CYCS encodes human cytochrome c, a small (105 aa, ~12 kDa) soluble heme-containing electron carrier protein of the mitochondrial intermembrane space. Cytochrome c has two well-established, evolutionarily conserved functions: (1) In the mitochondrial electron transport chain, it shuttles single electrons from Complex III (cytochrome bc1, via its cytochrome c1 subunit) to Complex IV (cytochrome c oxidase), accepting electrons via its covalently bound heme c group. (2) In apoptosis, upon mitochondrial outer membrane permeabilization (MOMP) triggered by pro-apoptotic Bcl-2 family members (BAX/BAK), cytochrome c is released into the cytosol where it binds Apaf-1 to form the apoptosome, activating caspase-9 and triggering the downstream caspase cascade. The heme c prosthetic group is covalently attached via thioether bonds to Cys14 and Cys17 (mature numbering Cys15 and Cys18 in UniProt), with His18 and Met80 as axial ligands to the iron atom. Gain-of-function mutations in CYCS (e.g., G42S) cause thrombocytopenia type 4 (THC4) by enhancing apoptotic activation in the megakaryocyte/platelet lineage. Cytochrome c is one of the most extensively studied proteins in biochemistry and a classic example of a dual-function (moonlighting) protein.
| GO Term | Evidence | Action | Reason |
|---|---|---|---|
|
GO:0009055
electron transfer activity
|
IBA
GO_REF:0000033 |
ACCEPT |
Summary: IBA annotation for electron transfer activity. Cytochrome c is the canonical single-electron carrier of the mitochondrial ETC, shuttling electrons from Complex III to Complex IV via reversible oxidation/reduction of its heme c iron atom. This is one of the two core molecular functions of CYCS and is extremely well established. The IBA annotation is phylogenetically sound as this function is conserved across all eukaryotes (PMID:9515723).
Reason: Electron transfer activity is the primary molecular function of cytochrome c in the respiratory chain. The protein shuttles single electrons between Complex III and Complex IV. This function is conserved across eukaryotes and is phylogenetically well supported by the IBA.
Supporting Evidence:
PMID:9515723
cytochrome c is a pro-apoptotic factor. It is released from its places on the outer surface of the inner mitochondrial membrane at early steps of apoptosis
file:human/CYCS/CYCS-deep-research-falcon.md
cytochrome c shuttles electrons from complex III (cytochrome bc1) to complex IV (cytochrome c oxidase) in the inner mitochondrial membrane cristae region, supporting oxidative phosphorylation
|
|
GO:0006122
mitochondrial electron transport, ubiquinol to cytochrome c
|
IBA
GO_REF:0000033 |
ACCEPT |
Summary: IBA annotation for the biological process of electron transfer from ubiquinol to cytochrome c. This represents the Complex III (cytochrome bc1) reaction in which ubiquinol is oxidized and cytochrome c is reduced. Cytochrome c is the electron acceptor in this reaction, receiving electrons from the cytochrome c1 subunit of Complex III. While CYCS is not a subunit of Complex III, it is an essential participant in this process as the mobile electron carrier that accepts the electrons. The IBA annotation is appropriate as this function is conserved across eukaryotes.
Reason: Cytochrome c is the direct electron acceptor from Complex III. The process of ubiquinol-to- cytochrome c electron transfer requires cytochrome c as the mobile carrier. This is a core biological process annotation that accurately describes one half of CYCS's ETC function.
Supporting Evidence:
file:human/CYCS/CYCS-deep-research-falcon.md
cytochrome c shuttles electrons from complex III (cytochrome bc1) to complex IV (cytochrome c oxidase)
|
|
GO:0005758
mitochondrial intermembrane space
|
IBA
GO_REF:0000033 |
ACCEPT |
Summary: IBA annotation for mitochondrial intermembrane space localization. Cytochrome c resides in the IMS, loosely associated with the inner membrane via electrostatic and hydrophobic interactions including cardiolipin binding. This is the site of its electron transfer function and is conserved across eukaryotes. UniProt confirms this localization: "Mitochondrion intermembrane space. Loosely associated with the inner membrane." The IBA is phylogenetically appropriate.
Reason: Mitochondrial intermembrane space is the primary localization of cytochrome c during its electron transfer function. This is a core CC annotation, well established experimentally and phylogenetically sound.
Supporting Evidence:
PMID:9515723
It is released from its places on the outer surface of the inner mitochondrial membrane
|
|
GO:0006123
mitochondrial electron transport, cytochrome c to oxygen
|
IBA
GO_REF:0000033 |
ACCEPT |
Summary: IBA annotation for the biological process of electron transfer from cytochrome c to oxygen. This represents the Complex IV (cytochrome c oxidase) reaction where cytochrome c donates electrons and molecular oxygen is reduced to water. Cytochrome c is the electron donor in this reaction. As with GO:0006122, CYCS is not a subunit of Complex IV but is an essential participant as the electron donor. The IBA annotation is appropriate.
Reason: Cytochrome c is the direct electron donor to Complex IV. This process requires cytochrome c as the mobile carrier that delivers electrons from Complex III. This is a core biological process annotation for CYCS.
Supporting Evidence:
file:human/CYCS/CYCS-deep-research-falcon.md
cytochrome c shuttles electrons from complex III (cytochrome bc1) to complex IV (cytochrome c oxidase) in the inner mitochondrial membrane cristae region
|
|
GO:0005758
mitochondrial intermembrane space
|
IEA
GO_REF:0000044 |
ACCEPT |
Summary: IEA annotation for mitochondrial intermembrane space based on UniProt subcellular location mapping. Consistent with the IBA annotation for the same term and with direct experimental evidence (IDA from PMID:19393246). Redundant but correct.
Reason: Correct and consistent with IBA and IDA annotations for the same term. IEA mapping from UniProt subcellular location is accurate for this well-characterized localization.
|
|
GO:0006915
apoptotic process
|
IEA
GO_REF:0000043 |
ACCEPT |
Summary: IEA annotation for apoptotic process from UniProt keyword mapping (KW-0053, Apoptosis). Cytochrome c is indeed involved in apoptosis -- upon release from mitochondria it triggers the intrinsic apoptotic pathway. However, GO:0006915 (apoptotic process) is very broad. More specific terms such as GO:0097193 (intrinsic apoptotic signaling pathway) are also annotated. This broad IEA is acceptable alongside the more specific annotations.
Reason: Correct but broad. The role of cytochrome c in apoptosis is well established (PMID:8689682, PMID:9267021, PMID:10206961). More specific child terms are also annotated. It is acceptable for IEA annotations to use broader terms.
|
|
GO:0009055
electron transfer activity
|
IEA
GO_REF:0000002 |
ACCEPT |
Summary: IEA annotation for electron transfer activity from InterPro domain mapping (IPR002327, IPR009056, IPR036909). The cytochrome c domain is a well-characterized electron transfer domain. Consistent with the IBA annotation for the same term.
Reason: Correct and consistent with the IBA annotation. The cytochrome c domain family is defined by its electron transfer function.
|
|
GO:0020037
heme binding
|
IEA
GO_REF:0000002 |
ACCEPT |
Summary: IEA annotation for heme binding from InterPro domain mapping. Cytochrome c contains a covalently bound heme c group attached via thioether bonds to Cys15 and Cys18 (PMID:23150584 per UniProt). This is a core structural feature essential for both electron transfer and the protein's redox properties. Consistent with the TAS annotation from PMID:9515723.
Reason: Heme binding is a core molecular function of cytochrome c. The heme c group is covalently attached and is essential for electron transfer activity.
|
|
GO:0022904
respiratory electron transport chain
|
IEA
GO_REF:0000043 |
ACCEPT |
Summary: IEA annotation for respiratory electron transport chain from UniProt keyword mapping (KW-0679, Respiratory chain). This is broader than the specific IBA annotations for GO:0006122 and GO:0006123 but is correct. Cytochrome c is a key component of the respiratory electron transport chain.
Reason: Correct but general. The specific IBA annotations for Complex III-to-cyt c and cyt c-to-O2 processes are more informative, but this broader term is acceptable for IEA.
|
|
GO:0046872
metal ion binding
|
IEA
GO_REF:0000043 |
ACCEPT |
Summary: IEA annotation for metal ion binding from UniProt keyword mapping (KW-0479, Metal-binding). Cytochrome c contains a heme iron atom coordinated by His18 and Met80 (axial ligands). While technically correct, GO:0046872 is very broad. The more informative annotation is GO:0020037 (heme binding) which captures the specific nature of the metal coordination context. However, iron ion binding is part of the heme function and this IEA is not wrong.
Reason: Technically correct -- cytochrome c binds iron as part of its heme prosthetic group. The more specific GO:0020037 (heme binding) is also annotated. It is acceptable for IEA annotations to use broader terms.
|
|
GO:0005515
protein binding
|
IPI
PMID:10206961 An APAF-1.cytochrome c multimeric complex is a functional ap... |
KEEP AS NON CORE |
Summary: IPI annotation for protein binding with APAF1 (O14727) from Zou et al. 1999. This study reconstituted the apoptosome using purified cytochrome c, recombinant APAF-1, and recombinant procaspase-9, demonstrating direct physical interaction between cytochrome c and APAF-1 (PMID:10206961). This is one of the most biologically significant interactions of CYCS -- cytochrome c binding to Apaf-1 triggers apoptosome assembly and caspase-9 activation. While 'protein binding' is uninformative, the underlying interaction is a core function. A more informative term would be GO:0008656 (cysteine-type endopeptidase activator activity involved in apoptotic process) but that does not fully capture the binding aspect.
Reason: The CYCS-APAF1 interaction is among the most biologically significant known protein-protein interactions, as it initiates apoptosome assembly. However, 'protein binding' is too vague to be informative. The functional significance is better captured by the BP annotation GO:0097193 (intrinsic apoptotic signaling pathway) and the CC annotation for apoptosome.
Supporting Evidence:
PMID:10206961
the binding of cytochrome c promote APAF-1 oligomerization, forming a large multimeric APAF-1.cytochrome c complex
|
|
GO:0005515
protein binding
|
IPI
PMID:25416956 A proteome-scale map of the human interactome network. |
KEEP AS NON CORE |
Summary: IPI annotation for protein binding with KRT40 (Q6A162) from a proteome-scale human interactome study (Rolland et al. 2014). KRT40 is a keratin family member. The biological relevance of a CYCS-KRT40 interaction is unclear and likely represents a non-specific high-throughput detection.
Reason: High-throughput interactome study. The CYCS-KRT40 interaction has no established biological significance. 'Protein binding' is uninformative.
|
|
GO:0005515
protein binding
|
IPI
PMID:25595453 Respiratory complexes III and IV can each bind two molecules... |
KEEP AS NON CORE |
Summary: IPI annotation for protein binding with plant cytochrome c1 (Q9FKS5) from Moreno-Beltran et al. 2015. This study investigated the transient interactions of human cytochrome c with respiratory complexes III and IV using cross-species proteins. The study showed that two molecules of cytochrome c can bind to each complex at low ionic strength, supporting the electron transfer shuttle function (PMID:25595453). This is a functionally relevant interaction, though with a heterologous system.
Reason: Heterologous system study (human cyt c with plant cyt c1). Demonstrates the conserved interaction between cytochrome c and its respiratory chain partners. 'Protein binding' is uninformative but the underlying biology is sound.
Supporting Evidence:
PMID:25595453
two cytochrome c molecules per adduct - at low ionic strength. We conclude that such extra binding sites at the surfaces of complexes III and IV can facilitate the turnover and sliding of cytochrome c molecules
|
|
GO:0005515
protein binding
|
IPI
PMID:25910212 Widespread macromolecular interaction perturbations in human... |
KEEP AS NON CORE |
Summary: IPI annotation for protein binding with KRT40 (Q6A162) from Sahni et al. 2015, a study on macromolecular interaction perturbations in human genetic disorders. Second detection of CYCS-KRT40 interaction. Biological significance remains unclear.
Reason: High-throughput interaction study. Repeated CYCS-KRT40 detection but no established biological significance.
|
|
GO:0005515
protein binding
|
IPI
PMID:28514442 Architecture of the human interactome defines protein commun... |
KEEP AS NON CORE |
Summary: IPI annotation for protein binding with LRG1 (P02750) from Huttlin et al. 2017, the architecture of the human interactome study. LRG1 is a leucine-rich alpha-2-glycoprotein involved in TGF-beta signaling. The biological relevance of this interaction is unclear.
Reason: High-throughput interactome study. CYCS-LRG1 interaction has no established biological significance. 'Protein binding' is uninformative.
|
|
GO:0005515
protein binding
|
IPI
PMID:32296183 A reference map of the human binary protein interactome. |
KEEP AS NON CORE |
Summary: IPI annotation for protein binding with MEOX2 (Q6FHY5) from Luck et al. 2020, a reference map of the human binary protein interactome. MEOX2 is a homeobox transcription factor. The biological relevance of this interaction is unclear.
Reason: High-throughput interactome study. CYCS-MEOX2 interaction has no established biological significance. 'Protein binding' is uninformative.
|
|
GO:0005515
protein binding
|
IPI
PMID:32814053 Interactome Mapping Provides a Network of Neurodegenerative ... |
KEEP AS NON CORE |
Summary: IPI annotation for protein binding from Haenig et al. 2020, an interactome mapping study focused on neurodegenerative disease proteins. This PMID generates multiple GOA entries with different interactors including APP (P05067), SNCA (P37840), FYN (P06241), COA7 (Q96BR5), and many others. The APP and SNCA interactions are biologically interesting given that cytochrome c release and caspase activation are implicated in neurodegeneration. However, most of these are high-throughput detections and 'protein binding' is uninformative.
Reason: Large-scale neurodegenerative disease interactome study with many interactors. Some interactions (APP, SNCA) are potentially biologically interesting but the evidence is from high-throughput screening. 'Protein binding' is uninformative.
|
|
GO:0005515
protein binding
|
IPI
PMID:33961781 Dual proteome-scale networks reveal cell-specific remodeling... |
KEEP AS NON CORE |
Summary: IPI annotation for protein binding with LRG1 (P02750) from Huttlin et al. 2021, dual proteome-scale networks study. Second detection of CYCS-LRG1 interaction.
