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: More specific MF term available.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding

# ============================================================================
# IDENTICAL PROTEIN BINDING ANNOTATIONS
# ============================================================================
      supported_by:
        - reference_id: PMID:9973195
          supporting_text: 'BNIP3alpha: a human homolog of mitochondrial proapoptotic
            protein BNIP3.'
  - term:
      id: GO:0042802
      label: identical protein binding
    evidence_type: IPI
    original_reference_id: PMID:18835031
    review:
      summary: BCL2 forms homodimers through the BH3-binding groove.
      action: ACCEPT
      reason: >
        PMID:9111042 demonstrates BCL2 homodimerization through the same binding site
        used for heterodimerization. BCL2 homodimers are well-documented.
      supported_by:
        - reference_id: PMID:18835031
          supporting_text: A short Nur77-derived peptide converts Bcl-2 from a 
            protector to a killer.
  - term:
      id: GO:0042802
      label: identical protein binding
    evidence_type: IPI
    original_reference_id: PMID:9463381
    review:
      summary: BCL2 homodimerization documented.
      action: ACCEPT
      reason: BCL2 homodimerization is well-established through BH domain 
        interactions.

# ============================================================================
# ADDITIONAL IEA ANNOTATIONS
# ============================================================================
      supported_by:
        - reference_id: PMID:9463381
          supporting_text: The conserved N-terminal BH4 domain of Bcl-2 
            homologues is essential for inhibition of apoptosis and interaction 
            with CED-4.
  - term:
      id: GO:0001836
      label: release of cytochrome c from mitochondria
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: >
        BCL2 prevents cytochrome c release; it does not promote it. This annotation
        should be modified to reflect negative regulation.
      action: MODIFY
      reason: >
        BCL2 blocks cytochrome c release (PMID:9027314). The appropriate term is
        GO:0090201 (negative regulation of release of cytochrome c from mitochondria).
      proposed_replacement_terms:
        - id: GO:0090201
          label: negative regulation of release of cytochrome c from 
            mitochondria
  - term:
      id: GO:0005634
      label: nucleus
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: >
        BCL2 has been detected in the nucleus in some studies, though this is not
        its primary localization.
      action: KEEP_AS_NON_CORE
      reason: >
        Some studies report nuclear localization (PMID:7546744, PMID:7896880), though
        the primary localization is at OMM and ER membranes.
  - term:
      id: GO:0005739
      label: mitochondrion
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: BCL2 localizes to mitochondria, specifically the outer membrane.
      action: ACCEPT
      reason: Well-established localization supported by multiple experimental 
        studies.
  - term:
      id: GO:0005783
      label: endoplasmic reticulum
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: BCL2 localizes to the ER, specifically the ER membrane.
      action: ACCEPT
      reason: Supported by experimental evidence (PMID:21358617, PMID:8402648).
  - term:
      id: GO:0005829
      label: cytosol
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: >
        BCL2 is primarily membrane-associated and not typically found as a soluble
        cytosolic protein.
      action: REMOVE
      reason: >
        BCL2 is an integral membrane protein with a C-terminal transmembrane anchor.
        It localizes to OMM, ER membrane, and nuclear envelope, not the cytosol as
        a soluble protein.
  - term:
      id: GO:0008284
      label: positive regulation of cell population proliferation
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: >
        BCL2's primary function is preventing apoptosis, which can secondarily
        allow cell survival and proliferation, but this is not its evolved function.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        BCL2 promotes cell survival by preventing apoptosis, which may allow
        proliferation as a downstream effect. This is not a direct function of BCL2
        and represents over-annotation of pleiotropic effects.
  - term:
      id: GO:0010506
      label: regulation of autophagy
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: >
        BCL2 interacts with BECN1 and can modulate autophagy, but this represents
        crosstalk between apoptosis and autophagy pathways.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        The BCL2-BECN1 interaction is regulatory crosstalk, not BCL2's evolved
        autophagy function. BCL2's primary evolved role is in apoptosis regulation.
  - term:
      id: GO:0010507
      label: negative regulation of autophagy
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: >
        BCL2 can negatively regulate autophagy through BECN1 binding, but this
        is crosstalk rather than core function.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        While BCL2 can inhibit autophagy by sequestering BECN1, this represents
        regulatory crosstalk between cell death pathways. The evolved function of
        BCL2 is apoptosis regulation.
  - term:
      id: GO:0019903
      label: protein phosphatase binding
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: >
        BCL2 interacts with protein phosphatases including PP2A, which regulates
        BCL2 phosphorylation status.
      action: KEEP_AS_NON_CORE
      reason: >
        BCL2 is regulated by phosphorylation/dephosphorylation at Ser-70.
        Interaction with phosphatases is documented but is regulatory, not a
        core molecular function.
  - term:
      id: GO:0031069
      label: hair follicle morphogenesis
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: >
        BCL2 may play a role in hair follicle development through its anti-apoptotic
        function, but this is a tissue-specific developmental outcome.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        This represents a pleiotropic developmental effect rather than BCL2's core
        molecular function. BCL2 knockout mice have defects in various tissues, but
        these are downstream consequences of lost anti-apoptotic activity.
  - term:
      id: GO:0031966
      label: mitochondrial membrane
    evidence_type: IEA
    original_reference_id: GO_REF:0000120
    review:
      summary: BCL2 localizes to the mitochondrial membrane, specifically the 
        outer membrane.
      action: ACCEPT
      reason: Supported by experimental evidence. More specific term (OMM) is 
        preferred but this is accurate.
  - term:
      id: GO:0043209
      label: myelin sheath
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: >
        BCL2 may be present in myelin sheath through its localization at membranes
        in neural cells, but this is not a core localization.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        This appears to be a tissue-specific localization observation rather than
        a core cellular localization of BCL2.
  - term:
      id: GO:0043473
      label: pigmentation
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: >
        BCL2 is regulated by MITF and plays a role in melanocyte survival, affecting
        pigmentation as a downstream consequence.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        BCL2's role in pigmentation is through its anti-apoptotic function in
        melanocyte survival. This is a pleiotropic downstream effect, not a
        direct function.
  - term:
      id: GO:0045069
      label: regulation of viral genome replication
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: >
        BCL2 has been implicated in viral infection contexts, but regulating viral
        replication is not its evolved function.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        BCL2's involvement in viral contexts is typically related to the virus
        exploiting or counteracting host apoptosis machinery. This is not an
        evolved function of BCL2.
  - term:
      id: GO:0046902
      label: regulation of mitochondrial membrane permeability
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: >
        BCL2 regulates mitochondrial membrane permeability by preventing MOMP.
        This is a core function.
      action: ACCEPT
      reason: >
        This accurately describes BCL2's core function in preventing MOMP and
        maintaining mitochondrial membrane integrity.
  - term:
      id: GO:0051721
      label: protein phosphatase 2A binding
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: BCL2 interacts with PP2A which regulates its phosphorylation 
        status.
      action: KEEP_AS_NON_CORE
      reason: >
        PP2A regulates BCL2 phosphorylation at Ser-70. This is a regulatory
        interaction, not a core molecular function of BCL2.
  - term:
      id: GO:0051881
      label: regulation of mitochondrial membrane potential
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: >
        BCL2 helps maintain mitochondrial membrane potential by preventing MOMP.
      action: ACCEPT
      reason: >
        By preventing MOMP, BCL2 helps maintain mitochondrial membrane potential.
        This is related to its core anti-apoptotic function.
  - term:
      id: GO:0060090
      label: molecular adaptor activity
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: >
        BCL2 has been described as having adaptor activity through its multiple
        protein interaction domains (BH1-4, TM).
      action: KEEP_AS_NON_CORE
      reason: >
        BCL2 can function as an adaptor/scaffold through its multiple interaction
        domains. PMID:26858413 provides experimental support, though this is
        secondary to its anti-apoptotic function.