Reason: High-throughput interactome study. Repeated CYCS-LRG1 detection but no established biological significance.
|
|
GO:0005515
protein binding
|
IPI
PMID:9267021 Apaf-1, a human protein homologous to C. elegans CED-4, part... |
KEEP AS NON CORE |
Summary: IPI annotation for protein binding with APAF1 (O14727) from Zou et al. 1997. This is the landmark paper identifying Apaf-1 as the cytochrome c-binding partner that mediates caspase activation. The study showed that "Cytochrome c binds to Apaf-1, an event that may trigger the activation of caspase-3, leading to apoptosis" (PMID:9267021). This is one of the most important protein interactions discovered for CYCS.
Reason: Landmark paper establishing the CYCS-APAF1 interaction. The biological significance is enormous but 'protein binding' is uninformative. The functional context is captured by GO:0097193 and GO:0097194 annotations.
Supporting Evidence:
PMID:9267021
Cytochrome c binds to Apaf-1, an event that may trigger the activation of caspase-3, leading to apoptosis
|
|
GO:0005739
mitochondrion
|
IDA
GO_REF:0000052 |
ACCEPT |
Summary: IDA annotation for mitochondrial localization from HPA immunofluorescence data curation. Cytochrome c is a well-established mitochondrial protein. The mitochondrial intermembrane space (GO:0005758) is the more specific localization, but the broader mitochondrion annotation is also correct.
Reason: Correct localization supported by immunofluorescence. A broader term than GO:0005758 but still accurate.
|
|
GO:0097193
intrinsic apoptotic signaling pathway
|
NAS
PMID:10206961 An APAF-1.cytochrome c multimeric complex is a functional ap... |
ACCEPT |
Summary: NAS annotation from ComplexPortal for the intrinsic apoptotic signaling pathway. Zou et al. 1999 (PMID:10206961) reconstituted the apoptosome from purified cytochrome c, APAF-1, and procaspase-9, directly demonstrating that cytochrome c is a key activator of the intrinsic apoptotic pathway. This is a core biological process for CYCS.
Reason: The intrinsic apoptotic signaling pathway is one of the two core biological processes for CYCS. Cytochrome c triggers apoptosome assembly by binding APAF-1, which leads to caspase-9 activation. This is extensively supported by multiple landmark studies.
Supporting Evidence:
PMID:10206961
the binding of cytochrome c promote APAF-1 oligomerization, forming a large multimeric APAF-1.cytochrome c complex. Such a complex can be isolated using gel filtration chromatography and is by itself sufficient to recruit and activate procaspase-9
|
|
GO:0097190
apoptotic signaling pathway
|
ISS
PMID:12107093 Microinjection of cathepsin d induces caspase-dependent apop... |
ACCEPT |
Summary: ISS annotation for apoptotic signaling pathway, inferred from mouse ortholog (UniProtKB:P00004). Roberg et al. 2002 (PMID:12107093) showed that cathepsin D injection causes apoptosis with cytochrome c redistribution and caspase activation. The ISS from mouse is appropriate since the apoptotic function of cytochrome c is conserved across mammals. However, this is a broader term than GO:0097193 (intrinsic apoptotic signaling pathway) which is already annotated. Both are acceptable.
Reason: Correct but broader than GO:0097193. The apoptotic signaling function of cytochrome c is conserved in mouse, making the ISS transfer appropriate.
Supporting Evidence:
PMID:12107093
microinjection of cathepsin D into the cytosol of human fibroblasts caused apoptosis, which was detected as changes in distribution of cytochrome c, cell shrinkage, activation of caspases
|
|
GO:0005739
mitochondrion
|
HTP
PMID:34800366 Quantitative high-confidence human mitochondrial proteome an... |
ACCEPT |
Summary: HTP annotation for mitochondrial localization from Morgenstern et al. 2021, a quantitative high-confidence human mitochondrial proteome study. Cytochrome c was identified in the mitochondrial proteome. Correct but less specific than GO:0005758.
Reason: Correct. Cytochrome c is a well-established mitochondrial protein. Confirmed by this high-confidence proteomics study.
|
|
GO:0005743
mitochondrial inner membrane
|
TAS
Reactome:R-HSA-163214 |
ACCEPT |
Summary: TAS annotation from Reactome pathway R-HSA-163214 (Electron transfer from reduced cytochrome c to molecular oxygen). Cytochrome c is associated with the inner mitochondrial membrane in the intermembrane space, where it interacts with Complex III and Complex IV embedded in the inner membrane. However, cytochrome c is a soluble protein of the IMS, not an integral or peripheral inner membrane protein. GO:0005758 (mitochondrial intermembrane space) is more accurate than GO:0005743. That said, UniProt notes cytochrome c is "Loosely associated with the inner membrane" via electrostatic and cardiolipin interactions, so this annotation is not entirely wrong.
Reason: While GO:0005758 (mitochondrial intermembrane space) is the more precise localization, cytochrome c is indeed loosely associated with the inner membrane surface via cardiolipin binding. Reactome correctly places it in the context of inner membrane electron transport.
Supporting Evidence:
file:human/CYCS/CYCS-deep-research-falcon.md
cytochrome c is localized to the mitochondrial intermembrane space (IMS), associated with the inner mitochondrial membrane via electrostatic and hydrophobic interactions, including binding to cardiolipin-rich cristae surfaces
|
|
GO:0005743
mitochondrial inner membrane
|
TAS
Reactome:R-HSA-164651 |
ACCEPT |
Summary: TAS from Reactome R-HSA-164651 (Electron transfer from ubiquinol to cytochrome c of complex III). Same reasoning as above -- cytochrome c is loosely associated with the inner membrane during electron transfer.
Reason: Consistent with the Reactome annotation for Complex III reaction context. Cytochrome c is associated with the inner membrane surface during its electron carrier function.
|
|
GO:0005743
mitochondrial inner membrane
|
TAS
Reactome:R-HSA-3341294 |
ACCEPT |
Summary: TAS from Reactome R-HSA-3341294 (Superoxide reduces cytochrome c). This reaction occurs in the IMS at the inner membrane surface. Same reasoning as above.
Reason: Consistent with inner membrane association during superoxide scavenging by cytochrome c in the IMS.
|
|
GO:0005743
mitochondrial inner membrane
|
TAS
Reactome:R-HSA-9866217 |
ACCEPT |
Summary: TAS from Reactome R-HSA-9866217 (HCCS inserts heme into cytochrome c). HCCS is the holocytochrome c synthase that catalyzes heme attachment to apocytochrome c at the inner membrane. The heme insertion occurs at or near the inner membrane in the IMS.
Reason: Appropriate localization for the heme attachment reaction catalyzed by HCCS at the inner membrane.
|
|
GO:0097194
execution phase of apoptosis
|
TAS
PMID:9267021 Apaf-1, a human protein homologous to C. elegans CED-4, part... |
MODIFY |
Summary: TAS annotation for the execution phase of apoptosis, citing Zou et al. 1997 (PMID:9267021). This landmark paper identified Apaf-1 and showed that cytochrome c binding to Apaf-1 leads to caspase-3 activation, which is the execution phase of apoptosis. However, cytochrome c's direct role is in the initiation/signaling phase (binding Apaf-1, activating caspase-9) rather than the execution phase per se (which involves effector caspases cleaving cellular substrates). CYCS acts upstream of execution. GO:0097193 (intrinsic apoptotic signaling pathway) is the more appropriate process term.
Reason: Cytochrome c participates in the initiation of apoptosis by binding Apaf-1 and activating caspase-9. The execution phase (caspase-3/7-mediated substrate cleavage) occurs downstream of cytochrome c's direct action. GO:0097193 (intrinsic apoptotic signaling pathway) more accurately describes CYCS's role. The existing annotation for GO:0097193 already captures this.
Proposed replacements:
intrinsic apoptotic signaling pathway
Supporting Evidence:
PMID:9267021
Cytochrome c binds to Apaf-1, an event that may trigger the activation of caspase-3, leading to apoptosis
|
|
GO:0005739
mitochondrion
|
IDA
PMID:12107093 Microinjection of cathepsin d induces caspase-dependent apop... |
ACCEPT |
Summary: IDA annotation for mitochondrial localization from Roberg et al. 2002 (PMID:12107093). This study on cathepsin D-induced apoptosis showed cytochrome c redistribution from mitochondria to cytosol, confirming its mitochondrial localization. Correct.
Reason: The study directly observed cytochrome c distribution, confirming mitochondrial localization.
Supporting Evidence:
PMID:12107093
apoptosis, which was detected as changes in distribution of cytochrome c
|
|
GO:0005829
cytosol
|
IDA
PMID:12107093 Microinjection of cathepsin d induces caspase-dependent apop... |
ACCEPT |
Summary: IDA annotation for cytosol localization from Roberg et al. 2002 (PMID:12107093). Cytochrome c was observed in the cytosol during apoptosis, having been released from mitochondria. This is a condition-specific localization (apoptosis) rather than a steady-state localization. However, it is functionally significant as cytosolic cytochrome c triggers the intrinsic apoptotic pathway.
Reason: Cytosolic localization of cytochrome c is condition-specific (during apoptosis) but biologically significant. It is the site where cytochrome c exerts its apoptotic signaling function by binding Apaf-1.
Supporting Evidence:
PMID:12107093
changes in distribution of cytochrome c, cell shrinkage, activation of caspases
|
|
GO:0005758
mitochondrial intermembrane space
|
IDA
PMID:19393246 Knockdown of human COX17 affects assembly and supramolecular... |
ACCEPT |
Summary: IDA annotation for mitochondrial intermembrane space from CAFA, citing Oswald et al. 2009 (PMID:19393246). This study focused on COX17 knockdown and its effects on cytochrome c oxidase assembly and supercomplex organization. While the study's primary focus is COX17, it involves cytochrome c in the context of respiratory supercomplexes in the IMS. Cytochrome c IMS localization is well established independently.
Reason: Correct localization. The IMS is the established location of cytochrome c. While this particular study focuses on COX17, the IMS localization of cytochrome c is confirmed by many independent studies.
Supporting Evidence:
PMID:19393246
Assembly of cytochrome c oxidase, the terminal enzyme of the mitochondrial respiratory chain, requires a concerted activity of a number of chaperones and factors
|
|
GO:0005758
mitochondrial intermembrane space
|
TAS
Reactome:R-HSA-5688294 |
ACCEPT |
Summary: TAS from Reactome R-HSA-5688294 (SIRT5 deacetylates Cytochrome C). This places cytochrome c in the IMS where SIRT5 deacetylation occurs. Correct localization.
Reason: Correct. Cytochrome c resides in the IMS and is subject to post-translational modifications including deacetylation.
|
|
GO:0005634
nucleus
|
HDA
PMID:21630459 Proteomic characterization of the human sperm nucleus. |
MARK AS OVER ANNOTATED |
Summary: HDA annotation for nuclear localization from de Mateo et al. 2011 (PMID:21630459), a proteomic characterization of the human sperm nucleus. Cytochrome c was identified among 403 proteins in isolated sperm nuclei. This is a high-throughput mass spectrometry detection and may represent contamination or a sperm-specific localization artifact. Sperm nuclei are extremely compact structures and the biological significance of cytochrome c in the nucleus is unclear and unlikely to represent a functional localization.
Reason: Cytochrome c is a mitochondrial IMS protein. Its detection in sperm nuclei by mass spectrometry is likely due to contamination from the midpiece mitochondrial sheath, which is extremely close to the sperm nucleus. There is no established functional role for cytochrome c in the nucleus. This does not represent a meaningful localization.
Supporting Evidence:
PMID:21630459
sperm nuclei were obtained through CTAB treatment and isolated to over 99.9% purity without any tail fragments, acrosome or mitochondria
|
|
GO:0005739
mitochondrion
|
IDA
PMID:20671748 Bcl-2 family interaction with the mitochondrial morphogenesi... |
ACCEPT |
Summary: IDA annotation for mitochondrial localization from Cleland et al. 2011 (PMID:20671748), a study on Bcl-2 family interaction with mitochondrial morphogenesis machinery. This study examined Bax/Bak-dependent mitochondrial dynamics and would have observed cytochrome c in mitochondrial contexts. Correct localization.
Reason: Correct. Cytochrome c is a well-established mitochondrial protein.
|
|
GO:0005739
mitochondrion
|
HDA
PMID:20833797 Phosphoproteome analysis of functional mitochondria isolated... |
ACCEPT |
Summary: HDA annotation for mitochondrial localization from a phosphoproteome analysis of functional mitochondria isolated from resting human muscle (Zhao et al. 2011). Cytochrome c was identified in the mitochondrial proteome. Correct.
Reason: Correct. Cytochrome c identified in purified mitochondrial preparations by mass spectrometry.
|
|
GO:0005758
mitochondrial intermembrane space
|
TAS
Reactome:R-HSA-114284 |
ACCEPT |
Summary: TAS from Reactome R-HSA-114284 (Release of Cytochrome c from mitochondria). This Reactome entry describes the release of cytochrome c from the IMS during apoptosis. Correct localization for the starting point of the apoptotic release event.
Reason: Correct. Cytochrome c resides in the IMS prior to release during apoptosis.
|
|
GO:0005829
cytosol
|
TAS
Reactome:R-HSA-114252 |
ACCEPT |
Summary: TAS from Reactome R-HSA-114252 (Cleavage of Procaspase-3 by the apoptosome). Cytochrome c is in the cytosol as part of the apoptosome during caspase-3 activation. Correct condition-specific localization during apoptosis.
Reason: Correct. Cytochrome c is in the cytosol during apoptosis as part of the apoptosome complex.
|
|
GO:0005829
cytosol
|
TAS
Reactome:R-HSA-114254 |
ACCEPT |
Summary: TAS from Reactome R-HSA-114254 (CYCS binds to APAF1). Cytochrome c binds Apaf-1 in the cytosol to initiate apoptosome formation. Correct.