# ============================================================================
# EXPERIMENTAL ANNOTATIONS (IDA, IMP, IGI, etc.)
# ============================================================================
  - term:
      id: GO:0005739
      label: mitochondrion
    evidence_type: IDA
    original_reference_id: GO_REF:0000052
    review:
      summary: BCL2 localizes to mitochondria based on immunofluorescence data.
      action: ACCEPT
      reason: Well-supported localization based on direct experimental 
        observation.
  - term:
      id: GO:0043065
      label: positive regulation of apoptotic process
    evidence_type: NAS
    original_reference_id: PMID:14634621
    review:
      summary: >
        This annotation appears to be an error. BCL2 is a well-established negative
        regulator of apoptosis, not positive.
      action: REMOVE
      reason: >
        BCL2 is definitively anti-apoptotic. This annotation contradicts the
        established function and should be removed. The review article cited
        discusses BCL2's protective role.
      supported_by:
        - reference_id: PMID:14634621
          supporting_text: 'The Bcl-2 family: roles in cell survival and oncogenesis.'
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IDA
    original_reference_id: PMID:9027314
    review:
      summary: >
        BCL2 prevents apoptosis by blocking cytochrome c release. This is a core
        function with strong experimental support.
      action: ACCEPT
      reason: >
        PMID:9027314 provides direct evidence that BCL2 blocks cytochrome c release
        and prevents apoptosis initiation.
      supported_by:
        - reference_id: PMID:9027314
          supporting_text: "Overexpression of Bcl-2 prevented the efflux of cytochrome
            c from the mitochondria and the initiation of apoptosis."
  - term:
      id: GO:0005739
      label: mitochondrion
    evidence_type: HTP
    original_reference_id: PMID:34800366
    review:
      summary: Mitochondrial proteomics study confirming BCL2 localization.
      action: ACCEPT
      reason: High-throughput proteomics supporting mitochondrial localization.
      supported_by:
        - reference_id: PMID:34800366
          supporting_text: Epub 2021 Nov 19. Quantitative high-confidence human 
            mitochondrial proteome and its dynamics in cellular context.
  - term:
      id: GO:0060090
      label: molecular adaptor activity
    evidence_type: EXP
    original_reference_id: PMID:26858413
    review:
      summary: >
        Study on BCL2 interaction with HBx showing adaptor-like function.
      action: KEEP_AS_NON_CORE
      reason: >
        Experimental support for adaptor activity, though this is not the primary
        molecular function of BCL2.
      supported_by:
        - reference_id: PMID:26858413
          supporting_text: Structural and biochemical analysis of Bcl-2 
            interaction with the hepatitis B virus protein HBx.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:29020630
    review:
      summary: Study on XIAP/ARTS-mediated BCL2 degradation.
      action: ACCEPT
      reason: Documents protein interaction in the context of BCL2 regulation.
      supported_by:
        - reference_id: PMID:29020630
          supporting_text: Degradation of Bcl-2 by XIAP and ARTS Promotes 
            Apoptosis.
  - term:
      id: GO:0005741
      label: mitochondrial outer membrane
    evidence_type: IDA
    original_reference_id: PMID:21358617
    review:
      summary: >
        Direct experimental evidence for BCL2 localization at OMM.
      action: ACCEPT
      reason: >
        PMID:21358617 provides direct evidence: "AMBRA1 binds preferentially the
        mitochondrial pool of the antiapoptotic factor BCL-2"
      supported_by:
        - reference_id: PMID:21358617
          supporting_text: "AMBRA1 binds preferentially the mitochondrial pool of
            the antiapoptotic factor BCL-2"
  - term:
      id: GO:0005789
      label: endoplasmic reticulum membrane
    evidence_type: IDA
    original_reference_id: PMID:21358617
    review:
      summary: Direct experimental evidence for BCL2 localization at ER 
        membrane.
      action: ACCEPT
      reason: >
        PMID:21358617 demonstrates ER-BCL-2 localization and interaction with AMBRA1.
      supported_by:
        - reference_id: PMID:21358617
          supporting_text: "AMBRA1 can compete with both mitochondrial and endoplasmic
            reticulum-resident BCL-2 (mito-BCL-2 and ER-BCL-2, respectively)"
  - term:
      id: GO:0010507
      label: negative regulation of autophagy
    evidence_type: IDA
    original_reference_id: PMID:21358617
    review:
      summary: >
        BCL2 inhibits autophagy through interaction with AMBRA1 and BECN1 at
        mitochondria and ER.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        While PMID:21358617 demonstrates BCL2 inhibition of autophagy, this represents
        regulatory crosstalk rather than BCL2's evolved core function. The paper
        title itself notes "Mitochondrial BCL-2 inhibits AMBRA1-induced autophagy"
        but this is a secondary regulatory function.
      supported_by:
        - reference_id: PMID:21358617
          supporting_text: Mitochondrial BCL-2 inhibits AMBRA1-induced 
            autophagy.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:25609812
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: More specific MF term available.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:25609812
          supporting_text: Tom70 mediates Sendai virus-induced apoptosis on 
            mitochondria.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:31206022
    review:
      summary: Study on BAP31-mitochondria contacts involving BCL2.
      action: ACCEPT
      reason: Specific protein interaction documented.
      supported_by:
        - reference_id: PMID:31206022
          supporting_text: 2019 Jun. BAP31 regulates mitochondrial function via 
            interaction with Tom40 within ER-mitochondria contact sites.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:17428862
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: More specific MF term available.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:17428862
          supporting_text: Induction of apoptosis by the severe acute 
            respiratory syndrome coronavirus 7a protein is dependent on its 
            interaction with the Bcl-XL protein.
  - term:
      id: GO:0042802
      label: identical protein binding
    evidence_type: IPI
    original_reference_id: PMID:9111042
    review:
      summary: >
        Study demonstrating BCL2 homodimerization through the same binding site
        as heterodimerization.
      action: ACCEPT
      reason: >
        PMID:9111042 directly demonstrates: "Bcl-2 forms protein-protein homodimers
        with itself and heterodimers with Bax"
      supported_by:
        - reference_id: PMID:9111042
          supporting_text: "Bcl-2 forms protein-protein homodimers with itself and
            heterodimers with Bax"
  - term:
      id: GO:0140297
      label: DNA-binding transcription factor binding
    evidence_type: IPI
    original_reference_id: PMID:16443602
    review:
      summary: >
        Study showing p53 binding to BCL2 at mitochondria inducing permeabilization.
      action: KEEP_AS_NON_CORE
      reason: >
        p53-BCL2 interaction at mitochondria is documented but represents a
        specific regulatory interaction rather than core BCL2 function.
      supported_by:
        - reference_id: PMID:16443602
          supporting_text: 2006 Jan 26. WT p53, but not tumor-derived mutants, 
            bind to Bcl2 via the DNA binding domain and induce mitochondrial 
            permeabilization.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:27031958
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: More specific MF term available.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:27031958
          supporting_text: Nupr1/Chop signal axis is involved in 
            mitochondrion-related endothelial cell apoptosis induced by 
            methamphetamine.
  - term:
      id: GO:0008284
      label: positive regulation of cell population proliferation
    evidence_type: IGI
    original_reference_id: PMID:28280358
    review:
      summary: >
        BCL2's role in cell proliferation is secondary to its anti-apoptotic
        function - by preventing cell death, cells can survive and proliferate.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        This is a downstream consequence of BCL2's anti-apoptotic function,
        not a direct evolved function in cell proliferation regulation.
      supported_by:
        - reference_id: PMID:28280358
          supporting_text: eCollection 2017. miR-204-5p acts as a tumor 
            suppressor by targeting matrix metalloproteinases-9 and B-cell 
            lymphoma-2 in malignant melanoma.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IGI
    original_reference_id: PMID:28280358
    review:
      summary: BCL2 negatively regulates apoptosis - core function.
      action: ACCEPT
      reason: Core function with genetic interaction evidence.
      supported_by:
        - reference_id: PMID:28280358
          supporting_text: eCollection 2017. miR-204-5p acts as a tumor 
            suppressor by targeting matrix metalloproteinases-9 and B-cell 
            lymphoma-2 in malignant melanoma.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:27673746
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: More specific MF term available.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:27673746
          supporting_text: Apoptotic properties of the type 1 interferon induced
            family of human mitochondrial membrane ISG12 proteins.
  - term:
      id: GO:1902166
      label: negative regulation of intrinsic apoptotic signaling pathway in 
        response to DNA damage by p53 class mediator
    evidence_type: TAS
    original_reference_id: PMID:1286168
    review:
      summary: >
        BCL2 negatively regulates the intrinsic apoptotic pathway in response to
        DNA damage. This is a core function.
      action: ACCEPT
      reason: >
        This specific term accurately captures BCL2's role in blocking the
        DNA damage-induced intrinsic apoptotic pathway.
      supported_by:
        - reference_id: PMID:1286168
          supporting_text: The bcl-2 oncogene and apoptosis.
  - term:
      id: GO:0032991
      label: protein-containing complex
    evidence_type: IMP
    original_reference_id: PMID:15733859
    review:
      summary: BCL2 forms protein complexes with other BCL2 family members.
      action: ACCEPT
      reason: BCL2 forms homo- and heterodimeric complexes with family members.
      supported_by:
        - reference_id: PMID:15733859
          supporting_text: The flexible loop of Bcl-2 is required for molecular 
            interaction with immunosuppressant FK-506 binding protein 38 
            (FKBP38).
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IDA
    original_reference_id: PMID:20041405
    review:
      summary: BCL2 negatively regulates apoptosis - core function.
      action: ACCEPT
      reason: Direct experimental evidence supporting core function.
      supported_by:
        - reference_id: PMID:20041405
          supporting_text: Effects of microRNA-29 on apoptosis, tumorigenicity, 
            and prognosis of hepatocellular carcinoma.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IMP
    original_reference_id: PMID:21212266
    review:
      summary: BCL2 negatively regulates apoptosis - core function.
      action: ACCEPT
      reason: Mutant phenotype evidence supporting core function.
      supported_by:
        - reference_id: PMID:21212266
          supporting_text: 2011 Jan 6. BCL-2 is a downstream target of ATF5 that
            mediates the prosurvival function of ATF5 in a cell type-dependent 
            manner.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:9660918
    review:
      summary: Study identifying BAX inhibitor-1 interaction with BCL2.
      action: ACCEPT
      reason: Specific protein interaction documented.
      supported_by:
        - reference_id: PMID:9660918
          supporting_text: Bax inhibitor-1, a mammalian apoptosis suppressor 
            identified by functional screening in yeast.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IGI
    original_reference_id: PMID:9660918
    review:
      summary: BCL2 negatively regulates apoptosis - genetic interaction 
        evidence.
      action: ACCEPT
      reason: Core function with genetic interaction support.
      supported_by:
        - reference_id: PMID:9660918
          supporting_text: Bax inhibitor-1, a mammalian apoptosis suppressor 
            identified by functional screening in yeast.
  - term:
      id: GO:0006915
      label: apoptotic process
    evidence_type: IDA
    original_reference_id: PMID:36599
    review:
      summary: >
        This PMID (36599) appears to be incorrectly cited - it refers to an
        unrelated study on Streptococcus pneumoniae antibiotic resistance.
      action: UNDECIDED
      reason: >
        The PMID reference appears incorrect. Cannot validate this annotation
        without access to the correct publication.
      supported_by:
        - reference_id: PMID:36599
          supporting_text: 'Isolation of a strain of Streptococcus pneumoniae multiresistant
            to antibiotics'
  - term:
      id: GO:0006915
      label: apoptotic process
    evidence_type: IDA
    original_reference_id: PMID:8022822
    review:
      summary: >
        BCL2 is involved in the apoptotic process as a regulator. The study
        demonstrates BCL2 regulates apoptosis through ER calcium flux control.
      action: ACCEPT
      reason: >
        PMID:8022822 provides evidence for BCL2's role in apoptosis regulation
        through calcium signaling.
      supported_by:
        - reference_id: PMID:8022822
          supporting_text: Evidence that BCL-2 represses apoptosis by regulating
            endoplasmic reticulum-associated Ca2+ fluxes.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:11060313
    review:
      summary: Study on MAP-1 interaction with BCL2 family through BH domains.
      action: MODIFY
      reason: BH3-like motif interaction supports BH3 domain binding.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:11060313
          supporting_text: Nov 1. MAP-1, a novel proapoptotic protein containing
            a BH3-like motif that associates with Bax through its Bcl-2 homology
            domains.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:23431138
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: More specific MF term available.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:23431138
          supporting_text: Related F-box proteins control cell death in 
            Caenorhabditis elegans and human lymphoma.
  - term:
      id: GO:0032469
      label: endoplasmic reticulum calcium ion homeostasis
    evidence_type: TAS
    original_reference_id: PMID:18309324
    review:
      summary: >
        BCL2 modulates ER calcium homeostasis through IP3 receptor interactions.
      action: KEEP_AS_NON_CORE
      reason: >
        BCL2's role in ER calcium regulation is documented but represents a
        secondary function related to its membrane localization and BH4 domain
        interactions with IP3 receptors.
      supported_by:
        - reference_id: PMID:18309324
          supporting_text: 'Feb 29. No death without life: vital functions of apoptotic
            effectors.'
  - term:
      id: GO:2001243
      label: negative regulation of intrinsic apoptotic signaling pathway
    evidence_type: IDA
    original_reference_id: PMID:11684014
    review:
      summary: >
        BCL2 negatively regulates the intrinsic apoptotic signaling pathway.
        This is a core function.
      action: ACCEPT
      reason: >
        This term accurately captures BCL2's primary function in blocking the
        intrinsic (mitochondrial) apoptotic pathway.
      supported_by:
        - reference_id: PMID:11684014
          supporting_text: ASPP proteins specifically stimulate the apoptotic 
            function of p53.
  - term:
      id: GO:0016248
      label: channel inhibitor activity
    evidence_type: IDA
    original_reference_id: PMID:9219694
    review:
      summary: >
        BCL2 inhibits BAX channel-forming activity. This is a key mechanistic
        aspect of its anti-apoptotic function.
      action: ACCEPT
      reason: >
        PMID:9219694 directly demonstrates: "At physiological pH, release [by Bax]
        could be blocked by Bcl-2." BCL2 inhibits BAX pore formation.
      supported_by:
        - reference_id: PMID:9219694
          supporting_text: "At physiological pH, release could be blocked by Bcl-2...
            the pro-apoptotic effects of Bax may be elicited through an intrinsic
            pore-forming activity that can be antagonized by Bcl-2."
  - term:
      id: GO:2001240
      label: negative regulation of extrinsic apoptotic signaling pathway in 
        absence of ligand
    evidence_type: IGI
    original_reference_id: PMID:8358790
    review:
      summary: >
        BCL2 heterodimerizes with BAX to regulate apoptosis. The extrinsic pathway
        annotation may be overly specific as BCL2 primarily functions in the
        intrinsic pathway.
      action: KEEP_AS_NON_CORE
      reason: >
        BCL2 can influence the extrinsic pathway through crosstalk at the
        mitochondrial level, but its primary function is in the intrinsic pathway.
      supported_by:
        - reference_id: PMID:8358790
          supporting_text: Bcl-2 heterodimerizes in vivo with a conserved 
            homolog, Bax, that accelerates programmed cell death.
  - term:
      id: GO:0008625
      label: extrinsic apoptotic signaling pathway via death domain receptors
    evidence_type: IDA
    original_reference_id: PMID:10597216
    review:
      summary: >
        BCL2 may influence extrinsic apoptotic signaling through crosstalk, but
        this is not its primary pathway.
      action: KEEP_AS_NON_CORE
      reason: >
        BCL2's primary function is in the intrinsic pathway. Its influence on
        extrinsic signaling occurs through mitochondrial crosstalk.

# ============================================================================
# REACTOME TAS ANNOTATIONS (Mitochondrial outer membrane)
# ============================================================================
      supported_by:
        - reference_id: PMID:10597216
          supporting_text: Bis, a Bcl-2-binding protein that synergizes with 
            Bcl-2 in preventing cell death.
  - term:
      id: GO:0005741
      label: mitochondrial outer membrane
    evidence_type: TAS
    original_reference_id: Reactome:R-HSA-114352
    review:
      summary: Reactome pathway annotation for BCL2 sequestration of tBID at 
        OMM.
      action: ACCEPT
      reason: Well-supported localization from curated pathway database.
  - term:
      id: GO:0005741
      label: mitochondrial outer membrane
    evidence_type: TAS
    original_reference_id: Reactome:R-HSA-139897
    review:
      summary: Reactome pathway annotation for BAD displacing tBID from BCL2.
      action: ACCEPT
      reason: Well-supported localization from curated pathway database.
  - term:
      id: GO:0005741
      label: mitochondrial outer membrane
    evidence_type: TAS
    original_reference_id: Reactome:R-HSA-508163
    review:
      summary: Reactome pathway annotation for BH3-only proteins inactivating 
        BCL2.
      action: ACCEPT
      reason: Well-supported localization from curated pathway database.
  - term:
      id: GO:0005741
      label: mitochondrial outer membrane
    evidence_type: TAS
    original_reference_id: Reactome:R-HSA-6790025
    review:
      summary: Reactome pathway annotation for BCL2 expression.
      action: ACCEPT
      reason: Pathway database annotation.
  - term:
      id: GO:0005741
      label: mitochondrial outer membrane
    evidence_type: TAS
    original_reference_id: Reactome:R-HSA-879201
    review:
      summary: Reactome pathway annotation for BCL2 binding NLRP1.
      action: ACCEPT
      reason: Well-supported localization.
  - term:
      id: GO:0005741
      label: mitochondrial outer membrane
    evidence_type: TAS
    original_reference_id: Reactome:R-HSA-9011941
    review:
      summary: Reactome pathway annotation for estrogen-responsive BCL2 
        expression.
      action: ACCEPT
      reason: Pathway database annotation.
  - term:
      id: GO:0005741
      label: mitochondrial outer membrane
    evidence_type: TAS
    original_reference_id: Reactome:R-HSA-9623999
    review:
      summary: Reactome pathway annotation for BCL2 expression downstream of 
        ESR1.
      action: ACCEPT
      reason: Pathway database annotation.
  - term:
      id: GO:0005741
      label: mitochondrial outer membrane
    evidence_type: TAS
    original_reference_id: Reactome:R-HSA-9692376
    review:
      summary: Reactome pathway annotation for BCL2 binding antagonists.
      action: ACCEPT
      reason: Well-supported localization.
  - term:
      id: GO:0005741
      label: mitochondrial outer membrane
    evidence_type: TAS
    original_reference_id: Reactome:R-HSA-9796055
    review:
      summary: Reactome pathway annotation for NFE2L2-dependent BCL2 expression.
      action: ACCEPT
      reason: Pathway database annotation.
  - term:
      id: GO:0005741
      label: mitochondrial outer membrane
    evidence_type: TAS
    original_reference_id: Reactome:R-HSA-9824587
    review:
      summary: Reactome pathway annotation for MITF-dependent BCL2 expression.
      action: ACCEPT
      reason: Pathway database annotation.