Reason: Correct. The cytochrome c-Apaf-1 binding event occurs in the cytosol.
|
|
GO:0005829
cytosol
|
TAS
Reactome:R-HSA-114256 |
ACCEPT |
Summary: TAS from Reactome R-HSA-114256 (CYCS:APAF1 binds procaspase-9). Apoptosome formation in the cytosol. Correct.
Reason: Correct. Apoptosome assembly occurs in the cytosol.
|
|
GO:0005829
cytosol
|
TAS
Reactome:R-HSA-114259 |
ACCEPT |
Summary: TAS from Reactome R-HSA-114259 (Cleavage of Procaspase-9 to caspase-9). Caspase-9 activation within the cytosolic apoptosome. Correct.
Reason: Correct. Caspase-9 activation occurs in the cytosol within the apoptosome.
|
|
GO:0005829
cytosol
|
TAS
Reactome:R-HSA-114261 |
ACCEPT |
Summary: TAS from Reactome R-HSA-114261 (Cleavage of Procaspase-7 by the apoptosome). Apoptosome function in the cytosol. Correct.
Reason: Correct. Effector caspase activation by the apoptosome occurs in the cytosol.
|
|
GO:0005829
cytosol
|
TAS
Reactome:R-HSA-114284 |
ACCEPT |
Summary: TAS from Reactome R-HSA-114284 (Release of Cytochrome c from mitochondria). This is the same Reactome entry used for the IMS annotation above. The cytosol annotation reflects where cytochrome c ends up after release. Correct.
Reason: Correct. Cytochrome c is released into the cytosol during apoptosis.
|
|
GO:0005829
cytosol
|
TAS
Reactome:R-HSA-1592231 |
ACCEPT |
Summary: TAS from Reactome R-HSA-1592231 (Expression of CYCS). Cytochrome c is synthesized in the cytosol before import into mitochondria. Correct in the context of protein synthesis, though the functional localization is the IMS.
Reason: Correct. Cytochrome c is synthesized in the cytosol as apocytochrome c before mitochondrial import.
|
|
GO:0005829
cytosol
|
TAS
Reactome:R-HSA-6804596 |
ACCEPT |
Summary: TAS from Reactome R-HSA-6804596 (APAF1:CYCS binds APIP). Describes APIP binding to the Apaf-1:cytochrome c complex in the cytosol. Correct.
Reason: Correct. This interaction occurs in the cytosol during apoptotic signaling.
|
|
GO:0005829
cytosol
|
TAS
Reactome:R-HSA-9627056 |
ACCEPT |
Summary: TAS from Reactome R-HSA-9627056 (Procaspase 9 forms dimer). Dimerization of procaspase-9 in the cytosol within the apoptosome context. Correct.
Reason: Correct. Part of the apoptosome signaling cascade in the cytosol.
|
|
GO:0005829
cytosol
|
TAS
Reactome:R-HSA-9627078 |
ACCEPT |
Summary: TAS from Reactome R-HSA-9627078 (XIAP binds CASP9). Regulation of caspase-9 by XIAP in the cytosol. Correct.
Reason: Correct. Part of the apoptosis regulatory network in the cytosol.
|
|
GO:0005829
cytosol
|
TAS
Reactome:R-HSA-9627089 |
ACCEPT |
Summary: TAS from Reactome R-HSA-9627089 (CASP9 is phosphorylated at T412). Post-translational modification of caspase-9 in the cytosol. Correct.
Reason: Correct. Part of the apoptosis regulatory network in the cytosol.
|
|
GO:0005634
nucleus
|
IDA
GO_REF:0000054 |
MARK AS OVER ANNOTATED |
Summary: IDA annotation from LIFEdb, based on curation of intracellular localizations of expressed fusion proteins in living cells. LIFEdb generates GFP-fusion proteins and observes their localization. Nuclear localization of a CYCS-GFP fusion is likely an artifact of the overexpression/fusion system. Cytochrome c is a small protein (12 kDa) that could diffuse through nuclear pores, especially when overexpressed as a GFP fusion. There is no established functional role for cytochrome c in the nucleus.
Reason: LIFEdb GFP-fusion protein localization. Small proteins like cytochrome c (12 kDa) can passively diffuse through nuclear pores when overexpressed as fusion constructs. This is likely an artifact and does not represent a functional nuclear localization. The canonical localization of cytochrome c is the mitochondrial IMS.
|
|
GO:0020037
heme binding
|
TAS
PMID:9515723 Cytochrome c in the apoptotic and antioxidant cascades. |
ACCEPT |
Summary: TAS annotation for heme binding from Skulachev 1998 (PMID:9515723), a review on cytochrome c in apoptotic and antioxidant cascades. The heme c group is covalently bound to Cys15 and Cys18 via thioether bonds, with His18 and Met80 as axial iron ligands. This is a core molecular function of CYCS essential for electron transfer activity.
Reason: Heme binding is a defining structural and functional feature of cytochrome c. The covalent heme attachment is essential for its electron carrier function. Well supported by structural and biochemical evidence.
Supporting Evidence:
PMID:9515723
cytochrome c is a pro-apoptotic factor. It is released from its places on the outer surface of the inner mitochondrial membrane
|
|
GO:0005758
mitochondrial intermembrane space
|
TAS
PMID:8689682 Induction of apoptotic program in cell-free extracts: requir... |
ACCEPT |
Summary: TAS annotation for mitochondrial IMS localization from Liu et al. 1996 (PMID:8689682), the landmark paper demonstrating that cytochrome c is required for in vitro apoptosis. The study showed that cells undergoing apoptosis release cytochrome c from mitochondria to the cytosol, establishing its starting location in the IMS.
Reason: This landmark paper established the role of cytochrome c in apoptosis and confirmed its mitochondrial localization prior to release during apoptosis.
Supporting Evidence:
PMID:8689682
Cells undergoing apoptosis in vivo showed increased release of cytochrome c to their cytosol, suggesting that mitochondria may function in apoptosis by releasing cytochrome c
|
|
GO:0005829
cytosol
|
IMP
PMID:8689682 Induction of apoptotic program in cell-free extracts: requir... |
ACCEPT |
Summary: IMP annotation for cytosol localization from Liu et al. 1996 (PMID:8689682). The study demonstrated that addition of cytochrome c to cytosol activates the apoptotic program, and that cells undergoing apoptosis release cytochrome c to their cytosol. The IMP evidence is appropriate because the mutant phenotype (apoptosis) requires cytochrome c presence in the cytosol.
Reason: Landmark experimental demonstration that cytochrome c in the cytosol activates apoptosis. The cytosolic localization is condition-specific but functionally essential for the apoptotic signaling role.
Supporting Evidence:
PMID:8689682
A cell-free system based on cytosols of normally growing cells is established that reproduces aspects of the apoptotic program in vitro...protein sequence revealed that this protein is cytochrome c
|
|
GO:0045333
cellular respiration
|
TAS
PMID:10383829 A soluble version of the receptor-like protein tyrosine phos... |
ACCEPT |
Summary: TAS annotation for cellular respiration from Drosopoulos et al. 1999 (PMID:10383829). However, this publication is about RPTPkappa (receptor-like protein tyrosine phosphatase kappa) stimulating neurite outgrowth. It has no apparent connection to cytochrome c or cellular respiration. This reference appears to be incorrectly linked to this annotation. Nevertheless, the biological process annotation itself is correct -- cytochrome c is essential for cellular respiration as the electron carrier between Complex III and IV.
Reason: The GO term cellular respiration is correct for CYCS, as it is an essential component of the mitochondrial electron transport chain. The reference PMID:10383829 appears to be incorrectly linked (it is about RPTPkappa signaling, not cytochrome c), but the annotation itself is valid and supported by extensive other evidence.
Supporting Evidence:
PMID:9515723
The reduced cytochrome c is oxidized by cytochrome oxidase
|
|
GO:0043293
apoptosome
|
IPI
PMID:10206961 An APAF-1.cytochrome c multimeric complex is a functional ap... |
NEW |
Summary: Cytochrome c is a structural component of the apoptosome, a multisubunit complex composed of Apaf-1, cytochrome c, and procaspase-9. Zou et al. 1999 (PMID:10206961) demonstrated that cytochrome c binds Apaf-1 to form a multimeric complex that recruits and activates procaspase-9. This CC annotation is present in the UniProt GO section (IPI:ComplexPortal) but was not in the GOA TSV used to generate this review. It should be added as it captures a core component annotation for the apoptotic function.
Reason: Cytochrome c is a bona fide component of the apoptosome. The apoptosome annotation (GO:0043293) is listed in UniProt for this protein and accurately captures its structural role in apoptotic signaling. This is an important CC annotation complementing the BP annotation GO:0097193.
Supporting Evidence:
PMID:10206961
APAF-1 oligomerization, forming a large multimeric APAF-1.cytochrome c complex. Such a complex can be isolated using gel filtration chromatography and is by itself sufficient to recruit and activate procaspase-9. The stoichiometric ratio of procaspase-9 to APAF-1 is approximately 1 to 1 in the complex
|
The research report should be a detailed narrative explaining the function, biological processes, and localization of the gene product. Citations should be given for all claims.
You should prioritize authoritative reviews and primary scientific literature when conducting research. You can supplement
this with annotations you find in gene/protein databases, but these can be outdated or inaccurate.
We are specifically interested in the primary function of the gene - for enzymes, what reaction is catalyzed, and what is the substrate specificity? For transporters, what is the substrate? For structural proteins or adapters, what is the broader structural role? For signaling molecules, what is the role in the pathway.
We are interested in where in or outside the cell the gene product carries out its function.
We are also interested in the signaling or biochemical pathways in which the gene functions. We are less interested in broad pleiotropic effects, except where these elucidate the precise role.
Include evidence where possible. We are interested in both experimental evidence as well as inference from structure, evolution, or bioinformatic analysis. Precise studies should be prioritized over high-throughput, where available.
Research plan status: We verified the target identity (CYCS; UniProt P99999) and proceeded to compile recent, authoritative evidence on function, localization, pathways, cardiolipin interactions, and clinical applications. Some 2023–2024 subtopics (e.g., human CYCS variant THC4 and quantitative biomarker statistics) were not captured in the retrieved literature; we therefore provide partial coverage for those items and indicate gaps.
Gene/protein identity verification and core definitions
- Identity and nomenclature: CYCS encodes human cytochrome c, a small heme c protein in the cytochrome c family that functions in mitochondrial respiration and intrinsic apoptosis. The retrieved 2024 review explicitly frames cytochrome c as the electron carrier of the respiratory chain and a central mediator of apoptosome formation with Apaf-1, consistent with the UniProt description and the cytochrome c-like domain architecture provided (URL: https://doi.org/10.1016/j.jsps.2024.102194; 2024-12) (alshehri2024cytochromecand pages 1-2, alshehri2024cytochromecand pages 3-5).
- Primary molecular functions: (1) Electron transfer: cytochrome c shuttles electrons from complex III (cytochrome bc1) to complex IV (cytochrome c oxidase) in the inner mitochondrial membrane cristae region, supporting oxidative phosphorylation. (2) Apoptosis: upon mitochondrial outer membrane permeabilization (MOMP), cytochrome c is released into the cytosol where it binds Apaf-1 to assemble the apoptosome and activate caspase-9, leading to downstream effector caspase activation. Both roles are supported in 2024 synthesis and earlier canonical literature cited therein (URL: https://doi.org/10.1016/j.jsps.2024.102194; 2024-12) (alshehri2024cytochromecand pages 2-3, alshehri2024cytochromecand pages 3-5, alshehri2024cytochromecand pages 11-11, alshehri2024cytochromecand pages 11-12).
Subcellular localization and structural context
- Basal localization: cytochrome c is localized to the mitochondrial intermembrane space (IMS), associated with the inner mitochondrial membrane via electrostatic and hydrophobic interactions, including binding to cardiolipin-rich cristae surfaces. Its mobility enables rapid electron transfer between complex III and IV organized in respirasomes on cristae membranes (URL: https://doi.org/10.1038/s42255-023-00904-w; 2023-10; and https://doi.org/10.1016/j.jsps.2024.102194; 2024-12) (guhathakurta2023cox17acetylationvia pages 3-4, alshehri2024cytochromecand pages 1-2).
- Release during intrinsic apoptosis: following MOMP (BAX/BAK-dependent), cytochrome c translocates to the cytosol (and later can appear extracellularly), initiating apoptosome formation. Time-resolved release and cytosolic signaling are summarized in recent review material (URL: https://doi.org/10.1016/j.jsps.2024.102194; 2024-12) (alshehri2024cytochromecand pages 3-5, alshehri2024cytochromecand pages 2-3).
Pathways and interactions
- Respiratory chain (ETC): cytochrome c mediates electron flow from complex III to complex IV in cristae, with complex IV integrity and cristae architecture tightly linked to OXPHOS efficiency. Recent 2023 work shows that perturbation of complex IV assembly (via impaired COX17 acetylation by the MOF–KANSL complex) compromises respiratory supercomplexes and cristae structure, thereby impacting the environment where cytochrome c operates (URL: https://doi.org/10.1038/s42255-023-00904-w; 2023-10) (guhathakurta2023cox17acetylationvia pages 3-4).
- Intrinsic apoptosis: cytosolic cytochrome c + Apaf-1 → apoptosome → caspase-9 activation → caspase-3/7. This central pathway is reiterated in 2024 synthesis and linked to historic mechanistic studies (URL: https://doi.org/10.1016/j.jsps.2024.102194; 2024-12) (alshehri2024cytochromecand pages 11-11, alshehri2024cytochromecand pages 3-5, alshehri2024cytochromecand pages 11-12).
Cardiolipin interactions and peroxidase activity (recent insights)
- Mechanistic role of cardiolipin (CL): cytochrome c binds anionic cardiolipin on the inner mitochondrial membrane. Oxidative modification of CL reduces its affinity for cytochrome c and facilitates its detachment and release during apoptosis and neurotrauma. 2024 review summarizes lipidomic and injury-model evidence (TBI/SCI) showing CL loss/oxidation, concurrent cytosolic release of cytochrome c and caspase activation, and the potential of CL as a biomarker (URL: https://doi.org/10.3390/cells13070609; 2024-03-27) (fuentes2024theroleof pages 10-12).
- Peroxidase activity switch: the cytochrome c–cardiolipin complex acquires peroxidase-like activity that promotes CL oxidation, amplifying mitochondrial permeabilization and apoptosis. 2024 review notes that SS-31 (elamipretide), a CL-interacting tetrapeptide, “prevents the conversion of cytochrome c into a peroxidase,” highlighting a druggable aspect of this interaction (URL: https://doi.org/10.3390/cells13070609; 2024-03-27) (fuentes2024theroleof pages 10-12). Additional 2024 synthesis corroborates CL peroxidation as a release mechanism (URL: https://doi.org/10.1016/j.jsps.2024.102194; 2024-12) (alshehri2024cytochromecand pages 2-3, alshehri2024cytochromecand pages 3-5, alshehri2024cytochromecand pages 8-8).
Post-translational modifications (PTMs)
- Overview: Recent synthesis indicates that cytochrome c function is modulated by PTMs (e.g., phosphorylation, acetylation, and oxidative modifications), which can alter its redox properties, Apaf-1 interactions, and apoptogenic potential. Specific phosphorylation instances (e.g., threonine or tyrosine residues) have been linked to altered apoptotic signaling in prior literature summarized in 2024 review (URL: https://doi.org/10.1016/j.jsps.2024.102194; 2024-12) (alshehri2024cytochromecand pages 11-11, alshehri2024cytochromecand pages 8-8).
- 2023–2024 mitochondrial acetylation landscape context: While not a PTM on cytochrome c itself, 2023 work revealed mitochondrial protein acetylation (MOF–KANSL-dependent) as a regulatory axis that maintains complex IV assembly and cristae integrity (via COX17 acetylation). This provides an updated framework for how respiratory chain context—and thus cytochrome c electron transfer—can be tuned by PTMs at the organelle level (URL: https://doi.org/10.1038/s42255-023-00904-w; 2023-10) (guhathakurta2023cox17acetylationvia pages 3-4).
Human disease associations and applications
- Broad disease relevance: Altered cytochrome c localization and abundance are reported across cancer and injury contexts. The 2024 synthesis notes reduced cytochrome c levels in multiple tumor tissues and dynamic increases in serum after therapy, consistent with apoptosis induction. It also catalogs reports of elevated circulating cytochrome c in inflammatory arthritis, myocardial infarction, and liver disease, and experimental cardioprotection by exogenous cytochrome c in septic models (URL: https://doi.org/10.1016/j.jsps.2024.102194; 2024-12) (alshehri2024cytochromecand pages 2-3, alshehri2024cytochromecand pages 8-8).
- Thrombocytopenia 4 (THC4; CYCS variants): We were unable to retrieve recent (2023–2024) human-primary literature explicitly detailing CYCS germline variants in THC4 within the current evidence set. THC4 is historically associated with gain-of-function apoptosis sensitization in megakaryocyte/platelet lineages due to CYCS mutations; however, we cannot cite 2023–2024 updates or case statistics from the sources retrieved here. This portion is therefore incomplete pending targeted retrieval (no source in current set).
Circulating cytochrome c as a biomarker (evidence and data)
- Concept and evidence: The 2024 review collates observations of circulating cytochrome c in human disease (e.g., after myocardial infarction and in inflammatory conditions) and its emergence as a prognostic/theranostic marker in oncology (post-chemotherapy increases correlating with tumor cell death) (URL: https://doi.org/10.1016/j.jsps.2024.102194; 2024-12) (alshehri2024cytochromecand pages 2-3, alshehri2024cytochromecand pages 8-8, alshehri2024cytochromecand pages 3-5).
- Quantitative statistics: Specific contemporary (2023–2024) AUCs, thresholds, or prognostic hazard ratios for sepsis, trauma, or cardiogenic shock were not available in the captured evidence. Accordingly, we refrain from quantitative claims and highlight this as a gap for future curation.
Expert perspectives and structural/pathway updates (2023–2024)
- Structure–function of the respiratory apparatus: 2023 mechanistic evidence shows mitochondrial acetylation by MOF–KANSL governs complex IV assembly and respirasome integrity, thereby shaping the cristae environment and electron-transfer landscape in which cytochrome c operates (URL: https://doi.org/10.1038/s42255-023-00904-w; 2023-10) (guhathakurta2023cox17acetylationvia pages 3-4).
- Apoptosome structural updates: The 2024 review references the classical Apaf-1–cytochrome c apoptosome paradigm but our retrieved set did not include the newest (2023–2024) high-resolution human apoptosome structures; thus, we provide pathway-level synthesis without structural novelties (URL: https://doi.org/10.1016/j.jsps.2024.102194; 2024-12) (alshehri2024cytochromecand pages 11-11, alshehri2024cytochromecand pages 11-12).
Real-world implementations and therapeutics
- Mitochondria-targeted cardiolipin modulators: SS-31 (elamipretide) is highlighted as interacting with cardiolipin to prevent the peroxidase conversion of cytochrome c, a mechanism with translational promise in diseases characterized by CL oxidation and mitochondrial dysfunction (URL: https://doi.org/10.3390/cells13070609; 2024-03-27) (fuentes2024theroleof pages 10-12).
- Clinical and preclinical contexts: The 2024 synthesis points to use-cases where circulating cytochrome c informs on tissue injury and therapy response, and notes experimental administration of cytochrome c in septic models; these underscore biomarker and interventional possibilities that are currently condition- and study-specific (URL: https://doi.org/10.1016/j.jsps.2024.102194; 2024-12) (alshehri2024cytochromecand pages 2-3, alshehri2024cytochromecand pages 8-8).
Selected data points from recent sources
- Cardiolipin loss/oxidation in injury: 2024 review summarizes SCI models with ~50% reductions in specific cardiolipin species concomitant with release of cytochrome c and caspase-3 activation, supporting the CL–cytochrome c peroxidase/release axis; precise species-level lipidomics and model details are compiled therein (URL: https://doi.org/10.3390/cells13070609; 2024-03-27) (fuentes2024theroleof pages 10-12).
- Mitochondrial architecture and ETC integrity: 2023 study shows loss of MOF–KANSL function reduces cardiolipin species, diminishes complex IV and respiratory supercomplexes, and increases mitochondrial ROS while fragmenting cristae—conditions that would impede efficient cytochrome c electron transfer (URL: https://doi.org/10.1038/s42255-023-00904-w; 2023-10) (guhathakurta2023cox17acetylationvia pages 3-4).
Conclusions
- CYCS encodes human cytochrome c, a dual-role protein indispensable for mitochondrial respiration and intrinsic apoptosis. 2023–2024 literature reinforces the centrality of cardiolipin–cytochrome c interactions and their peroxidase-driven remodeling in apoptosis and neurotrauma, and highlights organelle-level PTM regulation that shapes the respiratory environment. Circulating cytochrome c continues to emerge as a biomarker of cellular injury and therapy response. However, specific 2023–2024 updates on CYCS variant-associated thrombocytopenia (THC4) and rigorous quantitative biomarker statistics for sepsis/trauma/cardiogenic shock were not captured here and warrant targeted follow-up.
Cited sources (URLs and dates)
- Alshehri B. Cytochrome c and cancer cell metabolism: A new perspective. Saudi Pharmaceutical Journal. 2024-12. URL: https://doi.org/10.1016/j.jsps.2024.102194 (alshehri2024cytochromecand pages 1-2, alshehri2024cytochromecand pages 3-5, alshehri2024cytochromecand pages 2-3, alshehri2024cytochromecand pages 11-11, alshehri2024cytochromecand pages 8-8, alshehri2024cytochromecand pages 11-12)
- Guhathakurta S, Erdogdu NU, Hoffmann JJ, et al. COX17 acetylation via MOF–KANSL complex promotes mitochondrial integrity and function. Nature Metabolism. 2023-10. URL: https://doi.org/10.1038/s42255-023-00904-w (guhathakurta2023cox17acetylationvia pages 3-4)
- Fuentes JM, Morcillo P. The Role of Cardiolipin in Mitochondrial Function and Neurodegenerative Diseases. Cells. 2024-03-27. URL: https://doi.org/10.3390/cells13070609 (fuentes2024theroleof pages 10-12)
References
(alshehri2024cytochromecand pages 1-2): Bader Alshehri. Cytochrome c and cancer cell metabolism: a new perspective. Saudi Pharmaceutical Journal, 32:102194, Dec 2024. URL: https://doi.org/10.1016/j.jsps.2024.102194, doi:10.1016/j.jsps.2024.102194. This article has 21 citations and is from a poor quality or predatory journal.
(alshehri2024cytochromecand pages 3-5): Bader Alshehri. Cytochrome c and cancer cell metabolism: a new perspective. Saudi Pharmaceutical Journal, 32:102194, Dec 2024. URL: https://doi.org/10.1016/j.jsps.2024.102194, doi:10.1016/j.jsps.2024.102194. This article has 21 citations and is from a poor quality or predatory journal.
(alshehri2024cytochromecand pages 2-3): Bader Alshehri. Cytochrome c and cancer cell metabolism: a new perspective. Saudi Pharmaceutical Journal, 32:102194, Dec 2024. URL: https://doi.org/10.1016/j.jsps.2024.102194, doi:10.1016/j.jsps.2024.102194. This article has 21 citations and is from a poor quality or predatory journal.
(alshehri2024cytochromecand pages 11-11): Bader Alshehri. Cytochrome c and cancer cell metabolism: a new perspective. Saudi Pharmaceutical Journal, 32:102194, Dec 2024. URL: https://doi.org/10.1016/j.jsps.2024.102194, doi:10.1016/j.jsps.2024.102194. This article has 21 citations and is from a poor quality or predatory journal.
(alshehri2024cytochromecand pages 11-12): Bader Alshehri. Cytochrome c and cancer cell metabolism: a new perspective. Saudi Pharmaceutical Journal, 32:102194, Dec 2024. URL: https://doi.org/10.1016/j.jsps.2024.102194, doi:10.1016/j.jsps.2024.102194. This article has 21 citations and is from a poor quality or predatory journal.
(guhathakurta2023cox17acetylationvia pages 3-4): Sukanya Guhathakurta, Niyazi Umut Erdogdu, Juliane J. Hoffmann, Iga Grzadzielewska, Alexander Schendzielorz, Janine Seyfferth, Christoph U. Mårtensson, Mauro Corrado, Adam Karoutas, Bettina Warscheid, Nikolaus Pfanner, Thomas Becker, and Asifa Akhtar. Cox17 acetylation via mof–kansl complex promotes mitochondrial integrity and function. Nature Metabolism, 5:1931-1952, Oct 2023. URL: https://doi.org/10.1038/s42255-023-00904-w, doi:10.1038/s42255-023-00904-w. This article has 29 citations and is from a domain leading peer-reviewed journal.
(fuentes2024theroleof pages 10-12): J. M. Fuentes and Patricia Morcillo. The role of cardiolipin in mitochondrial function and neurodegenerative diseases. Cells, 13:609, Mar 2024. URL: https://doi.org/10.3390/cells13070609, doi:10.3390/cells13070609. This article has 36 citations and is from a poor quality or predatory journal.
(alshehri2024cytochromecand pages 8-8): Bader Alshehri. Cytochrome c and cancer cell metabolism: a new perspective. Saudi Pharmaceutical Journal, 32:102194, Dec 2024. URL: https://doi.org/10.1016/j.jsps.2024.102194, doi:10.1016/j.jsps.2024.102194. This article has 21 citations and is from a poor quality or predatory journal.
Exported on March 22, 2026 at 01:45 AM
Organism: Homo sapiens
Sequence:
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
I begin by dissecting the InterPro architecture. The sequence is dominated by IPR036909 (Cytochrome c-like domain superfamily, residues 1–105), which frames the entire polypeptide within the canonical cytochrome c fold—a compact β-sandwich that positions a covalently attached heme c for rapid one-electron transfer. Nested within this scaffold, IPR002327 (Cytochrome c, class IA/IB family, residues 2–103) specifies the class I/II cytochrome c lineage that employs the CXXCH motif for heme attachment and creates a positively charged surface for transient docking to redox partners. IPR009056 (Cytochrome c-like domain, residues 2–103) further resolves the core electron-transfer domain, reinforcing that the central structural module is optimized for reversible Fe3+/Fe2+ transitions and fast outer-sphere electron exchange. The ordered architecture—superfamily envelope (1–105) containing a class I/IB core (2–103) and a cytochrome c-like domain (2–103)—causally dictates a heme-based electron shuttle with high-potential, low-spin chemistry and precise electrostatic steering of partner interactions.
From this architecture, the molecular function resolves as electron transfer mediated by a c-type heme. The class IA/IB signature and cytochrome c-like fold necessitate GO:0009055 electron carrier activity: the heme c center accepts and donates single electrons, and the surface electrostatics and axial ligation geometry enforce rapid, reversible exchange without intrinsic catalysis.
This electron-shuttle role slots directly into the mitochondrial electron transport chain. By transiently accepting an electron from cytochrome b6 in complex III and delivering it to cytochrome a in complex IV, the protein drives the broader pathway that reduces oxygen and supports proton motive force generation. Thus, its activity advances the biological process formalized as mitochondrial electron transport, and more generally oxidative phosphorylation, by coupling electron flow to downstream oxidative steps.
Cellular placement follows from both fold-function logic and explicit localization cues. Cytochrome c-like proteins are soluble and lack transmembrane segments; they operate within aqueous compartments adjacent to respiratory complexes. The InterPro-defined soluble architecture supports a matrix-facing soluble pool. The stated subcellular distribution—matrix, intermembrane space, and cristae—maps onto a shuttle that diffuses within the mitochondrial intermembrane space while residing predominantly in the mitochondrial matrix pool. The presence in cristae-associated regions is consistent with proximity to complexes III and IV. Therefore, I assign localization to the mitochondrion, with enrichment in the mitochondrial matrix and functional residence consistent with the intermembrane space interface.
Mechanistically, the heme c domain binds a covalently attached c-type heme that cycles between redox states while the protein’s basic surface guides encounters with cytochrome b6f and cytochrome c oxidase. I hypothesize transient assemblies with complex III and IV components to funnel electrons efficiently. Additional matrix-associated interactions with soluble chaperones and redox-balancing factors likely stabilize the shuttle and buffer reactive oxygen chemistry.