# ============================================================================
# ADDITIONAL EXPERIMENTAL ANNOTATIONS
# ============================================================================
  - term:
      id: GO:2000811
      label: negative regulation of anoikis
    evidence_type: IMP
    original_reference_id: PMID:15006356
    review:
      summary: >
        Anoikis is a form of apoptosis triggered by loss of cell attachment.
        BCL2's anti-apoptotic function extends to preventing anoikis.
      action: KEEP_AS_NON_CORE
      reason: >
        BCL2 can prevent anoikis through its general anti-apoptotic function.
        This is a specific context of apoptosis regulation rather than a
        distinct evolved function.
      supported_by:
        - reference_id: PMID:15006356
          supporting_text: A mitochondrial protein, Bit1, mediates apoptosis 
            regulated by integrins and Groucho/TLE corepressors.
  - term:
      id: GO:0010507
      label: negative regulation of autophagy
    evidence_type: TAS
    original_reference_id: PMID:18309324
    review:
      summary: >
        Review on vital functions of apoptotic effectors including BCL2's
        role in autophagy regulation.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        BCL2's autophagy regulation is crosstalk with BECN1, not its evolved
        core function. The primary function is apoptosis regulation.
      supported_by:
        - reference_id: PMID:18309324
          supporting_text: 'Feb 29. No death without life: vital functions of apoptotic
            effectors.'
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IMP
    original_reference_id: PMID:17289999
    review:
      summary: BCL2 negatively regulates apoptosis - core function.
      action: ACCEPT
      reason: Core function with mutant phenotype evidence.
      supported_by:
        - reference_id: PMID:17289999
          supporting_text: Apoptosis initiated when BH3 ligands engage multiple 
            Bcl-2 homologs, not Bax or Bak.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:20849813
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: More specific MF term available.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:20849813
          supporting_text: Prolyl hydroxylase 3 interacts with Bcl-2 to regulate
            doxorubicin-induced apoptosis in H9c2 cells.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:19706769
    review:
      summary: Study on G0S2 interaction with BCL2.
      action: ACCEPT
      reason: Specific protein interaction documented.
      supported_by:
        - reference_id: PMID:19706769
          supporting_text: 2009 Aug 25. Identification of a protein, G0S2, that 
            lacks Bcl-2 homology domains and interacts with and antagonizes 
            Bcl-2.
  - term:
      id: GO:2001234
      label: negative regulation of apoptotic signaling pathway
    evidence_type: IMP
    original_reference_id: PMID:20097879
    review:
      summary: BCL2 negatively regulates apoptotic signaling - core function.
      action: ACCEPT
      reason: Core function with experimental evidence.
      supported_by:
        - reference_id: PMID:20097879
          supporting_text: 'Identification of a novel proapoptotic function of resveratrol
            in fat cells: SIRT1-independent sensitization to TRAIL-induced apoptosis.'
  - term:
      id: GO:0031625
      label: ubiquitin protein ligase binding
    evidence_type: IPI
    original_reference_id: PMID:20889974
    review:
      summary: >
        Study on Parkin-mediated BCL2 mono-ubiquitination in autophagy regulation.
      action: KEEP_AS_NON_CORE
      reason: >
        BCL2 is a substrate for ubiquitin ligases including Parkin, but this
        represents post-translational regulation of BCL2 rather than its
        core molecular function.
      supported_by:
        - reference_id: PMID:20889974
          supporting_text: 2010 Oct 2. Parkin mono-ubiquitinates Bcl-2 and 
            regulates autophagy.
  - term:
      id: GO:0005741
      label: mitochondrial outer membrane
    evidence_type: IDA
    original_reference_id: PMID:8402648
    review:
      summary: Direct experimental evidence for BCL2 OMM localization.
      action: ACCEPT
      reason: Well-supported localization.
      supported_by:
        - reference_id: PMID:8402648
          supporting_text: 'Investigation of the subcellular distribution of the bcl-2
            oncoprotein: residence in the nuclear envelope, endoplasmic reticulum,
            and outer mitochondrial membranes.'
  - term:
      id: GO:0005783
      label: endoplasmic reticulum
    evidence_type: IDA
    original_reference_id: PMID:8402648
    review:
      summary: Direct experimental evidence for BCL2 ER localization.
      action: ACCEPT
      reason: Well-supported localization.
      supported_by:
        - reference_id: PMID:8402648
          supporting_text: 'Investigation of the subcellular distribution of the bcl-2
            oncoprotein: residence in the nuclear envelope, endoplasmic reticulum,
            and outer mitochondrial membranes.'
  - term:
      id: GO:0031965
      label: nuclear membrane
    evidence_type: IDA
    original_reference_id: PMID:8402648
    review:
      summary: Direct experimental evidence for BCL2 nuclear membrane 
        localization.
      action: KEEP_AS_NON_CORE
      reason: >
        Nuclear envelope localization is documented but is not the primary
        site of BCL2 function.
      supported_by:
        - reference_id: PMID:8402648
          supporting_text: 'Investigation of the subcellular distribution of the bcl-2
            oncoprotein: residence in the nuclear envelope, endoplasmic reticulum,
            and outer mitochondrial membranes.'
  - term:
      id: GO:0015267
      label: channel activity
    evidence_type: IDA
    original_reference_id: PMID:9219694
    review:
      summary: >
        BCL2 can form ion channels in artificial membranes at acidic pH.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        PMID:9219694 showed BCL2 forms channels only at acidic pH in artificial
        membranes. At physiological pH, BCL2's function is to inhibit BAX
        channel activity. Channel formation is not considered BCL2's primary
        function.
      supported_by:
        - reference_id: PMID:9219694
          supporting_text: Inhibition of Bax channel-forming activity by Bcl-2.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IDA
    original_reference_id: PMID:9219694
    review:
      summary: BCL2 negatively regulates apoptosis by inhibiting BAX pore 
        formation.
      action: ACCEPT
      reason: >
        PMID:9219694 demonstrates BCL2 blocks BAX-mediated membrane
        permeabilization, supporting its anti-apoptotic function.
      supported_by:
        - reference_id: PMID:9219694
          supporting_text: Inhibition of Bax channel-forming activity by Bcl-2.
  - term:
      id: GO:0046930
      label: pore complex
    evidence_type: IDA
    original_reference_id: PMID:9219694
    review:
      summary: >
        BCL2 can form pores in artificial membranes, but this is not its
        primary physiological function.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        While BCL2 can form pore-like structures in artificial membranes at
        acidic pH, its physiological function is to prevent pore formation
        by BAX/BAK. This annotation may be misleading.
      supported_by:
        - reference_id: PMID:9219694
          supporting_text: Inhibition of Bax channel-forming activity by Bcl-2.
  - term:
      id: GO:0006974
      label: DNA damage response
    evidence_type: IMP
    original_reference_id: PMID:17875758
    review:
      summary: >
        BCL2 is involved in cellular response to DNA damage through its
        anti-apoptotic function.
      action: KEEP_AS_NON_CORE
      reason: >
        BCL2's role in DNA damage response is through its anti-apoptotic
        function, not a direct role in DNA repair or damage sensing.
      supported_by:
        - reference_id: PMID:17875758
          supporting_text: ATM, CTLA4, MNDA, and HEM1 in high versus low CD38 
            expressing B-cell chronic lymphocytic leukemia.
  - term:
      id: GO:0009410
      label: response to xenobiotic stimulus
    evidence_type: IMP
    original_reference_id: PMID:17875758
    review:
      summary: >
        BCL2 levels may change in response to xenobiotics as part of stress response.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        BCL2's role in xenobiotic response is indirect, through its anti-apoptotic
        function in protecting cells from stress-induced death.
      supported_by:
        - reference_id: PMID:17875758
          supporting_text: ATM, CTLA4, MNDA, and HEM1 in high versus low CD38 
            expressing B-cell chronic lymphocytic leukemia.
  - term:
      id: GO:0030890
      label: positive regulation of B cell proliferation
    evidence_type: IMP
    original_reference_id: PMID:17875758
    review:
      summary: >
        BCL2 promotes B cell survival which enables proliferation, but this is
        a downstream effect of its anti-apoptotic function.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        BCL2 was first identified in B cell lymphoma. Its role in B cell
        proliferation is through preventing apoptosis, allowing cell survival
        and subsequent proliferation. This is not a direct proliferation function.
      supported_by:
        - reference_id: PMID:17875758
          supporting_text: ATM, CTLA4, MNDA, and HEM1 in high versus low CD38 
            expressing B-cell chronic lymphocytic leukemia.
  - term:
      id: GO:0050853
      label: B cell receptor signaling pathway
    evidence_type: IMP
    original_reference_id: PMID:17875758
    review:
      summary: >
        BCL2 may influence BCR signaling outcomes through its survival function.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        BCL2 is not a direct component of BCR signaling. Its involvement is
        through providing survival signals that enable B cells to respond to
        BCR stimulation.
      supported_by:
        - reference_id: PMID:17875758
          supporting_text: ATM, CTLA4, MNDA, and HEM1 in high versus low CD38 
            expressing B-cell chronic lymphocytic leukemia.
  - term:
      id: GO:0030307
      label: positive regulation of cell growth
    evidence_type: IDA
    original_reference_id: PMID:8022822
    review:
      summary: >
        BCL2 allows cell growth by preventing apoptosis, which is a downstream
        effect.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        BCL2's role in cell growth is indirect - by preventing cell death,
        cells can grow. This is not a direct growth-promoting function.
      supported_by:
        - reference_id: PMID:8022822
          supporting_text: Evidence that BCL-2 represses apoptosis by regulating
            endoplasmic reticulum-associated Ca2+ fluxes.
  - term:
      id: GO:0043565
      label: sequence-specific DNA binding
    evidence_type: IDA
    original_reference_id: PMID:12086670
    review:
      summary: >
        This annotation appears unusual for BCL2 which is primarily a membrane
        protein. The study is about MITF regulation of BCL2 expression.
      action: REMOVE
      reason: >
        BCL2 is not a DNA-binding protein. The study PMID:12086670 is about
        MITF (a transcription factor) regulating BCL2 gene expression, not
        BCL2 binding DNA. This appears to be a curation error.
      supported_by:
        - reference_id: PMID:12086670
          supporting_text: Bcl2 regulation by the melanocyte master regulator 
            Mitf modulates lineage survival and melanoma cell viability.
  - term:
      id: GO:0000209
      label: protein polyubiquitination
    evidence_type: IDA
    original_reference_id: PMID:16717086
    review:
      summary: >
        BCL2 undergoes polyubiquitination as part of its regulation, but this
        is a modification BCL2 receives, not a function it performs.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        BCL2 is a substrate for ubiquitination, not an enzyme that performs
        ubiquitination. This annotation may represent BCL2 being ubiquitinated
        rather than BCL2 performing ubiquitination activity.
      supported_by:
        - reference_id: PMID:16717086
          supporting_text: 2006 May 22. PP2A regulates BCL-2 phosphorylation and
            proteasome-mediated degradation at the endoplasmic reticulum.
  - term:
      id: GO:0005737
      label: cytoplasm
    evidence_type: IDA
    original_reference_id: PMID:7546744
    review:
      summary: BCL2 detected in cytoplasm (membrane-associated).
      action: ACCEPT
      reason: BCL2 is present in cytoplasm associated with membranes.
      supported_by:
        - reference_id: PMID:7546744
          supporting_text: Role of BCL-2 in the survival and function of 
            developing and mature sympathetic neurons.
  - term:
      id: GO:0016020
      label: membrane
    evidence_type: IDA
    original_reference_id: PMID:7896880
    review:
      summary: BCL2 is an integral membrane protein.
      action: ACCEPT
      reason: Well-supported - BCL2 has a C-terminal transmembrane anchor.
      supported_by:
        - reference_id: PMID:7896880
          supporting_text: The intracellular distribution and pattern of 
            expression of Mcl-1 overlap with, but are not identical to, those of
            Bcl-2.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:9305631
    review:
      summary: Study on BAG-1 modulating Hsp70/Hsc70 chaperone activity.
      action: ACCEPT
      reason: Specific protein interaction documented.
      supported_by:
        - reference_id: PMID:9305631
          supporting_text: BAG-1 modulates the chaperone activity of 
            Hsp70/Hsc70.
  - term:
      id: GO:0005634
      label: nucleus
    evidence_type: IDA
    original_reference_id: PMID:7546744
    review:
      summary: BCL2 detected in nucleus in some studies.
      action: KEEP_AS_NON_CORE
      reason: >
        Nuclear localization has been reported but is not the primary site
        of BCL2 function.
      supported_by:
        - reference_id: PMID:7546744
          supporting_text: Role of BCL-2 in the survival and function of 
            developing and mature sympathetic neurons.
  - term:
      id: GO:0005634
      label: nucleus
    evidence_type: IDA
    original_reference_id: PMID:7896880
    review:
      summary: BCL2 detected in nucleus.
      action: KEEP_AS_NON_CORE
      reason: Secondary localization, not primary site of function.
      supported_by:
        - reference_id: PMID:7896880
          supporting_text: The intracellular distribution and pattern of 
            expression of Mcl-1 overlap with, but are not identical to, those of
            Bcl-2.
  - term:
      id: GO:0005739
      label: mitochondrion
    evidence_type: IDA
    original_reference_id: PMID:7896880
    review:
      summary: BCL2 localizes to mitochondria.
      action: ACCEPT
      reason: Primary localization well-supported.
      supported_by:
        - reference_id: PMID:7896880
          supporting_text: The intracellular distribution and pattern of 
            expression of Mcl-1 overlap with, but are not identical to, those of
            Bcl-2.
  - term:
      id: GO:0009410
      label: response to xenobiotic stimulus
    evidence_type: IDA
    original_reference_id: PMID:36599
    review:
      summary: >
        This PMID (36599) appears incorrect - refers to bacterial antibiotic
        resistance study.
      action: UNDECIDED
      reason: PMID reference appears incorrect.
      supported_by:
        - reference_id: PMID:36599
          supporting_text: 'Isolation of a strain of Streptococcus pneumoniae multiresistant
            to antibiotics'
  - term:
      id: GO:0009636
      label: response to toxic substance
    evidence_type: IDA
    original_reference_id: PMID:16717086
    review:
      summary: >
        BCL2 protects cells from toxic substance-induced apoptosis.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        BCL2's protective effect against toxins is through its anti-apoptotic
        function, not a direct toxin response mechanism.
      supported_by:
        - reference_id: PMID:16717086
          supporting_text: 2006 May 22. PP2A regulates BCL-2 phosphorylation and
            proteasome-mediated degradation at the endoplasmic reticulum.
  - term:
      id: GO:0034097
      label: response to cytokine
    evidence_type: IDA
    original_reference_id: PMID:9184696
    review:
      summary: >
        BCL2 expression changes in response to cytokines like IL-10 in B cells.
      action: KEEP_AS_NON_CORE
      reason: >
        BCL2 expression is regulated by cytokines, but this represents
        regulation of BCL2 rather than a cytokine response function of BCL2.
      supported_by:
        - reference_id: PMID:9184696
          supporting_text: The apoptosis and proliferation of SAC-activated B 
            cells by IL-10 are associated with changes in Bcl-2, Bcl-xL, and 
            Mcl-1 expression.
  - term:
      id: GO:0042100
      label: B cell proliferation
    evidence_type: IDA
    original_reference_id: PMID:1373874
    review:
      summary: >
        BCL2 confers survival advantage to B cells allowing proliferation.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        BCL2 was identified in B cell lymphoma. Its role in B cell proliferation
        is through survival, not direct proliferation regulation. The study
        notes BCL2 provides "growth and survival advantage."
      supported_by:
        - reference_id: PMID:1373874
          supporting_text: Bcl-2 confers growth and survival advantage to 
            interleukin 7-dependent early pre-B cells which become factor 
            independent by a multistep process in culture.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IDA
    original_reference_id: PMID:1373874
    review:
      summary: BCL2 prevents apoptosis in early pre-B cells.
      action: ACCEPT
      reason: Core function demonstrated in B cell context.
      supported_by:
        - reference_id: PMID:1373874
          supporting_text: Bcl-2 confers growth and survival advantage to 
            interleukin 7-dependent early pre-B cells which become factor 
            independent by a multistep process in culture.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IDA
    original_reference_id: PMID:7650367
    review:
      summary: BCL2 prevents apoptosis after T cell activation.
      action: ACCEPT
      reason: Core function in T cell context.
      supported_by:
        - reference_id: PMID:7650367
          supporting_text: Expression of Bcl-2, Bcl-x, and Bax after T cell 
            activation and IL-2 withdrawal.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IDA
    original_reference_id: PMID:7772249
    review:
      summary: BCL2 anti-apoptotic function is evolutionarily conserved.
      action: ACCEPT
      reason: Core function with evolutionary conservation evidence.
      supported_by:
        - reference_id: PMID:7772249
          supporting_text: Evolutionary conservation of function among 
            mammalian, avian, and viral homologs of the Bcl-2 oncoprotein.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IMP
    original_reference_id: PMID:7772249
    review:
      summary: BCL2 anti-apoptotic function demonstrated by mutant analysis.
      action: ACCEPT
      reason: Core function with mutant phenotype evidence.
      supported_by:
        - reference_id: PMID:7772249