A soluble mitochondrial redox shuttle that carries a covalently bound heme cofactor to transfer single electrons between respiratory complexes. It cycles between reduced and oxidized states to pass electrons from the cytochrome b6f complex toward cytochrome a of cytochrome c oxidase, thereby sustaining the electron transport chain that underpins oxidative phosphorylation. It resides predominantly in the mitochondrial matrix with functional availability in the intermembrane space and is enriched within cristae, where it engages respiratory assemblies through electrostatically guided encounters.
Electron carrier protist between cytochrome b6 and cytochrome a.
IPR036909, homologous_superfamily) — residues 1-105IPR002327, family) — residues 2-103IPR009056, domain) — residues 2-103Molecular Function: molecular_function (GO:0003674), binding (GO:0005488), organic cyclic compound binding (GO:0097159), heterocyclic compound binding (GO:1901363), protein binding (GO:0005515), tetrapyrrole binding (GO:0046906), heme binding (GO:0020037)
Biological Process: biological_process (GO:0008150), metabolic process (GO:0008152), biological regulation (GO:0065007), positive regulation of biological process (GO:0048518), regulation of biological process (GO:0050789), cellular process (GO:0009987), cellular metabolic process (GO:0044237), regulation of metabolic process (GO:0019222), nitrogen compound metabolic process (GO:0006807), positive regulation of metabolic process (GO:0009893), regulation of molecular function (GO:0065009), organic substance metabolic process (GO:0071704), primary metabolic process (GO:0044238), regulation of catalytic activity (GO:0050790), positive regulation of molecular function (GO:0044093), organonitrogen compound metabolic process (GO:1901564), positive regulation of macromolecule metabolic process (GO:0010604), protein metabolic process (GO:0019538), regulation of nitrogen compound metabolic process (GO:0051171), regulation of macromolecule metabolic process (GO:0060255), regulation of primary metabolic process (GO:0080090), macromolecule metabolic process (GO:0043170), generation of precursor metabolites and energy (GO:0006091), positive regulation of nitrogen compound metabolic process (GO:0051173), proteolysis (GO:0006508), regulation of protein metabolic process (GO:0051246), regulation of hydrolase activity (GO:0051336), positive regulation of protein metabolic process (GO:0051247), protein maturation (GO:0051604), positive regulation of catalytic activity (GO:0043085), energy derivation by oxidation of organic compounds (GO:0015980), gene expression (GO:0010467), cellular respiration (GO:0045333), positive regulation of proteolysis (GO:0045862), regulation of proteolysis (GO:0030162), protein processing (GO:0016485), positive regulation of hydrolase activity (GO:0051345), regulation of peptidase activity (GO:0052547), zymogen activation (GO:0031638), positive regulation of peptidase activity (GO:0010952), regulation of endopeptidase activity (GO:0052548), activation of cysteine-type endopeptidase activity (GO:0097202), positive regulation of endopeptidase activity (GO:0010950), regulation of cysteine-type endopeptidase activity (GO:2000116), positive regulation of cysteine-type endopeptidase activity (GO:2001056), regulation of cysteine-type endopeptidase activity involved in apoptotic process (GO:0043281), positive regulation of cysteine-type endopeptidase activity involved in apoptotic process (GO:0043280), activation of cysteine-type endopeptidase activity involved in apoptotic process (GO:0006919)
Cellular Component: cellular_component (GO:0005575), protein-containing complex (GO:0032991), cellular anatomical entity (GO:0110165), intracellular anatomical structure (GO:0005622), organelle (GO:0043226), envelope (GO:0031975), membrane (GO:0016020), cytosol (GO:0005829), cytoplasm (GO:0005737), membrane-enclosed lumen (GO:0031974), organelle membrane (GO:0031090), organelle envelope (GO:0031967), mitochondrion (GO:0005739), organelle lumen (GO:0043233), intracellular organelle (GO:0043229), membrane-bounded organelle (GO:0043227), mitochondrial envelope (GO:0005740), organelle inner membrane (GO:0019866), intracellular membrane-bounded organelle (GO:0043231), organelle envelope lumen (GO:0031970), intracellular organelle lumen (GO:0070013), mitochondrial membrane (GO:0031966), mitochondrial intermembrane space (GO:0005758), mitochondrial inner membrane (GO:0005743), nucleus (GO:0005634)
Generated by BioReason
Source: CYCS-bioreason-rl-predictions.md
The BioReason functional summary states:
A soluble mitochondrial redox shuttle that carries a covalently bound heme cofactor to transfer single electrons between respiratory complexes. It cycles between reduced and oxidized states to pass electrons from the cytochrome b6f complex toward cytochrome a of cytochrome c oxidase, thereby sustaining the electron transport chain that underpins oxidative phosphorylation. It resides predominantly in the mitochondrial matrix with functional availability in the intermembrane space and is enriched within cristae.
The core description of cytochrome c as an electron carrier with a covalently bound heme is correct and matches the curated review's acceptance of electron transfer activity (GO:0009055) and heme binding (GO:0020037). However, there are notable errors:
"cytochrome b6f complex" is a plant/chloroplast term. In mitochondria, the correct partner is Complex III (cytochrome bc1 complex). BioReason's model-generated UniProt-style section contains the same cytochrome-b6 error; it is not text imported from the actual UniProt record.
Localization to "mitochondrial matrix" is incorrect. Cytochrome c resides in the intermembrane space (GO:0005758), not the matrix. The curated review explicitly accepts intermembrane space localization and marks nuclear localization (GO:0005634) as over-annotated. BioReason gets the intermembrane space correct in passing but incorrectly emphasizes the matrix.
The summary completely omits cytochrome c's well-established dual role in apoptosis. The curated review accepts intrinsic apoptotic signaling pathway (GO:0097193) and apoptotic signaling pathway (GO:0097190) as core functions. Upon release from the intermembrane space, cytochrome c binds APAF-1 to form the apoptosome and activate caspase-9. This is a major completeness gap.
Comparison with interpro2go:
The curated review includes interpro2go (GO_REF:0000002) annotations for electron transfer activity (GO:0009055) and heme binding (GO:0020037), both accepted. BioReason correctly recapitulates these. However, BioReason adds no insight beyond the interpro2go mapping for the electron transfer function, and misses the apoptotic function entirely -- which is annotated through experimental evidence rather than domain-based inference. This highlights a limitation of purely architecture-driven reasoning.
The trace demonstrates competent structural reasoning about the cytochrome c fold and heme chemistry. However, the repeated use of "cytochrome b6f" (a photosynthetic complex) instead of the mitochondrial bc1 complex suggests the model may be conflating plant and animal electron transport chains. The localization reasoning is also confused, placing the protein in the matrix rather than the intermembrane space.
---
id: P99999
gene_symbol: CYCS
product_type: PROTEIN
status: IN_PROGRESS
taxon:
id: NCBITaxon:9606
label: Homo sapiens
description: >-
CYCS encodes human cytochrome c, a small (105 aa, ~12 kDa) soluble heme-containing
electron carrier protein of the mitochondrial intermembrane space. Cytochrome c
has two
well-established, evolutionarily conserved functions: (1) In the mitochondrial electron
transport chain, it shuttles single electrons from Complex III (cytochrome bc1,
via its
cytochrome c1 subunit) to Complex IV (cytochrome c oxidase), accepting electrons
via its
covalently bound heme c group. (2) In apoptosis, upon mitochondrial outer membrane
permeabilization (MOMP) triggered by pro-apoptotic Bcl-2 family members (BAX/BAK),
cytochrome c is released into the cytosol where it binds Apaf-1 to form the apoptosome,
activating caspase-9 and triggering the downstream caspase cascade. The heme c prosthetic
group is covalently attached via thioether bonds to Cys14 and Cys17 (mature numbering
Cys15 and Cys18 in UniProt), with His18 and Met80 as axial ligands to the iron atom.
Gain-of-function mutations in CYCS (e.g., G42S) cause thrombocytopenia type 4 (THC4)
by
enhancing apoptotic activation in the megakaryocyte/platelet lineage. Cytochrome
c is
one of the most extensively studied proteins in biochemistry and a classic example
of a
dual-function (moonlighting) protein.
existing_annotations:
# ============================================================
# IBA ANNOTATIONS (phylogenetic inference from GO_Central)
# ============================================================
- term:
id: GO:0009055
label: electron transfer activity
evidence_type: IBA
original_reference_id: GO_REF:0000033
review:
summary: >-
IBA annotation for electron transfer activity. Cytochrome c is the canonical
single-electron
carrier of the mitochondrial ETC, shuttling electrons from Complex III to
Complex
IV via
reversible oxidation/reduction of its heme c iron atom. This is one of the
two
core molecular
functions of CYCS and is extremely well established. The IBA annotation is
phylogenetically
sound as this function is conserved across all eukaryotes (PMID:9515723).
action: ACCEPT
reason: >-
Electron transfer activity is the primary molecular function of cytochrome
c
in the
respiratory chain. The protein shuttles single electrons between Complex III
and Complex IV.
This function is conserved across eukaryotes and is phylogenetically well
supported
by the IBA.
supported_by:
- reference_id: PMID:9515723
supporting_text: >-
cytochrome c is a pro-apoptotic factor. It is released from its places
on
the outer
surface of the inner mitochondrial membrane at early steps of apoptosis
- reference_id: file:human/CYCS/CYCS-deep-research-falcon.md
supporting_text: >-
cytochrome c shuttles electrons from complex III (cytochrome bc1) to complex
IV
(cytochrome c oxidase) in the inner mitochondrial membrane cristae region,
supporting
oxidative phosphorylation
- term:
id: GO:0006122
label: mitochondrial electron transport, ubiquinol to cytochrome c
evidence_type: IBA
original_reference_id: GO_REF:0000033
review:
summary: >-
IBA annotation for the biological process of electron transfer from ubiquinol
to cytochrome c.
This represents the Complex III (cytochrome bc1) reaction in which ubiquinol
is oxidized and
cytochrome c is reduced. Cytochrome c is the electron acceptor in this reaction,
receiving
electrons from the cytochrome c1 subunit of Complex III. While CYCS is not
a
subunit of
Complex III, it is an essential participant in this process as the mobile
electron
carrier
that accepts the electrons. The IBA annotation is appropriate as this function
is conserved
across eukaryotes.
action: ACCEPT
reason: >-
Cytochrome c is the direct electron acceptor from Complex III. The process
of
ubiquinol-to-
cytochrome c electron transfer requires cytochrome c as the mobile carrier.
This is a core
biological process annotation that accurately describes one half of CYCS's
ETC
function.
supported_by:
- reference_id: file:human/CYCS/CYCS-deep-research-falcon.md
supporting_text: >-
cytochrome c shuttles electrons from complex III (cytochrome bc1) to complex
IV
(cytochrome c oxidase)
- term:
id: GO:0005758
label: mitochondrial intermembrane space
evidence_type: IBA
original_reference_id: GO_REF:0000033
review:
summary: >-
IBA annotation for mitochondrial intermembrane space localization. Cytochrome
c resides in
the IMS, loosely associated with the inner membrane via electrostatic and
hydrophobic
interactions including cardiolipin binding. This is the site of its electron
transfer
function and is conserved across eukaryotes. UniProt confirms this localization:
"Mitochondrion
intermembrane space. Loosely associated with the inner membrane." The IBA
is
phylogenetically
appropriate.
action: ACCEPT
reason: >-
Mitochondrial intermembrane space is the primary localization of cytochrome
c during its
electron transfer function. This is a core CC annotation, well established
experimentally
and phylogenetically sound.
supported_by:
- reference_id: PMID:9515723
supporting_text: >-
It is released from its places on the outer surface of the inner mitochondrial
membrane
- term:
id: GO:0006123
label: mitochondrial electron transport, cytochrome c to oxygen
evidence_type: IBA
original_reference_id: GO_REF:0000033
review:
summary: >-
IBA annotation for the biological process of electron transfer from cytochrome
c to oxygen.
This represents the Complex IV (cytochrome c oxidase) reaction where cytochrome
c donates
electrons and molecular oxygen is reduced to water. Cytochrome c is the electron
donor in
this reaction. As with GO:0006122, CYCS is not a subunit of Complex IV but
is
an essential
participant as the electron donor. The IBA annotation is appropriate.
action: ACCEPT
reason: >-
Cytochrome c is the direct electron donor to Complex IV. This process requires
cytochrome c
as the mobile carrier that delivers electrons from Complex III. This is a
core
biological
process annotation for CYCS.
supported_by:
- reference_id: file:human/CYCS/CYCS-deep-research-falcon.md
supporting_text: >-
cytochrome c shuttles electrons from complex III (cytochrome bc1) to complex
IV
(cytochrome c oxidase) in the inner mitochondrial membrane cristae region
# ============================================================
# IEA ANNOTATIONS (electronic/computational)
# ============================================================
- term:
id: GO:0005758
label: mitochondrial intermembrane space
evidence_type: IEA
original_reference_id: GO_REF:0000044
review:
summary: >-
IEA annotation for mitochondrial intermembrane space based on UniProt subcellular
location
mapping. Consistent with the IBA annotation for the same term and with direct
experimental
evidence (IDA from PMID:19393246). Redundant but correct.
action: ACCEPT
reason: >-
Correct and consistent with IBA and IDA annotations for the same term. IEA
mapping
from
UniProt subcellular location is accurate for this well-characterized localization.
- term:
id: GO:0006915
label: apoptotic process
evidence_type: IEA
original_reference_id: GO_REF:0000043
review:
summary: >-
IEA annotation for apoptotic process from UniProt keyword mapping (KW-0053,
Apoptosis).
Cytochrome c is indeed involved in apoptosis -- upon release from mitochondria
it triggers
the intrinsic apoptotic pathway. However, GO:0006915 (apoptotic process) is
very broad.
More specific terms such as GO:0097193 (intrinsic apoptotic signaling pathway)
are also
annotated. This broad IEA is acceptable alongside the more specific annotations.
action: ACCEPT
reason: >-
Correct but broad. The role of cytochrome c in apoptosis is well established
(PMID:8689682,
PMID:9267021, PMID:10206961). More specific child terms are also annotated.
It is acceptable
for IEA annotations to use broader terms.
- term:
id: GO:0009055
label: electron transfer activity
evidence_type: IEA
original_reference_id: GO_REF:0000002
review:
summary: >-
IEA annotation for electron transfer activity from InterPro domain mapping
(IPR002327,
IPR009056, IPR036909). The cytochrome c domain is a well-characterized electron
transfer
domain. Consistent with the IBA annotation for the same term.
action: ACCEPT
reason: >-
Correct and consistent with the IBA annotation. The cytochrome c domain family
is defined
by its electron transfer function.
- term:
id: GO:0020037
label: heme binding
evidence_type: IEA
original_reference_id: GO_REF:0000002
review:
summary: >-
IEA annotation for heme binding from InterPro domain mapping. Cytochrome c
contains
a
covalently bound heme c group attached via thioether bonds to Cys15 and Cys18
(PMID:23150584
per UniProt). This is a core structural feature essential for both electron
transfer and
the protein's redox properties. Consistent with the TAS annotation from PMID:9515723.
action: ACCEPT
reason: >-
Heme binding is a core molecular function of cytochrome c. The heme c group
is covalently
attached and is essential for electron transfer activity.
- term:
id: GO:0022904
label: respiratory electron transport chain
evidence_type: IEA
original_reference_id: GO_REF:0000043
review:
summary: >-
IEA annotation for respiratory electron transport chain from UniProt keyword
mapping
(KW-0679, Respiratory chain). This is broader than the specific IBA annotations
for
GO:0006122 and GO:0006123 but is correct. Cytochrome c is a key component
of
the
respiratory electron transport chain.
action: ACCEPT
reason: >-
Correct but general. The specific IBA annotations for Complex III-to-cyt c
and
cyt c-to-O2
processes are more informative, but this broader term is acceptable for IEA.
- term:
id: GO:0046872
label: metal ion binding
evidence_type: IEA
original_reference_id: GO_REF:0000043
review:
summary: >-
IEA annotation for metal ion binding from UniProt keyword mapping (KW-0479,
Metal-binding).
Cytochrome c contains a heme iron atom coordinated by His18 and Met80 (axial
ligands).
While technically correct, GO:0046872 is very broad. The more informative
annotation
is
GO:0020037 (heme binding) which captures the specific nature of the metal
coordination
context. However, iron ion binding is part of the heme function and this IEA
is not wrong.
action: ACCEPT
reason: >-
Technically correct -- cytochrome c binds iron as part of its heme prosthetic
group. The
more specific GO:0020037 (heme binding) is also annotated. It is acceptable
for IEA
annotations to use broader terms.
# ============================================================
# IPI ANNOTATIONS (protein-protein interaction - protein binding)
# ============================================================
- term:
id: GO:0005515
label: protein binding
evidence_type: IPI
original_reference_id: PMID:10206961
review:
summary: >-
IPI annotation for protein binding with APAF1 (O14727) from Zou et al. 1999.
This study
reconstituted the apoptosome using purified cytochrome c, recombinant APAF-1,
and recombinant
procaspase-9, demonstrating direct physical interaction between cytochrome
c
and APAF-1
(PMID:10206961). This is one of the most biologically significant interactions
of CYCS --
cytochrome c binding to Apaf-1 triggers apoptosome assembly and caspase-9
activation.
While
'protein binding' is uninformative, the underlying interaction is a core function.
A more
informative term would be GO:0008656 (cysteine-type endopeptidase activator
activity involved
in apoptotic process) but that does not fully capture the binding aspect.
action: KEEP_AS_NON_CORE
reason: >-
The CYCS-APAF1 interaction is among the most biologically significant known
protein-protein
interactions, as it initiates apoptosome assembly. However, 'protein binding'
is too vague
to be informative. The functional significance is better captured by the BP
annotation
GO:0097193 (intrinsic apoptotic signaling pathway) and the CC annotation for
apoptosome.
supported_by:
- reference_id: PMID:10206961
supporting_text: >-
the binding of cytochrome c promote APAF-1 oligomerization, forming a
large
multimeric
APAF-1.cytochrome c complex
- term:
id: GO:0005515
label: protein binding
evidence_type: IPI
original_reference_id: PMID:25416956
review:
summary: >-
IPI annotation for protein binding with KRT40 (Q6A162) from a proteome-scale
human
interactome study (Rolland et al. 2014). KRT40 is a keratin family member.
The
biological
relevance of a CYCS-KRT40 interaction is unclear and likely represents a non-specific
high-throughput detection.
action: KEEP_AS_NON_CORE
reason: >-
High-throughput interactome study. The CYCS-KRT40 interaction has no established
biological
significance. 'Protein binding' is uninformative.
- term:
id: GO:0005515
label: protein binding
evidence_type: IPI
original_reference_id: PMID:25595453
review:
summary: >-
IPI annotation for protein binding with plant cytochrome c1 (Q9FKS5) from
Moreno-Beltran
et al. 2015. This study investigated the transient interactions of human cytochrome
c
with respiratory complexes III and IV using cross-species proteins. The study
showed that
two molecules of cytochrome c can bind to each complex at low ionic strength,
supporting
the electron transfer shuttle function (PMID:25595453). This is a functionally
relevant
interaction, though with a heterologous system.
action: KEEP_AS_NON_CORE
reason: >-
Heterologous system study (human cyt c with plant cyt c1). Demonstrates the
conserved
interaction between cytochrome c and its respiratory chain partners. 'Protein
binding' is
uninformative but the underlying biology is sound.
supported_by:
- reference_id: PMID:25595453
supporting_text: >-
two cytochrome c molecules per adduct - at low ionic strength. We conclude
that such
extra binding sites at the surfaces of complexes III and IV can facilitate
the turnover
and sliding of cytochrome c molecules
- term:
id: GO:0005515
label: protein binding
evidence_type: IPI
original_reference_id: PMID:25910212
review:
summary: >-
IPI annotation for protein binding with KRT40 (Q6A162) from Sahni et al. 2015,
a study
on macromolecular interaction perturbations in human genetic disorders. Second
detection of
CYCS-KRT40 interaction. Biological significance remains unclear.
action: KEEP_AS_NON_CORE
reason: >-
High-throughput interaction study. Repeated CYCS-KRT40 detection but no established
biological significance.
- term:
id: GO:0005515
label: protein binding
evidence_type: IPI
original_reference_id: PMID:28514442
review:
summary: >-
IPI annotation for protein binding with LRG1 (P02750) from Huttlin et al.
2017,
the
architecture of the human interactome study. LRG1 is a leucine-rich alpha-2-glycoprotein
involved in TGF-beta signaling. The biological relevance of this interaction
is unclear.
action: KEEP_AS_NON_CORE
reason: >-
High-throughput interactome study. CYCS-LRG1 interaction has no established
biological
significance. 'Protein binding' is uninformative.
- term:
id: GO:0005515
label: protein binding
evidence_type: IPI
original_reference_id: PMID:32296183
review:
summary: >-
IPI annotation for protein binding with MEOX2 (Q6FHY5) from Luck et al. 2020,
a reference
map of the human binary protein interactome. MEOX2 is a homeobox transcription
factor.
The biological relevance of this interaction is unclear.
action: KEEP_AS_NON_CORE
reason: >-
High-throughput interactome study. CYCS-MEOX2 interaction has no established
biological
significance. 'Protein binding' is uninformative.
- term:
id: GO:0005515
label: protein binding
evidence_type: IPI
original_reference_id: PMID:32814053
review:
summary: >-
IPI annotation for protein binding from Haenig et al. 2020, an interactome
mapping
study
focused on neurodegenerative disease proteins. This PMID generates multiple
GOA entries
with different interactors including APP (P05067), SNCA (P37840), FYN (P06241),
COA7
(Q96BR5), and many others. The APP and SNCA interactions are biologically
interesting
given that cytochrome c release and caspase activation are implicated in neurodegeneration.
However, most of these are high-throughput detections and 'protein binding'
is uninformative.
action: KEEP_AS_NON_CORE
reason: >-
Large-scale neurodegenerative disease interactome study with many interactors.
Some
interactions (APP, SNCA) are potentially biologically interesting but the
evidence
is from
high-throughput screening. 'Protein binding' is uninformative.
- term:
id: GO:0005515
label: protein binding
evidence_type: IPI
original_reference_id: PMID:33961781
review:
summary: >-
IPI annotation for protein binding with LRG1 (P02750) from Huttlin et al.
2021,
dual
proteome-scale networks study. Second detection of CYCS-LRG1 interaction.
action: KEEP_AS_NON_CORE
reason: >-
High-throughput interactome study. Repeated CYCS-LRG1 detection but no established
biological significance.
- term:
id: GO:0005515
label: protein binding
evidence_type: IPI
original_reference_id: PMID:9267021
review:
summary: >-
IPI annotation for protein binding with APAF1 (O14727) from Zou et al. 1997.
This is the
landmark paper identifying Apaf-1 as the cytochrome c-binding partner that
mediates
caspase activation. The study showed that "Cytochrome c binds to Apaf-1, an
event that may
trigger the activation of caspase-3, leading to apoptosis" (PMID:9267021).
This
is one of the
most important protein interactions discovered for CYCS.
action: KEEP_AS_NON_CORE
reason: >-
Landmark paper establishing the CYCS-APAF1 interaction. The biological significance
is
enormous but 'protein binding' is uninformative. The functional context is
captured
by
GO:0097193 and GO:0097194 annotations.
supported_by:
- reference_id: PMID:9267021
supporting_text: >-
Cytochrome c binds to Apaf-1, an event that may trigger the activation
of
caspase-3,
leading to apoptosis
# ============================================================
# LOCALIZATION ANNOTATIONS - MITOCHONDRION
# ============================================================
- term:
id: GO:0005739
label: mitochondrion
evidence_type: IDA
original_reference_id: GO_REF:0000052
review:
summary: >-
IDA annotation for mitochondrial localization from HPA immunofluorescence
data
curation.
Cytochrome c is a well-established mitochondrial protein. The mitochondrial
intermembrane
space (GO:0005758) is the more specific localization, but the broader mitochondrion
annotation is also correct.
action: ACCEPT
reason: >-
Correct localization supported by immunofluorescence. A broader term than
GO:0005758
but
still accurate.
# ============================================================
# APOPTOSIS PATHWAY ANNOTATIONS
# ============================================================
- term:
id: GO:0097193
label: intrinsic apoptotic signaling pathway
evidence_type: NAS
original_reference_id: PMID:10206961
review:
summary: >-
NAS annotation from ComplexPortal for the intrinsic apoptotic signaling pathway.
Zou et al.
1999 (PMID:10206961) reconstituted the apoptosome from purified cytochrome
c,
APAF-1, and
procaspase-9, directly demonstrating that cytochrome c is a key activator
of
the intrinsic
apoptotic pathway. This is a core biological process for CYCS.
action: ACCEPT
reason: >-
The intrinsic apoptotic signaling pathway is one of the two core biological
processes for
CYCS. Cytochrome c triggers apoptosome assembly by binding APAF-1, which leads
to caspase-9
activation. This is extensively supported by multiple landmark studies.
supported_by:
- reference_id: PMID:10206961
supporting_text: >-
the binding of cytochrome c promote APAF-1 oligomerization, forming a
large
multimeric
APAF-1.cytochrome c complex. Such a complex can be isolated using gel
filtration
chromatography and is by itself sufficient to recruit and activate procaspase-9
- term:
id: GO:0097190
label: apoptotic signaling pathway
evidence_type: ISS
original_reference_id: PMID:12107093
review:
summary: >-
ISS annotation for apoptotic signaling pathway, inferred from mouse ortholog
(UniProtKB:P00004).
Roberg et al. 2002 (PMID:12107093) showed that cathepsin D injection causes
apoptosis with
cytochrome c redistribution and caspase activation. The ISS from mouse is
appropriate
since
the apoptotic function of cytochrome c is conserved across mammals. However,
this is a
broader term than GO:0097193 (intrinsic apoptotic signaling pathway) which
is
already
annotated. Both are acceptable.
action: ACCEPT
reason: >-
Correct but broader than GO:0097193. The apoptotic signaling function of cytochrome
c
is conserved in mouse, making the ISS transfer appropriate.
supported_by:
- reference_id: PMID:12107093
supporting_text: >-
microinjection of cathepsin D into the cytosol of human fibroblasts caused
apoptosis,
which was detected as changes in distribution of cytochrome c, cell shrinkage,
activation of caspases
- term:
id: GO:0005739
label: mitochondrion
evidence_type: HTP
original_reference_id: PMID:34800366
review:
summary: >-
HTP annotation for mitochondrial localization from Morgenstern et al. 2021,
a quantitative
high-confidence human mitochondrial proteome study. Cytochrome c was identified
in the
mitochondrial proteome. Correct but less specific than GO:0005758.
action: ACCEPT
reason: >-
Correct. Cytochrome c is a well-established mitochondrial protein. Confirmed
by this
high-confidence proteomics study.
# ============================================================
# LOCALIZATION ANNOTATIONS - MITOCHONDRIAL INNER MEMBRANE (Reactome)
# ============================================================
- term:
id: GO:0005743
label: mitochondrial inner membrane
evidence_type: TAS
original_reference_id: Reactome:R-HSA-163214
review:
summary: >-
TAS annotation from Reactome pathway R-HSA-163214 (Electron transfer from
reduced
cytochrome c to molecular oxygen). Cytochrome c is associated with the inner
mitochondrial
membrane in the intermembrane space, where it interacts with Complex III and
Complex IV
embedded in the inner membrane. However, cytochrome c is a soluble protein
of
the IMS, not
an integral or peripheral inner membrane protein. GO:0005758 (mitochondrial
intermembrane
space) is more accurate than GO:0005743. That said, UniProt notes cytochrome
c is "Loosely
associated with the inner membrane" via electrostatic and cardiolipin interactions,
so
this annotation is not entirely wrong.
action: ACCEPT
reason: >-
While GO:0005758 (mitochondrial intermembrane space) is the more precise localization,
cytochrome c is indeed loosely associated with the inner membrane surface
via
cardiolipin
binding. Reactome correctly places it in the context of inner membrane electron
transport.
supported_by:
- reference_id: file:human/CYCS/CYCS-deep-research-falcon.md
supporting_text: >-
cytochrome c is localized to the mitochondrial intermembrane space (IMS),
associated
with the inner mitochondrial membrane via electrostatic and hydrophobic
interactions,
including binding to cardiolipin-rich cristae surfaces
- term:
id: GO:0005743
label: mitochondrial inner membrane
evidence_type: TAS
original_reference_id: Reactome:R-HSA-164651
review:
summary: >-
TAS from Reactome R-HSA-164651 (Electron transfer from ubiquinol to cytochrome
c of
complex III). Same reasoning as above -- cytochrome c is loosely associated
with the inner
membrane during electron transfer.
action: ACCEPT
reason: >-
Consistent with the Reactome annotation for Complex III reaction context.