          supporting_text: Evolutionary conservation of function among 
            mammalian, avian, and viral homologs of the Bcl-2 oncoprotein.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IDA
    original_reference_id: PMID:8050499
    review:
      summary: BCL2 prevents apoptosis in endothelial cells.
      action: ACCEPT
      reason: Core function in endothelial cell context.
      supported_by:
        - reference_id: PMID:8050499
          supporting_text: bcl-2 gene prevents apoptosis of basic fibroblast 
            growth factor-deprived murine aortic endothelial cells.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IDA
    original_reference_id: PMID:8080725
    review:
      summary: BCL2 protects bone marrow cells from chemotherapy-induced death.
      action: ACCEPT
      reason: Core anti-apoptotic function.
      supported_by:
        - reference_id: PMID:8080725
          supporting_text: bcl-2 gene enables rescue from in vitro 
            myelosuppression (bone marrow cell death) induced by chemotherapy.
  - term:
      id: GO:0043524
      label: negative regulation of neuron apoptotic process
    evidence_type: IDA
    original_reference_id: PMID:7546744
    review:
      summary: BCL2 protects neurons from apoptosis.
      action: ACCEPT
      reason: Core function in neuronal context.
      supported_by:
        - reference_id: PMID:7546744
          supporting_text: Role of BCL-2 in the survival and function of 
            developing and mature sympathetic neurons.
  - term:
      id: GO:0051924
      label: regulation of calcium ion transport
    evidence_type: IDA
    original_reference_id: PMID:8022822
    review:
      summary: >
        BCL2 regulates ER-associated calcium fluxes through IP3 receptor
        interactions.
      action: KEEP_AS_NON_CORE
      reason: >
        BCL2's calcium regulation function at the ER is documented but is
        secondary to its primary anti-apoptotic function at mitochondria.
      supported_by:
        - reference_id: PMID:8022822
          supporting_text: Evidence that BCL-2 represses apoptosis by regulating
            endoplasmic reticulum-associated Ca2+ fluxes.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IDA
    original_reference_id: PMID:15776018
    review:
      summary: BCL2 prevents apoptosis - core function.
      action: ACCEPT
      reason: Core function with experimental evidence.
      supported_by:
        - reference_id: PMID:15776018
          supporting_text: Proapoptotic BAX and BAK control multiple initiator 
            caspases.
  - term:
      id: GO:0070059
      label: intrinsic apoptotic signaling pathway in response to endoplasmic 
        reticulum stress
    evidence_type: IDA
    original_reference_id: PMID:15776018
    review:
      summary: >
        BCL2 regulates the intrinsic apoptotic pathway in response to ER stress.
      action: ACCEPT
      reason: >
        BCL2 at the ER can prevent ER stress-induced apoptosis, consistent
        with its anti-apoptotic function extending to ER stress responses.
      supported_by:
        - reference_id: PMID:15776018
          supporting_text: Proapoptotic BAX and BAK control multiple initiator 
            caspases.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:16790527
    review:
      summary: Generic protein binding annotation.
      action: MODIFY
      reason: More specific MF term available.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:16790527
          supporting_text: 'Mitochondrial damage due to SOD1 deficiency in SH-SY5Y
            neuroblastoma cells: a rationale for the redundancy of SOD1.'
  - term:
      id: GO:0009636
      label: response to toxic substance
    evidence_type: IDA
    original_reference_id: PMID:16307838
    review:
      summary: BCL2 protects cells from T-2 toxin-induced apoptosis.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        BCL2's protection against toxins is through its anti-apoptotic function,
        not a direct toxin response mechanism.
      supported_by:
        - reference_id: PMID:16307838
          supporting_text: 2005 Nov 22. T-2 toxin induces apoptosis, and 
            selenium partly blocks, T-2 toxin induced apoptosis in chondrocytes 
            through modulation of the Bax/Bcl-2 ratio.
  - term:
      id: GO:0002020
      label: protease binding
    evidence_type: IDA
    original_reference_id: PMID:10620603
    review:
      summary: >
        BCL2 may interact with proteases in the context of apoptosis regulation.
      action: KEEP_AS_NON_CORE
      reason: >
        Protease interactions may occur as part of BCL2's anti-apoptotic
        function but are not its primary molecular function.
      supported_by:
        - reference_id: PMID:10620603
          supporting_text: The HIV-1 viral protein R induces apoptosis via a 
            direct effect on the mitochondrial permeability transition pore.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:10837489
    review:
      summary: Study on MCL-1S BH3-only protein interaction with BCL2.
      action: MODIFY
      reason: BH3 domain interaction documented.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:10837489
          supporting_text: MCL-1S, a splicing variant of the antiapoptotic BCL-2
            family member MCL-1, encodes a proapoptotic protein possessing only 
            the BH3 domain.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:11054413
    review:
      summary: Study on BCL-G BH3 domain interaction.
      action: MODIFY
      reason: BH3 domain binding documented.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:11054413
          supporting_text: Oct 27. Bcl-G, a novel pro-apoptotic member of the 
            Bcl-2 family.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:11126360
    review:
      summary: Study on RTN-XS interaction with BCL2 at ER.
      action: ACCEPT
      reason: Specific protein interaction at ER documented.
      supported_by:
        - reference_id: PMID:11126360
          supporting_text: A novel protein, RTN-XS, interacts with both Bcl-XL 
            and Bcl-2 on endoplasmic reticulum and reduces their anti-apoptotic 
            activity.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:11278245
    review:
      summary: Study on BCL-B interaction with BCL2 family members.
      action: MODIFY
      reason: BCL2 family member interaction through BH domains.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:11278245
          supporting_text: 2001 Feb 21. Bcl-B, a novel Bcl-2 family member that 
            differentially binds and regulates Bax and Bak.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:11463391
    review:
      summary: Study on PUMA BH3-only protein interaction.
      action: MODIFY
      reason: BH3 domain binding documented.
      proposed_replacement_terms:
        - id: GO:0051434
          label: BH3 domain binding
      supported_by:
        - reference_id: PMID:11463391
          supporting_text: PUMA induces the rapid apoptosis of colorectal cancer
            cells.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:12901880
    review:
      summary: Study on BNIPL-2 interaction with BCL2.
      action: ACCEPT
      reason: Specific protein interaction documented.
      supported_by:
        - reference_id: PMID:12901880
          supporting_text: BNIPL-2, a novel homologue of BNIP-2, interacts with 
            Bcl-2 and Cdc42GAP in apoptosis.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:7954800
    review:
      summary: >
        Study showing adenovirus E1B 19kDa and BCL2 interact with common
        cellular proteins.
      action: ACCEPT
      reason: Protein interactions documented.
      supported_by:
        - reference_id: PMID:7954800
          supporting_text: Adenovirus E1B 19 kDa and Bcl-2 proteins interact 
            with a common set of cellular proteins.
  - term:
      id: GO:0005737
      label: cytoplasm
    evidence_type: IDA
    original_reference_id: PMID:11530860
    review:
      summary: BCL2 detected in cytoplasm of placental cells.
      action: ACCEPT
      reason: Localization documented.
      supported_by:
        - reference_id: PMID:11530860
          supporting_text: The immunolocalization of Bcl-2 in human term 
            placenta.
  - term:
      id: GO:0005739
      label: mitochondrion
    evidence_type: IDA
    original_reference_id: PMID:9027314
    review:
      summary: BCL2 localizes to mitochondria.
      action: ACCEPT
      reason: >
        PMID:9027314 states: "Bcl-2 is an integral membrane protein located
        mainly on the outer membrane of mitochondria."
      supported_by:
        - reference_id: PMID:9027314
          supporting_text: "Bcl-2 is an integral membrane protein located mainly on
            the outer membrane of mitochondria."
  - term:
      id: GO:0005741
      label: mitochondrial outer membrane
    evidence_type: IDA
    original_reference_id: PMID:9027314
    review:
      summary: BCL2 localizes specifically to the OMM.
      action: ACCEPT
      reason: Direct experimental evidence from landmark paper.
      supported_by:
        - reference_id: PMID:9027314
          supporting_text: "Bcl-2 is an integral membrane protein located mainly on
            the outer membrane of mitochondria."
  - term:
      id: GO:0007565
      label: female pregnancy
    evidence_type: NAS
    original_reference_id: PMID:11530860
    review:
      summary: >
        BCL2 is expressed in placenta and may play a role in pregnancy through
        its survival function.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        BCL2's role in pregnancy is through general cell survival function,
        not a specific pregnancy-related function. This is an over-annotation
        based on expression pattern.
      supported_by:
        - reference_id: PMID:11530860
          supporting_text: The immunolocalization of Bcl-2 in human term 
            placenta.
  - term:
      id: GO:0009314
      label: response to radiation
    evidence_type: NAS
    original_reference_id: PMID:15799693
    review:
      summary: BCL2 protects cells from radiation-induced apoptosis.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        BCL2's radioprotective effect is through its anti-apoptotic function,
        not a specific radiation response mechanism.
      supported_by:
        - reference_id: PMID:15799693
          supporting_text: Medium from irradiated cells induces dose-dependent 
            mitochondrial changes and BCL2 responses in unirradiated human 
            keratinocytes.
  - term:
      id: GO:0010039
      label: response to iron ion
    evidence_type: IDA
    original_reference_id: PMID:11264898
    review:
      summary: BCL2 expression is induced by iron in endothelial cells.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        This represents regulation of BCL2 expression by iron, not a functional
        response of BCL2 to iron.
      supported_by:
        - reference_id: PMID:11264898
          supporting_text: Iron induces Bcl-2 expression in human dermal 
            microvascular endothelial cells.
  - term:
      id: GO:0031965
      label: nuclear membrane
    evidence_type: IDA
    original_reference_id: PMID:1502141
    review:
      summary: BCL2 localizes to nuclear membrane in insect cells.
      action: KEEP_AS_NON_CORE
      reason: Nuclear envelope localization documented but not primary site.
      supported_by:
        - reference_id: PMID:1502141
          supporting_text: Overexpressed full-length human BCL2 extends the 
            survival of baculovirus-infected Sf9 insect cells.
  - term:
      id: GO:0032848
      label: negative regulation of cellular pH reduction
    evidence_type: IDA
    original_reference_id: PMID:10506221
    review:
      summary: BCL2 prevents intracellular acidification associated with 
        apoptosis.
      action: KEEP_AS_NON_CORE
      reason: >
        BCL2's effect on pH is part of its anti-apoptotic function, as
        cytoplasmic acidification occurs during apoptosis.
      supported_by:
        - reference_id: PMID:10506221
          supporting_text: Regulation of acidification and apoptosis by SHP-1 
            and Bcl-2.
  - term:
      id: GO:0035094
      label: response to nicotine
    evidence_type: IDA
    original_reference_id: PMID:12421819
    review:
      summary: BCL2 is phosphorylated in response to nicotine.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        This represents post-translational modification of BCL2 in response
        to nicotine signaling, not a functional response by BCL2.
      supported_by:
        - reference_id: PMID:12421819
          supporting_text: 2002 Nov 5. A functional role for nicotine in Bcl2 
            phosphorylation and suppression of apoptosis.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IDA
    original_reference_id: PMID:10506221
    review:
      summary: BCL2 negatively regulates apoptosis.
      action: ACCEPT
      reason: Core function.
      supported_by:
        - reference_id: PMID:10506221
          supporting_text: Regulation of acidification and apoptosis by SHP-1 
            and Bcl-2.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IDA
    original_reference_id: PMID:10620603
    review:
      summary: BCL2 prevents HIV-1 Vpr-induced apoptosis.
      action: ACCEPT
      reason: Core function demonstrated in viral infection context.
      supported_by:
        - reference_id: PMID:10620603
          supporting_text: The HIV-1 viral protein R induces apoptosis via a 
            direct effect on the mitochondrial permeability transition pore.
  - term:
      id: GO:0046982
      label: protein heterodimerization activity
    evidence_type: IPI
    original_reference_id: PMID:9111042
    review:
      summary: BCL2 forms heterodimers with BAX and other family members.
      action: ACCEPT
      reason: >
        PMID:9111042 demonstrates heterodimerization: "Bcl-2 forms protein-protein
        homodimers with itself and heterodimers with Bax"
      supported_by:
        - reference_id: PMID:9111042
          supporting_text: "Bcl-2 forms protein-protein homodimers with itself and
            heterodimers with Bax"
  - term:
      id: GO:0051434
      label: BH3 domain binding
    evidence_type: IPI
    original_reference_id: PMID:9111042
    review:
      summary: >
        BCL2 binds BH3 domains from BAX, BAK, and BH3-only proteins through
        its hydrophobic groove.
      action: ACCEPT
      reason: >
        This is a core molecular function of BCL2. PMID:9111042 demonstrates
        that BH3 peptides block BCL2 interactions.
      supported_by:
        - reference_id: PMID:9111042
          supporting_text: "Bax as well as peptides derived from the BH3 domains of
            Bax and Bak block both Bcl-2/Bax binding and Bcl-2/Bcl-2 binding"
  - term:
      id: GO:0051607
      label: defense response to virus
    evidence_type: IDA
    original_reference_id: PMID:10620603
    review:
      summary: >
        BCL2 can protect cells from virus-induced apoptosis but this is not
        its evolved function for host defense.
      action: MARK_AS_OVER_ANNOTATED
      reason: >
        BCL2's protective effect against viral apoptosis is a consequence of
        its general anti-apoptotic function. Viruses have evolved to exploit
        or counteract BCL2; this is not BCL2's evolved role in host defense.
      supported_by:
        - reference_id: PMID:10620603
          supporting_text: The HIV-1 viral protein R induces apoptosis via a 
            direct effect on the mitochondrial permeability transition pore.
  - term:
      id: GO:0051402
      label: neuron apoptotic process
    evidence_type: TAS
    original_reference_id: PMID:16167175
    review:
      summary: BCL2 regulates neuronal apoptosis.
      action: ACCEPT
      reason: BCL2's anti-apoptotic function in neurons is well-documented.
      supported_by:
        - reference_id: PMID:16167175
          supporting_text: Inhibition of mitochondrial neural cell death 
            pathways by protein transduction of Bcl-2 family proteins.
  - term:
      id: GO:0001836
      label: release of cytochrome c from mitochondria
    evidence_type: ISS
    original_reference_id: PMID:9843949
    review:
      summary: >
        BCL2 prevents cytochrome c release - should be negative regulation term.
      action: MODIFY
      reason: BCL2 blocks this process, not promotes it.
      proposed_replacement_terms:
        - id: GO:0090201
          label: negative regulation of release of cytochrome c from 
            mitochondria
      supported_by:
        - reference_id: PMID:9843949
          supporting_text: Bax interacts with the permeability transition pore 
            to induce permeability transition and cytochrome c release in 
            isolated mitochondria.
  - term:
      id: GO:0046902
      label: regulation of mitochondrial membrane permeability
    evidence_type: ISS
    original_reference_id: PMID:9843949
    review:
      summary: BCL2 regulates mitochondrial membrane permeability - core 
        function.
      action: ACCEPT
      reason: Core function supported by sequence similarity evidence.
      supported_by:
        - reference_id: PMID:9843949
          supporting_text: Bax interacts with the permeability transition pore 
            to induce permeability transition and cytochrome c release in 
            isolated mitochondria.
  - term:
      id: GO:0051881
      label: regulation of mitochondrial membrane potential
    evidence_type: ISS
    original_reference_id: PMID:9843949
    review:
      summary: BCL2 helps maintain mitochondrial membrane potential.
      action: ACCEPT
      reason: Related to core anti-apoptotic function.
      supported_by:
        - reference_id: PMID:9843949
          supporting_text: Bax interacts with the permeability transition pore 
            to induce permeability transition and cytochrome c release in 
            isolated mitochondria.
  - term:
      id: GO:0001836
      label: release of cytochrome c from mitochondria
    evidence_type: NAS
    original_reference_id: PMID:9027314
    review:
      summary: >
        BCL2 blocks cytochrome c release - term should reflect negative regulation.
      action: MODIFY
      reason: BCL2 prevents this process.
      proposed_replacement_terms:
        - id: GO:0090201
          label: negative regulation of release of cytochrome c from 
            mitochondria
      supported_by:
        - reference_id: PMID:9027314
          supporting_text: 'Prevention of apoptosis by Bcl-2: release of cytochrome
            c from mitochondria blocked.'
  - term:
      id: GO:0006959
      label: humoral immune response
    evidence_type: TAS
    original_reference_id: PMID:1908951
    review:
      summary: >
        BCL2 maintains B cell memory, supporting humoral immune response.
      action: KEEP_AS_NON_CORE
      reason: >
        BCL2's role in B cell survival supports memory B cell maintenance,
        which is important for humoral immunity. This is a tissue-specific
        consequence of its anti-apoptotic function.
      supported_by:
        - reference_id: PMID:1908951
          supporting_text: Bcl-2 maintains B cell memory.
  - term:
      id: GO:0051902
      label: negative regulation of mitochondrial depolarization
    evidence_type: TAS
    original_reference_id: PMID:9027314
    review:
      summary: BCL2 prevents mitochondrial depolarization by preventing MOMP.
      action: ACCEPT
      reason: Core function - by preventing MOMP, BCL2 maintains membrane 
        potential.

# ============================================================================
# SUGGESTED NEW ANNOTATIONS
# ============================================================================
      supported_by:
        - reference_id: PMID:9027314
          supporting_text: 'Prevention of apoptosis by Bcl-2: release of cytochrome
            c from mitochondria blocked.'
  - term:
      id: GO:1901029
      label: negative regulation of mitochondrial outer membrane 
        permeabilization involved in apoptotic signaling pathway
    evidence_type: IC
    original_reference_id: PMID:9027314
    review:
      summary: >
        BCL2's primary core function is to prevent MOMP. This more specific term
        captures the mechanism better than general negative regulation of apoptosis.
      action: NEW
      reason: >
        BCL2 prevents MOMP by sequestering BH3-only proteins and restraining
        BAX/BAK activation. This term most accurately describes BCL2's evolved
        molecular function.
      supported_by:
        - reference_id: PMID:9027314
          supporting_text: "Overexpression of Bcl-2 prevented the efflux of cytochrome
            c from the mitochondria"
        - reference_id: PMID:9219694
          supporting_text: "the pro-apoptotic effects of Bax may be elicited through
            an intrinsic pore-forming activity that can be antagonized by Bcl-2"

references:
  - id: GO_REF:0000002
    title: Gene Ontology annotation through association of InterPro records with
      GO terms
    findings: []
  - id: GO_REF:0000033
    title: Annotation inferences using phylogenetic trees
    findings: []
  - id: GO_REF:0000043
    title: Gene Ontology annotation based on UniProtKB/Swiss-Prot keyword 
      mapping
    findings: []
  - id: GO_REF:0000044
    title: Gene Ontology annotation based on UniProtKB/Swiss-Prot Subcellular 
      Location vocabulary mapping
    findings: []
  - id: GO_REF:0000052
    title: Gene Ontology annotation based on curation of immunofluorescence data
    findings: []
  - id: GO_REF:0000107
    title: Automatic transfer of experimentally verified manual GO annotation 
      data to orthologs using Ensembl Compara
    findings: []
  - id: GO_REF:0000108
    title: Automatic assignment of GO terms using logical inference
    findings: []
  - id: GO_REF:0000117
    title: Electronic Gene Ontology annotations created by ARBA machine learning
      models
    findings: []
  - id: GO_REF:0000120
    title: Combined Automated Annotation using Multiple IEA Methods
    findings: []
  - id: PMID:9027314
    title: 'Prevention of apoptosis by Bcl-2: release of cytochrome c from mitochondria
      blocked.'
    findings:
      - statement: BCL2 localizes to mitochondrial outer membrane
      - statement: BCL2 prevents cytochrome c release from mitochondria
      - statement: BCL2 blocks apoptosis initiation
  - id: PMID:9219694
    title: Inhibition of Bax channel-forming activity by Bcl-2.
    findings:
      - statement: BCL2 inhibits BAX pore-forming activity at physiological pH
      - statement: BCL2 forms channels only at acidic pH in artificial membranes
      - statement: BCL2 antagonizes BAX pro-apoptotic function
  - id: PMID:9111042
    title: A common binding site mediates heterodimerization and 
      homodimerization of Bcl-2 family members.
    findings:
      - statement: BCL2 forms homodimers and heterodimers with BAX
      - statement: BH3 peptides block BCL2 binding interactions
      - statement: Same binding motifs mediate homo- and heterodimerization
  - id: PMID:21358617
    title: Mitochondrial BCL-2 inhibits AMBRA1-induced autophagy.
    findings:
      - statement: BCL2 localizes to both mitochondria and ER
      - statement: BCL2 binds AMBRA1 preferentially at mitochondria
      - statement: BCL2-AMBRA1 interaction is disrupted upon autophagy induction
      - statement: BCL2 inhibits BECN1-dependent autophagy through AMBRA1 
          sequestration
  - id: PMID:2250705
    title: Bcl-2 is an inner mitochondrial membrane protein that blocks 
      programmed cell death
    findings:
      - statement: Early localization study establishing BCL2 at mitochondrial 
          membranes
  - id: croce2025thebcl2protein
    title: The bcl-2 protein family - from discovery to drug development
    findings:
      - statement: BCL2 BH1-BH4 domains form hydrophobic groove for BH3 binding
      - statement: C-terminal TM helix anchors BCL2 to OMM and ER membranes
      - statement: BCL2 prevents MOMP by neutralizing BH3-only proteins and 
          restraining BAX/BAK
# Additional references from GOA annotations
  - id: PMID:12624108
    title: 'Inhibition of Bid-induced apoptosis by Bcl-2. tBid insertion, Bax translocation,
      and Bax/Bak oligomerization suppressed.'
    findings: []
  - id: PMID:12667443
    title: 'p53 has a direct apoptogenic role at the mitochondria.'
    findings: []
  - id: PMID:14739602
    title: 'The Siva-1 putative amphipathic helical region (SAH) is sufficient to
      bind to BCL-XL and sensitize cells to UV radiation induced apoptosis.'
    findings: []
  - id: PMID:15225643
    title: 'The phosphorylation status and anti-apoptotic activity of Bcl-2 are regulated
      by ERK and protein phosphatase 2A on the mitochondria.'
    findings: []
  - id: PMID:15694340
    title: 'Differential targeting of prosurvival Bcl-2 proteins by their BH3-only
      ligands allows complementary apoptotic function.'
    findings: []
  - id: PMID:15733859
    title: 'The flexible loop of Bcl-2 is required for molecular interaction with
      immunosuppressant FK-506 binding protein 38 (FKBP38).'
    findings: []
  - id: PMID:16697956
    title: 'Mitochondria primed by death signals determine cellular addiction to antiapoptotic
      BCL-2 family members.'
    findings: []
  - id: PMID:17074758
    title: 'The vaccinia virus protein F1L interacts with Bim and inhibits activation
      of the pro-apoptotic protein Bax.'
    findings: []
  - id: PMID:17289999
    title: 'Apoptosis initiated when BH3 ligands engage multiple Bcl-2 homologs, not
      Bax or Bak.'
    findings: []
  - id: PMID:17418785
    title: 'Bcl-2 and Bcl-XL regulate proinflammatory caspase-1 activation by interaction
      with NALP1.'
    findings: []
  - id: PMID:17446862
    title: 'Functional and physical interaction between Bcl-X(L) and a BH3-like domain
      in Beclin-1.'
    findings: []
  - id: PMID:17525735
    title: 'ERK1/2-dependent phosphorylation of BimEL promotes its rapid dissociation
      from Mcl-1 and Bcl-xL.'
    findings: []
  - id: PMID:17692808
    title: 'BH3 profiling identifies three distinct classes of apoptotic blocks to
      predict response to ABT-737 and conventional chemotherapeutic agents.'
    findings: []
  - id: PMID:18719108
    title: 'Molecular basis of the interaction between the antiapoptotic Bcl-2 family
      proteins and the proapoptotic protein ASPP2.'
    findings: []
  - id: PMID:18835031
    title: 'A short Nur77-derived peptide converts Bcl-2 from a protector to a killer.'
    findings: []
  - id: PMID:18981409
    title: 'Apoptosis is triggered when prosurvival Bcl-2 proteins cannot restrain
      Bax.'
    findings: []
  - id: PMID:19050071
    title: 'Identification of Barkor as a mammalian autophagy-specific factor for
      Beclin 1 and class III phosphatidylinositol 3-kinase.'
    findings: []
  - id: PMID:19074266
    title: 'Mechanism of apoptosis induction by inhibition of the anti-apoptotic BCL-2
      proteins.'
    findings: []
  - id: PMID:19180116
    title: 'DAP-kinase-mediated phosphorylation on the BH3 domain of beclin 1 promotes
      dissociation of beclin 1 from Bcl-XL and induction of autophagy.'
    findings: []
  - id: PMID:19223583
    title: 'Mechanism of Bcl-2 and Bcl-X(L) inhibition of NLRP1 inflammasome: loop
      domain-dependent suppression of ATP binding and oligomerization.'
    findings: []
  - id: PMID:19521340
    title: 'MDM4 (MDMX) localizes at the mitochondria and facilitates the p53-mediated
      intrinsic-apoptotic pathway.'
    findings: []
  - id: PMID:19706527
    title: 'The BH4 domain of Bcl-2 inhibits ER calcium release and apoptosis by binding
      the regulatory and coupling domain of the IP3 receptor.'
    findings: []
  - id: PMID:19959994
    title: 'The IKK complex contributes to the induction of autophagy.'
    findings: []
  - id: PMID:20010695
    title: 'Antagonism of Beclin 1-dependent autophagy by BCL-2 at the endoplasmic
      reticulum requires NAF-1.'
    findings: []
  - id: PMID:21139567
    title: 'MCL-1 is a stress sensor that regulates autophagy in a developmentally
      regulated manner.'
    findings: []
  - id: PMID:21199865
    title: 'Mutation to Bax beyond the BH3 domain disrupts interactions with pro-survival
      proteins and promotes apoptosis.'
    findings: []
  - id: PMID:21454712
    title: 'Noxa/Bcl-2 protein interactions contribute to bortezomib resistance in
      human lymphoid cells.'
    findings: []
  - id: PMID:21458670
    title: 'Bcl-x(L) retrotranslocates Bax from the mitochondria into the cytosol.'
    findings: []
  - id: PMID:21671007
    title: 'Role of Bim in apoptosis induced in H460 lung tumor cells by the spindle
      poison Combretastatin-A4.'
    findings: []
  - id: PMID:23541952
    title: 'Control of autophagic cell death by caspase-10 in multiple myeloma.'
    findings: []
  - id: PMID:23845444
    title: 'Targeting BCL-2 with the BH3 mimetic ABT-199 in estrogen receptor-positive
      breast cancer.'
    findings: []
  - id: PMID:23954414
    title: 'Beclin 2 functions in autophagy, degradation of G protein-coupled receptors,
      and metabolism.'
    findings: []
  - id: PMID:24034250
    title: 'EGFR-mediated Beclin 1 phosphorylation in autophagy suppression, tumor
      progression, and tumor chemoresistance.'
    findings: []
  - id: PMID:24472739
    title: 'Decorin activates AMPK, an energy sensor kinase, to induce autophagy in
      endothelial cells.'
    findings: []
  - id: PMID:26004684
    title: 'Small-Molecule Bcl2 BH4 Antagonist for Lung Cancer Therapy.'
    findings: []
  - id: PMID:26431330
    title: "Subcellular localization of PUMA regulates its pro-apoptotic activity
      in Burkitt's lymphoma B cells."
    findings: []
  - id: PMID:29749471
    title: "GSK3β‑mediated Ser156 phosphorylation modulates a BH3‑like domain in BCL2L12
      during TMZ‑induced apoptosis and autophagy in glioma cells."
    findings: []
  - id: PMID:29849149
    title: 'Disruption of the beclin 1-BCL2 autophagy regulatory complex promotes
      longevity in mice.'
    findings: []
  - id: PMID:32296183
    title: 'A reference map of the human binary protein interactome.'
    findings: []
  - id: PMID:32814053
    title: 'Interactome Mapping Provides a Network of Neurodegenerative Disease Proteins
      and Uncovers Widespread Protein Aggregation in Affected Brains.'
    findings: []
  - id: PMID:33961781
    title: 'Dual proteome-scale networks reveal cell-specific remodeling of the human
      interactome.'
    findings: []
  - id: PMID:9334338
    title: 'p28 Bap31, a Bcl-2/Bcl-XL- and procaspase-8-associated protein in the
      endoplasmic reticulum.'
    findings: []
  - id: PMID:9388232
    title: 'Dimerization properties of human BAD. Identification of a BH-3 domain
      and analysis of its binding to mutant BCL-2 and BCL-XL proteins.'
    findings: []
  - id: PMID:9463381
    title: 'The conserved N-terminal BH4 domain of Bcl-2 homologues is essential for
      inhibition of apoptosis and interaction with CED-4.'
    findings: []
  - id: PMID:9973195
    title: 'BNIP3alpha: a human homolog of mitochondrial proapoptotic protein BNIP3.'
    findings: []
  - id: PMID:14634621
    title: 'The Bcl-2 family: roles in cell survival and oncogenesis.'
    findings: []
  - id: PMID:34800366
    title: 'Quantitative high-confidence human mitochondrial proteome and its dynamics