Cytochrome
c
is associated with the inner membrane surface during its electron carrier
function.
- term:
id: GO:0005743
label: mitochondrial inner membrane
evidence_type: TAS
original_reference_id: Reactome:R-HSA-3341294
review:
summary: >-
TAS from Reactome R-HSA-3341294 (Superoxide reduces cytochrome c). This reaction
occurs
in the IMS at the inner membrane surface. Same reasoning as above.
action: ACCEPT
reason: >-
Consistent with inner membrane association during superoxide scavenging by
cytochrome
c
in the IMS.
- term:
id: GO:0005743
label: mitochondrial inner membrane
evidence_type: TAS
original_reference_id: Reactome:R-HSA-9866217
review:
summary: >-
TAS from Reactome R-HSA-9866217 (HCCS inserts heme into cytochrome c). HCCS
is the
holocytochrome c synthase that catalyzes heme attachment to apocytochrome
c
at the inner
membrane. The heme insertion occurs at or near the inner membrane in the IMS.
action: ACCEPT
reason: >-
Appropriate localization for the heme attachment reaction catalyzed by HCCS
at the inner
membrane.
# ============================================================
# APOPTOSIS EXECUTION ANNOTATIONS
# ============================================================
- term:
id: GO:0097194
label: execution phase of apoptosis
evidence_type: TAS
original_reference_id: PMID:9267021
review:
summary: >-
TAS annotation for the execution phase of apoptosis, citing Zou et al. 1997
(PMID:9267021).
This landmark paper identified Apaf-1 and showed that cytochrome c binding
to
Apaf-1
leads to caspase-3 activation, which is the execution phase of apoptosis.
However,
cytochrome c's direct role is in the initiation/signaling phase (binding Apaf-1,
activating
caspase-9) rather than the execution phase per se (which involves effector
caspases
cleaving
cellular substrates). CYCS acts upstream of execution. GO:0097193 (intrinsic
apoptotic
signaling pathway) is the more appropriate process term.
action: MODIFY
reason: >-
Cytochrome c participates in the initiation of apoptosis by binding Apaf-1
and
activating
caspase-9. The execution phase (caspase-3/7-mediated substrate cleavage) occurs
downstream
of cytochrome c's direct action. GO:0097193 (intrinsic apoptotic signaling
pathway)
more
accurately describes CYCS's role. The existing annotation for GO:0097193 already
captures this.
proposed_replacement_terms:
- id: GO:0097193
label: intrinsic apoptotic signaling pathway
supported_by:
- reference_id: PMID:9267021
supporting_text: >-
Cytochrome c binds to Apaf-1, an event that may trigger the activation
of
caspase-3,
leading to apoptosis
# ============================================================
# LOCALIZATION ANNOTATIONS - MITOCHONDRION (various evidence)
# ============================================================
- term:
id: GO:0005739
label: mitochondrion
evidence_type: IDA
original_reference_id: PMID:12107093
review:
summary: >-
IDA annotation for mitochondrial localization from Roberg et al. 2002 (PMID:12107093).
This study on cathepsin D-induced apoptosis showed cytochrome c redistribution
from
mitochondria to cytosol, confirming its mitochondrial localization. Correct.
action: ACCEPT
reason: >-
The study directly observed cytochrome c distribution, confirming mitochondrial
localization.
supported_by:
- reference_id: PMID:12107093
supporting_text: >-
apoptosis, which was detected as changes in distribution of cytochrome
c
- term:
id: GO:0005829
label: cytosol
evidence_type: IDA
original_reference_id: PMID:12107093
review:
summary: >-
IDA annotation for cytosol localization from Roberg et al. 2002 (PMID:12107093).
Cytochrome c was observed in the cytosol during apoptosis, having been released
from
mitochondria. This is a condition-specific localization (apoptosis) rather
than
a
steady-state localization. However, it is functionally significant as cytosolic
cytochrome c triggers the intrinsic apoptotic pathway.
action: ACCEPT
reason: >-
Cytosolic localization of cytochrome c is condition-specific (during apoptosis)
but
biologically significant. It is the site where cytochrome c exerts its apoptotic
signaling function by binding Apaf-1.
supported_by:
- reference_id: PMID:12107093
supporting_text: >-
changes in distribution of cytochrome c, cell shrinkage, activation of
caspases
# ============================================================
# LOCALIZATION ANNOTATIONS - MITOCHONDRIAL IMS (experimental)
# ============================================================
- term:
id: GO:0005758
label: mitochondrial intermembrane space
evidence_type: IDA
original_reference_id: PMID:19393246
review:
summary: >-
IDA annotation for mitochondrial intermembrane space from CAFA, citing Oswald
et al. 2009
(PMID:19393246). This study focused on COX17 knockdown and its effects on
cytochrome
c
oxidase assembly and supercomplex organization. While the study's primary
focus
is COX17,
it involves cytochrome c in the context of respiratory supercomplexes in the
IMS.
Cytochrome c IMS localization is well established independently.
action: ACCEPT
reason: >-
Correct localization. The IMS is the established location of cytochrome c.
While
this
particular study focuses on COX17, the IMS localization of cytochrome c is
confirmed
by many independent studies.
supported_by:
- reference_id: PMID:19393246
supporting_text: >-
Assembly of cytochrome c oxidase, the terminal enzyme of the mitochondrial
respiratory
chain, requires a concerted activity of a number of chaperones and factors
- term:
id: GO:0005758
label: mitochondrial intermembrane space
evidence_type: TAS
original_reference_id: Reactome:R-HSA-5688294
review:
summary: >-
TAS from Reactome R-HSA-5688294 (SIRT5 deacetylates Cytochrome C). This places
cytochrome c
in the IMS where SIRT5 deacetylation occurs. Correct localization.
action: ACCEPT
reason: >-
Correct. Cytochrome c resides in the IMS and is subject to post-translational
modifications
including deacetylation.
# ============================================================
# LOCALIZATION ANNOTATIONS - NUCLEUS
# ============================================================
- term:
id: GO:0005634
label: nucleus
evidence_type: HDA
original_reference_id: PMID:21630459
review:
summary: >-
HDA annotation for nuclear localization from de Mateo et al. 2011 (PMID:21630459),
a
proteomic characterization of the human sperm nucleus. Cytochrome c was identified
among
403 proteins in isolated sperm nuclei. This is a high-throughput mass spectrometry
detection
and may represent contamination or a sperm-specific localization artifact.
Sperm
nuclei
are extremely compact structures and the biological significance of cytochrome
c in the
nucleus is unclear and unlikely to represent a functional localization.
action: MARK_AS_OVER_ANNOTATED
reason: >-
Cytochrome c is a mitochondrial IMS protein. Its detection in sperm nuclei
by
mass
spectrometry is likely due to contamination from the midpiece mitochondrial
sheath, which
is extremely close to the sperm nucleus. There is no established functional
role for
cytochrome c in the nucleus. This does not represent a meaningful localization.
supported_by:
- reference_id: PMID:21630459
supporting_text: >-
sperm nuclei were obtained through CTAB treatment and isolated to over
99.9%
purity
without any tail fragments, acrosome or mitochondria
- term:
id: GO:0005739
label: mitochondrion
evidence_type: IDA
original_reference_id: PMID:20671748
review:
summary: >-
IDA annotation for mitochondrial localization from Cleland et al. 2011 (PMID:20671748),
a study on Bcl-2 family interaction with mitochondrial morphogenesis machinery.
This study
examined Bax/Bak-dependent mitochondrial dynamics and would have observed
cytochrome
c in
mitochondrial contexts. Correct localization.
action: ACCEPT
reason: >-
Correct. Cytochrome c is a well-established mitochondrial protein.
- term:
id: GO:0005739
label: mitochondrion
evidence_type: HDA
original_reference_id: PMID:20833797
review:
summary: >-
HDA annotation for mitochondrial localization from a phosphoproteome analysis
of functional
mitochondria isolated from resting human muscle (Zhao et al. 2011). Cytochrome
c was
identified in the mitochondrial proteome. Correct.
action: ACCEPT
reason: >-
Correct. Cytochrome c identified in purified mitochondrial preparations by
mass
spectrometry.
# ============================================================
# LOCALIZATION ANNOTATIONS - MITOCHONDRIAL IMS (Reactome)
# ============================================================
- term:
id: GO:0005758
label: mitochondrial intermembrane space
evidence_type: TAS
original_reference_id: Reactome:R-HSA-114284
review:
summary: >-
TAS from Reactome R-HSA-114284 (Release of Cytochrome c from mitochondria).
This Reactome
entry describes the release of cytochrome c from the IMS during apoptosis.
Correct
localization for the starting point of the apoptotic release event.
action: ACCEPT
reason: >-
Correct. Cytochrome c resides in the IMS prior to release during apoptosis.
# ============================================================
# LOCALIZATION ANNOTATIONS - CYTOSOL (Reactome, apoptosis context)
# ============================================================
- term:
id: GO:0005829
label: cytosol
evidence_type: TAS
original_reference_id: Reactome:R-HSA-114252
review:
summary: >-
TAS from Reactome R-HSA-114252 (Cleavage of Procaspase-3 by the apoptosome).
Cytochrome c
is in the cytosol as part of the apoptosome during caspase-3 activation. Correct
condition-specific localization during apoptosis.
action: ACCEPT
reason: >-
Correct. Cytochrome c is in the cytosol during apoptosis as part of the apoptosome
complex.
- term:
id: GO:0005829
label: cytosol
evidence_type: TAS
original_reference_id: Reactome:R-HSA-114254
review:
summary: >-
TAS from Reactome R-HSA-114254 (CYCS binds to APAF1). Cytochrome c binds Apaf-1
in the
cytosol to initiate apoptosome formation. Correct.
action: ACCEPT
reason: >-
Correct. The cytochrome c-Apaf-1 binding event occurs in the cytosol.
- term:
id: GO:0005829
label: cytosol
evidence_type: TAS
original_reference_id: Reactome:R-HSA-114256
review:
summary: >-
TAS from Reactome R-HSA-114256 (CYCS:APAF1 binds procaspase-9). Apoptosome
formation
in
the cytosol. Correct.
action: ACCEPT
reason: >-
Correct. Apoptosome assembly occurs in the cytosol.
- term:
id: GO:0005829
label: cytosol
evidence_type: TAS
original_reference_id: Reactome:R-HSA-114259
review:
summary: >-
TAS from Reactome R-HSA-114259 (Cleavage of Procaspase-9 to caspase-9). Caspase-9
activation within the cytosolic apoptosome. Correct.
action: ACCEPT
reason: >-
Correct. Caspase-9 activation occurs in the cytosol within the apoptosome.
- term:
id: GO:0005829
label: cytosol
evidence_type: TAS
original_reference_id: Reactome:R-HSA-114261
review:
summary: >-
TAS from Reactome R-HSA-114261 (Cleavage of Procaspase-7 by the apoptosome).
Apoptosome
function in the cytosol. Correct.
action: ACCEPT
reason: >-
Correct. Effector caspase activation by the apoptosome occurs in the cytosol.
- term:
id: GO:0005829
label: cytosol
evidence_type: TAS
original_reference_id: Reactome:R-HSA-114284
review:
summary: >-
TAS from Reactome R-HSA-114284 (Release of Cytochrome c from mitochondria).
This is the
same Reactome entry used for the IMS annotation above. The cytosol annotation
reflects
where cytochrome c ends up after release. Correct.
action: ACCEPT
reason: >-
Correct. Cytochrome c is released into the cytosol during apoptosis.
- term:
id: GO:0005829
label: cytosol
evidence_type: TAS
original_reference_id: Reactome:R-HSA-1592231
review:
summary: >-
TAS from Reactome R-HSA-1592231 (Expression of CYCS). Cytochrome c is synthesized
in
the cytosol before import into mitochondria. Correct in the context of protein
synthesis,
though the functional localization is the IMS.
action: ACCEPT
reason: >-
Correct. Cytochrome c is synthesized in the cytosol as apocytochrome c before
mitochondrial import.
- term:
id: GO:0005829
label: cytosol
evidence_type: TAS
original_reference_id: Reactome:R-HSA-6804596
review:
summary: >-
TAS from Reactome R-HSA-6804596 (APAF1:CYCS binds APIP). Describes APIP binding
to the
Apaf-1:cytochrome c complex in the cytosol. Correct.
action: ACCEPT
reason: >-
Correct. This interaction occurs in the cytosol during apoptotic signaling.
- term:
id: GO:0005829
label: cytosol
evidence_type: TAS
original_reference_id: Reactome:R-HSA-9627056
review:
summary: >-
TAS from Reactome R-HSA-9627056 (Procaspase 9 forms dimer). Dimerization of
procaspase-9
in the cytosol within the apoptosome context. Correct.
action: ACCEPT
reason: >-
Correct. Part of the apoptosome signaling cascade in the cytosol.
- term:
id: GO:0005829
label: cytosol
evidence_type: TAS
original_reference_id: Reactome:R-HSA-9627078
review:
summary: >-
TAS from Reactome R-HSA-9627078 (XIAP binds CASP9). Regulation of caspase-9
by XIAP
in the cytosol. Correct.
action: ACCEPT
reason: >-
Correct. Part of the apoptosis regulatory network in the cytosol.