      in cellular context.'
    findings: []
  - id: PMID:26858413
    title: 'Structural and biochemical analysis of Bcl-2 interaction with the hepatitis
      B virus protein HBx.'
    findings: []
  - id: PMID:29020630
    title: 'Degradation of Bcl-2 by XIAP and ARTS Promotes Apoptosis.'
    findings: []
  - id: PMID:25609812
    title: 'Tom70 mediates Sendai virus-induced apoptosis on mitochondria.'
    findings: []
  - id: PMID:31206022
    title: 'BAP31 regulates mitochondrial function via interaction with Tom40 within
      ER-mitochondria contact sites.'
    findings: []
  - id: PMID:17428862
    title: 'Induction of apoptosis by the severe acute respiratory syndrome coronavirus
      7a protein is dependent on its interaction with the Bcl-XL protein.'
    findings: []
  - id: PMID:16443602
    title: 'WT p53, but not tumor-derived mutants, bind to Bcl2 via the DNA binding
      domain and induce mitochondrial permeabilization.'
    findings: []
  - id: PMID:27031958
    title: 'Nupr1/Chop signal axis is involved in mitochondrion-related endothelial
      cell apoptosis induced by methamphetamine.'
    findings: []
  - id: PMID:28280358
    title: 'miR-204-5p acts as a tumor suppressor by targeting matrix metalloproteinases-9
      and B-cell lymphoma-2 in malignant melanoma.'
    findings: []
  - id: PMID:27673746
    title: 'Apoptotic properties of the type 1 interferon induced family of human
      mitochondrial membrane ISG12 proteins.'
    findings: []
  - id: PMID:1286168
    title: 'The bcl-2 oncogene and apoptosis.'
    findings: []
  - id: PMID:20041405
    title: 'Effects of microRNA-29 on apoptosis, tumorigenicity, and prognosis of
      hepatocellular carcinoma.'
    findings: []
  - id: PMID:21212266
    title: 'BCL-2 is a downstream target of ATF5 that mediates the prosurvival function
      of ATF5 in a cell type-dependent manner.'
    findings: []
  - id: PMID:9660918
    title: 'Bax inhibitor-1, a mammalian apoptosis suppressor identified by functional
      screening in yeast.'
    findings: []
  - id: PMID:36599
    title: '[Isolation of a strain of Streptococcus pneumoniae multiresistant to antibiotics].'
    findings: []
  - id: PMID:8022822
    title: 'Evidence that BCL-2 represses apoptosis by regulating endoplasmic reticulum-associated
      Ca2+ fluxes.'
    findings: []
  - id: PMID:11060313
    title: 'MAP-1, a novel proapoptotic protein containing a BH3-like motif that associates
      with Bax through its Bcl-2 homology domains.'
    findings: []
  - id: PMID:23431138
    title: 'Related F-box proteins control cell death in Caenorhabditis elegans and
      human lymphoma.'
    findings: []
  - id: PMID:18309324
    title: 'Vital functions of apoptotic effectors.'
    findings: []
  - id: PMID:11684014
    title: 'ASPP proteins specifically stimulate the apoptotic function of p53.'
    findings: []
  - id: PMID:8358790
    title: 'Bcl-2 heterodimerizes in vivo with a conserved homolog, Bax, that accelerates
      programmed cell death.'
    findings: []
  - id: PMID:10597216
    title: 'Bis, a Bcl-2-binding protein that synergizes with Bcl-2 in preventing
      cell death.'
    findings: []
  - id: Reactome:R-HSA-114352
    title: BCL2 sequestration of tBID
    findings: []
  - id: Reactome:R-HSA-139897
    title: BAD displacing tBID from BCL2
    findings: []
  - id: Reactome:R-HSA-508163
    title: BH3-only proteins inactivating BCL2
    findings: []
  - id: Reactome:R-HSA-6790025
    title: BCL2 expression
    findings: []
  - id: Reactome:R-HSA-879201
    title: BCL2 binding NLRP1
    findings: []
  - id: Reactome:R-HSA-9011941
    title: Estrogen-responsive BCL2 expression
    findings: []
  - id: Reactome:R-HSA-9623999
    title: BCL2 expression downstream of ESR1
    findings: []
  - id: Reactome:R-HSA-9692376
    title: BCL2 binding antagonists
    findings: []
  - id: Reactome:R-HSA-9796055
    title: NFE2L2-dependent BCL2 expression
    findings: []
  - id: Reactome:R-HSA-9824587
    title: MITF-dependent BCL2 expression
    findings: []
  - id: PMID:15006356
    title: 'A mitochondrial protein, Bit1, mediates apoptosis regulated by integrins
      and Groucho/TLE corepressors.'
    findings: []
  - id: PMID:20849813
    title: 'Prolyl hydroxylase 3 interacts with Bcl-2 to regulate doxorubicin-induced
      apoptosis in H9c2 cells.'
    findings: []
  - id: PMID:19706769
    title: 'Identification of a protein, G0S2, that lacks Bcl-2 homology domains and
      interacts with and antagonizes Bcl-2.'
    findings: []
  - id: PMID:20097879
    title: 'Identification of a novel proapoptotic function of resveratrol in fat
      cells: SIRT1-independent sensitization to TRAIL-induced apoptosis.'
    findings: []
  - id: PMID:20889974
    title: 'Parkin mono-ubiquitinates Bcl-2 and regulates autophagy.'
    findings: []
  - id: PMID:8402648
    title: 'Investigation of the subcellular distribution of the bcl-2 oncoprotein:
      residence in the nuclear envelope, endoplasmic reticulum, and outer mitochondrial
      membranes.'
    findings: []
  - id: PMID:17875758
    title: 'ATM, CTLA4, MNDA, and HEM1 in high versus low CD38 expressing B-cell chronic
      lymphocytic leukemia.'
    findings: []
  - id: PMID:12086670
    title: 'Bcl2 regulation by the melanocyte master regulator Mitf modulates lineage
      survival and melanoma cell viability.'
    findings: []
  - id: PMID:16717086
    title: 'PP2A regulates BCL-2 phosphorylation and proteasome-mediated degradation
      at the endoplasmic reticulum.'
    findings: []
  - id: PMID:7546744
    title: 'Role of BCL-2 in the survival and function of developing and mature sympathetic
      neurons.'
    findings: []
  - id: PMID:7896880
    title: 'The intracellular distribution and pattern of expression of Mcl-1 overlap
      with, but are not identical to, those of Bcl-2.'
    findings: []
  - id: PMID:9305631
    title: 'BAG-1 modulates the chaperone activity of Hsp70/Hsc70.'
    findings: []
  - id: PMID:9184696
    title: 'The apoptosis and proliferation of SAC-activated B cells by IL-10 are
      associated with changes in Bcl-2, Bcl-xL, and Mcl-1 expression.'
    findings: []
  - id: PMID:1373874
    title: 'Bcl-2 confers growth and survival advantage to interleukin 7-dependent
      early pre-B cells which become factor independent by a multistep process in
      culture.'
    findings: []
  - id: PMID:7650367
    title: 'Expression of Bcl-2, Bcl-x, and Bax after T cell activation and IL-2 withdrawal.'
    findings: []
  - id: PMID:7772249
    title: 'Evolutionary conservation of function among mammalian, avian, and viral
      homologs of the Bcl-2 oncoprotein.'
    findings: []
  - id: PMID:8050499
    title: 'bcl-2 gene prevents apoptosis of basic fibroblast growth factor-deprived
      murine aortic endothelial cells.'
    findings: []
  - id: PMID:8080725
    title: 'bcl-2 gene enables rescue from in vitro myelosuppression (bone marrow
      cell death) induced by chemotherapy.'
    findings: []
  - id: PMID:15776018
    title: 'Proapoptotic BAX and BAK control multiple initiator caspases.'
    findings: []
  - id: PMID:16790527
    title: 'Mitochondrial damage due to SOD1 deficiency in SH-SY5Y neuroblastoma cells:
      a rationale for the redundancy of SOD1.'
    findings: []
  - id: PMID:16307838
    title: 'T-2 toxin induces apoptosis, and selenium partly blocks, T-2 toxin induced
      apoptosis in chondrocytes through modulation of the Bax/Bcl-2 ratio.'
    findings: []
  - id: PMID:10620603
    title: 'The HIV-1 viral protein R induces apoptosis via a direct effect on the
      mitochondrial permeability transition pore.'
    findings: []
  - id: PMID:10837489
    title: 'MCL-1S, a splicing variant of the antiapoptotic BCL-2 family member MCL-1,
      encodes a proapoptotic protein possessing only the BH3 domain.'
    findings: []
  - id: PMID:11054413
    title: 'Bcl-G, a novel pro-apoptotic member of the Bcl-2 family.'
    findings: []
  - id: PMID:11126360
    title: 'A novel protein, RTN-XS, interacts with both Bcl-XL and Bcl-2 on endoplasmic
      reticulum and reduces their anti-apoptotic activity.'
    findings: []
  - id: PMID:11278245
    title: 'Bcl-B, a novel Bcl-2 family member that differentially binds and regulates
      Bax and Bak.'
    findings: []
  - id: PMID:11463391
    title: 'PUMA induces the rapid apoptosis of colorectal cancer cells.'
    findings: []
  - id: PMID:12901880
    title: 'BNIPL-2, a novel homologue of BNIP-2, interacts with Bcl-2 and Cdc42GAP
      in apoptosis.'
    findings: []
  - id: PMID:7954800
    title: 'Adenovirus E1B 19 kDa and Bcl-2 proteins interact with a common set of
      cellular proteins.'
    findings: []
  - id: PMID:11530860
    title: 'The immunolocalization of Bcl-2 in human term placenta.'
    findings: []
  - id: PMID:15799693
    title: 'Medium from irradiated cells induces dose-dependent mitochondrial changes
      and BCL2 responses in unirradiated human keratinocytes.'
    findings: []
  - id: PMID:11264898
    title: 'Iron induces Bcl-2 expression in human dermal microvascular endothelial
      cells.'
    findings: []
  - id: PMID:1502141
    title: 'Overexpressed full-length human BCL2 extends the survival of baculovirus-infected
      Sf9 insect cells.'
    findings: []
  - id: PMID:10506221
    title: 'Regulation of acidification and apoptosis by SHP-1 and Bcl-2.'
    findings: []
  - id: PMID:12421819
    title: 'A functional role for nicotine in Bcl2 phosphorylation and suppression
      of apoptosis.'
    findings: []
  - id: PMID:16167175
    title: 'Inhibition of mitochondrial neural cell death pathways by protein transduction
      of Bcl-2 family proteins.'
    findings: []
  - id: PMID:9843949
    title: 'Bax interacts with the permeability transition pore to induce permeability
      transition and cytochrome c release in isolated mitochondria.'
    findings: []
  - id: PMID:1908951
    title: 'Bcl-2 maintains B cell memory.'
    findings: []
  - id: file:human/BCL2/BCL2-deep-research-falcon.md
    title: Deep research report on BCL2
    findings: []
core_functions:
  - description: >
      BCL2's primary evolved function is to prevent apoptosis by blocking MOMP
      and cytochrome c release. This is supported by extensive experimental
      evidence from multiple cell types and organisms.
    molecular_function:
      id: GO:0051434
      label: BH3 domain binding
    directly_involved_in:
      - id: GO:0043066
        label: negative regulation of apoptotic process
      - id: GO:1901029
        label: negative regulation of mitochondrial outer membrane 
          permeabilization involved in apoptotic signaling pathway
    locations:
      - id: GO:0005741
        label: mitochondrial outer membrane
  - description: >
      BCL2 inhibits BAX/BAK pore-forming activity at the OMM, which is central
      to its anti-apoptotic mechanism.
    molecular_function:
      id: GO:0016248
      label: channel inhibitor activity
    directly_involved_in:
      - id: GO:0043066
        label: negative regulation of apoptotic process
    locations:
      - id: GO:0005741
        label: mitochondrial outer membrane
proposed_new_terms: []
suggested_questions:
  - question: Does BCL2's channel-forming activity at acidic pH have 
      physiological relevance, or is it an artifact of artificial membrane 
      systems?
  - question: What is the relative importance of BCL2's function at the ER vs 
      mitochondria in different cellular contexts?
  - question: Should BCL2's autophagy regulation through BECN1 be considered a 
      secondary evolved function or purely crosstalk?
suggested_experiments:
  - description: Structure-function analysis of BCL2 variants that retain BH3 
      binding but lack membrane insertion to dissect OMM vs cytosolic functions
  - description: Live-cell imaging of BCL2-BECN1 vs BCL2-BAX interactions to 
      quantify relative occupancy under different stress conditions

BCL2

Gene Description

Existing Annotations Review

Core Functions

BCL2's primary evolved function is to prevent apoptosis by blocking MOMP and cytochrome c release. This is supported by extensive experimental evidence from multiple cell types and organisms.

BCL2 inhibits BAX/BAK pore-forming activity at the OMM, which is central to its anti-apoptotic mechanism.

References

Suggested Questions for Experts

Suggested Experiments

📚 Additional Documentation

Deep Research Bioreason

BioReason Chat Export

Thinking Trace

Functional Summary

UniProt Summary

InterPro Domains

GO Terms

Deep Research Bioreason Rl

BioReason Chat Export

Thinking Trace

Functional Summary

UniProt Summary

InterPro Domains

GO Terms

Deep Research Falcon

Question

Gene Research for Functional Annotation

⚠️ CRITICAL: Gene/Protein Identification Context

Target Gene/Protein Identity (from UniProt):

MANDATORY VERIFICATION STEPS:

If Gene Symbol is Ambiguous or You Cannot Find Relevant Literature:

Research Target:

Output

Gene Research for Functional Annotation

⚠️ CRITICAL: Gene/Protein Identification Context

Target Gene/Protein Identity (from UniProt):

MANDATORY VERIFICATION STEPS:

If Gene Symbol is Ambiguous or You Cannot Find Relevant Literature:

Research Target:

Citations

Bioreason Rl Review

BioReason-Pro RL Review: BCL2 (human)

Functional Summary Review

Notes on thinking trace

📄 View Raw YAML