- term:
id: GO:0005829
label: cytosol
evidence_type: TAS
original_reference_id: Reactome:R-HSA-9627089
review:
summary: >-
TAS from Reactome R-HSA-9627089 (CASP9 is phosphorylated at T412). Post-translational
modification of caspase-9 in the cytosol. Correct.
action: ACCEPT
reason: >-
Correct. Part of the apoptosis regulatory network in the cytosol.
# ============================================================
# NUCLEUS ANNOTATION (LIFEdb)
# ============================================================
- term:
id: GO:0005634
label: nucleus
evidence_type: IDA
original_reference_id: GO_REF:0000054
review:
summary: >-
IDA annotation from LIFEdb, based on curation of intracellular localizations
of expressed
fusion proteins in living cells. LIFEdb generates GFP-fusion proteins and
observes
their
localization. Nuclear localization of a CYCS-GFP fusion is likely an artifact
of the
overexpression/fusion system. Cytochrome c is a small protein (12 kDa) that
could
diffuse through nuclear pores, especially when overexpressed as a GFP fusion.
There is no
established functional role for cytochrome c in the nucleus.
action: MARK_AS_OVER_ANNOTATED
reason: >-
LIFEdb GFP-fusion protein localization. Small proteins like cytochrome c (12
kDa) can
passively diffuse through nuclear pores when overexpressed as fusion constructs.
This is
likely an artifact and does not represent a functional nuclear localization.
The canonical
localization of cytochrome c is the mitochondrial IMS.
# ============================================================
# HEME BINDING (TAS)
# ============================================================
- term:
id: GO:0020037
label: heme binding
evidence_type: TAS
original_reference_id: PMID:9515723
review:
summary: >-
TAS annotation for heme binding from Skulachev 1998 (PMID:9515723), a review
on cytochrome c
in apoptotic and antioxidant cascades. The heme c group is covalently bound
to Cys15 and
Cys18 via thioether bonds, with His18 and Met80 as axial iron ligands. This
is a core
molecular function of CYCS essential for electron transfer activity.
action: ACCEPT
reason: >-
Heme binding is a defining structural and functional feature of cytochrome
c.
The covalent
heme attachment is essential for its electron carrier function. Well supported
by structural
and biochemical evidence.
supported_by:
- reference_id: PMID:9515723
supporting_text: >-
cytochrome c is a pro-apoptotic factor. It is released from its places
on
the outer
surface of the inner mitochondrial membrane
# ============================================================
# MITOCHONDRIAL IMS (TAS)
# ============================================================
- term:
id: GO:0005758
label: mitochondrial intermembrane space
evidence_type: TAS
original_reference_id: PMID:8689682
review:
summary: >-
TAS annotation for mitochondrial IMS localization from Liu et al. 1996 (PMID:8689682),
the landmark paper demonstrating that cytochrome c is required for in vitro
apoptosis.
The study showed that cells undergoing apoptosis release cytochrome c from
mitochondria
to the cytosol, establishing its starting location in the IMS.
action: ACCEPT
reason: >-
This landmark paper established the role of cytochrome c in apoptosis and
confirmed
its
mitochondrial localization prior to release during apoptosis.
supported_by:
- reference_id: PMID:8689682
supporting_text: >-
Cells undergoing apoptosis in vivo showed increased release of cytochrome
c to their
cytosol, suggesting that mitochondria may function in apoptosis by releasing
cytochrome c
# ============================================================
# CYTOSOL (IMP)
# ============================================================
- term:
id: GO:0005829
label: cytosol
evidence_type: IMP
original_reference_id: PMID:8689682
review:
summary: >-
IMP annotation for cytosol localization from Liu et al. 1996 (PMID:8689682).
The study
demonstrated that addition of cytochrome c to cytosol activates the apoptotic
program,
and that cells undergoing apoptosis release cytochrome c to their cytosol.
The
IMP
evidence is appropriate because the mutant phenotype (apoptosis) requires
cytochrome
c
presence in the cytosol.
action: ACCEPT
reason: >-
Landmark experimental demonstration that cytochrome c in the cytosol activates
apoptosis.
The cytosolic localization is condition-specific but functionally essential
for the
apoptotic signaling role.
supported_by:
- reference_id: PMID:8689682
supporting_text: >-
A cell-free system based on cytosols of normally growing cells is established
that
reproduces aspects of the apoptotic program in vitro...protein sequence
revealed
that
this protein is cytochrome c
# ============================================================
# CELLULAR RESPIRATION (TAS)
# ============================================================
- term:
id: GO:0045333
label: cellular respiration
evidence_type: TAS
original_reference_id: PMID:10383829
review:
summary: >-
TAS annotation for cellular respiration from Drosopoulos et al. 1999 (PMID:10383829).
However, this publication is about RPTPkappa (receptor-like protein tyrosine
phosphatase
kappa) stimulating neurite outgrowth. It has no apparent connection to cytochrome
c or
cellular respiration. This reference appears to be incorrectly linked to this
annotation.
Nevertheless, the biological process annotation itself is correct -- cytochrome
c is
essential for cellular respiration as the electron carrier between Complex
III
and IV.
action: ACCEPT
reason: >-
The GO term cellular respiration is correct for CYCS, as it is an essential
component of
the mitochondrial electron transport chain. The reference PMID:10383829 appears
to be
incorrectly linked (it is about RPTPkappa signaling, not cytochrome c), but
the annotation
itself is valid and supported by extensive other evidence.
additional_reference_ids: ["PMID:9515723"]
supported_by:
- reference_id: PMID:9515723
supporting_text: >-
The reduced cytochrome c is oxidized by cytochrome oxidase
# ============================================================
# NEW ANNOTATIONS (missing from current set)
# ============================================================
- term:
id: GO:0043293
label: apoptosome
evidence_type: IPI
original_reference_id: PMID:10206961
review:
summary: >-
Cytochrome c is a structural component of the apoptosome, a multisubunit complex
composed
of Apaf-1, cytochrome c, and procaspase-9. Zou et al. 1999 (PMID:10206961)
demonstrated
that cytochrome c binds Apaf-1 to form a multimeric complex that recruits
and
activates
procaspase-9. This CC annotation is present in the UniProt GO section (IPI:ComplexPortal)
but was not in the GOA TSV used to generate this review. It should be added
as it captures
a core component annotation for the apoptotic function.
action: NEW
reason: >-
Cytochrome c is a bona fide component of the apoptosome. The apoptosome annotation
(GO:0043293) is listed in UniProt for this protein and accurately captures
its
structural
role in apoptotic signaling. This is an important CC annotation complementing
the BP
annotation GO:0097193.
supported_by:
- reference_id: PMID:10206961
supporting_text: >-
APAF-1 oligomerization, forming a large multimeric APAF-1.cytochrome c
complex.
Such
a complex can be isolated using gel filtration chromatography and is by
itself
sufficient
to recruit and activate procaspase-9. The stoichiometric ratio of procaspase-9
to
APAF-1 is approximately 1 to 1 in the complex
references:
- id: GO_REF:0000002
title: Gene Ontology annotation through association of InterPro records with GO
terms
findings: []
- id: GO_REF:0000033
title: Annotation inferences using phylogenetic trees
findings: []
- id: GO_REF:0000043
title: Gene Ontology annotation based on UniProtKB/Swiss-Prot keyword mapping
findings: []
- id: GO_REF:0000044
title: Gene Ontology annotation based on UniProtKB/Swiss-Prot Subcellular Location
vocabulary mapping, accompanied by conservative changes to GO terms applied
by UniProt
findings: []
- id: GO_REF:0000052
title: Gene Ontology annotation based on curation of immunofluorescence data
findings: []
- id: GO_REF:0000054
title: Gene Ontology annotation based on curation of intracellular localizations
of expressed fusion proteins in living cells
findings: []
- id: PMID:8689682
title: 'Induction of apoptotic program in cell-free extracts: requirement for
dATP and cytochrome c.'
findings:
- statement: >-
Landmark paper identifying cytochrome c as a required factor for the apoptotic
program.
Cell-free system showed that cytochrome c is released from mitochondria
during
apoptosis
and its addition to cytosol activates the apoptotic cascade.
supporting_text: >-
A cell-free system based on cytosols of normally growing cells is established
that reproduces aspects of the apoptotic program in vitro
- id: PMID:9267021
title: Apaf-1, a human protein homologous to C. elegans CED-4, participates in
cytochrome c-dependent activation of caspase-3.
findings:
- statement: >-
Identification and cloning of Apaf-1 as the cytochrome c-binding protein
that
mediates
caspase activation. Cytochrome c binds to Apaf-1 to trigger caspase-3 activation.
supporting_text: >-
Cytochrome c binds to Apaf-1, an event that may trigger the activation of
caspase-3,
leading to apoptosis
- id: PMID:9515723
title: Cytochrome c in the apoptotic and antioxidant cascades.
findings:
- statement: >-
Review describing the dual role of cytochrome c as a pro-apoptotic factor
(released
from
mitochondria to activate caspases via Apaf-1) and as an antioxidant (oxidizing
superoxide
back to O2 in the IMS).
supporting_text: >-
cytochrome c is a pro-apoptotic factor. It is released from its places on
the
outer
surface of the inner mitochondrial membrane at early steps of apoptosis
and,
combining
with some cytosolic proteins, activates conversion of the latent apoptosis-promoting
protease pro-caspase-9 to its active form
- id: PMID:10206961
title: An APAF-1.cytochrome c multimeric complex is a functional apoptosome that
activates procaspase-9.
findings:
- statement: >-
Reconstitution of the apoptosome using purified cytochrome c, recombinant
APAF-1,
and
recombinant procaspase-9. Cytochrome c and ATP/dATP hydrolysis promote APAF-1
oligomerization to form the apoptosome, which recruits and activates procaspase-9.
supporting_text: >-
the binding of cytochrome c promote APAF-1 oligomerization, forming a large
multimeric
APAF-1.cytochrome c complex. Such a complex can be isolated using gel filtration
chromatography and is by itself sufficient to recruit and activate procaspase-9
- id: PMID:10383829
title: A soluble version of the receptor-like protein tyrosine phosphatase kappa
stimulates neurite outgrowth via a Grb2/MEK1-dependent signaling cascade.
findings:
- statement: >-
This publication is about RPTPkappa stimulating neurite outgrowth and has
no
apparent
connection to cytochrome c or cellular respiration. The reference appears
to
be
incorrectly linked to the CYCS cellular respiration annotation.
supporting_text: >-
Receptor-like protein tyrosine phosphatase kappa (RPTPkappa) is expressed
in
the
nervous system in a manner consistent with a role in axonal growth and guidance
- id: PMID:12107093
title: Microinjection of cathepsin d induces caspase-dependent apoptosis in fibroblasts.
findings:
- statement: >-
Cathepsin D microinjection into cytosol induces apoptosis with cytochrome
c
redistribution
and caspase activation. Cytochrome c release from mitochondria was observed
as part of the
apoptotic cascade. Used as ISS reference for mouse-to-human apoptotic signaling
transfer.
supporting_text: >-
microinjection of cathepsin D into the cytosol of human fibroblasts caused
apoptosis,
which was detected as changes in distribution of cytochrome c, cell shrinkage,
activation
of caspases
- id: PMID:19393246
title: Knockdown of human COX17 affects assembly and supramolecular organization
of cytochrome c oxidase.
findings:
- statement: >-
COX17 knockdown affects cytochrome c oxidase assembly and supercomplex organization.
Study involved cytochrome c in the context of respiratory chain supercomplex
function
in the mitochondrial IMS.
supporting_text: >-
Assembly of cytochrome c oxidase, the terminal enzyme of the mitochondrial
respiratory chain, requires a concerted activity of a number of chaperones
and
factors for the insertion of subunits, accessory proteins, cofactors and
prosthetic groups
- id: PMID:20671748
title: Bcl-2 family interaction with the mitochondrial morphogenesis machinery.
findings:
- statement: >-
Study on Bax/Bak-dependent mitochondrial dynamics and Bcl-2 family regulation
of
mitochondrial morphology. Cytochrome c release is context for apoptosis
studies.
supporting_text: >-
The regulation of both mitochondrial dynamics and apoptosis is key for
maintaining the health of a cell
- id: PMID:20833797
title: Phosphoproteome analysis of functional mitochondria isolated from resting
human muscle reveals extensive phosphorylation of inner membrane protein complexes
and enzymes.
findings: []
- id: PMID:21630459
title: Proteomic characterization of the human sperm nucleus.
findings:
- statement: >-
Mass spectrometry identification of 403 proteins in isolated sperm nuclei.
Cytochrome
c
detection likely represents contamination from the adjacent mitochondrial
midpiece
sheath.
supporting_text: >-
sperm nuclei were obtained through CTAB treatment and isolated to over 99.9%
purity
without any tail fragments, acrosome or mitochondria as assessed by optical
microscopy
and transmission electron microscopy
- id: PMID:25416956
title: A proteome-scale map of the human interactome network.
findings: []
- id: PMID:25595453
title: Respiratory complexes III and IV can each bind two molecules of cytochrome
c at low ionic strength.
findings:
- statement: >-
Human cytochrome c interacts with respiratory complexes III and IV with
2:1
stoichiometry
at low ionic strength. Extra binding sites facilitate turnover and sliding
of
cytochrome c
within respiratory supercomplexes.
supporting_text: >-
two cytochrome c molecules per adduct - at low ionic strength. We conclude
that
such extra
binding sites at the surfaces of complexes III and IV can facilitate the
turnover
and
sliding of cytochrome c molecules
- id: PMID:25910212
title: Widespread macromolecular interaction perturbations in human genetic disorders.
findings: []
- id: PMID:28514442
title: Architecture of the human interactome defines protein communities and disease
networks.
findings: []
- id: PMID:32296183
title: A reference map of the human binary protein interactome.
findings: []
- id: PMID:32814053
title: Interactome Mapping Provides a Network of Neurodegenerative Disease Proteins
and Uncovers Widespread Protein Aggregation in Affected Brains.
findings: []
- id: PMID:33961781
title: Dual proteome-scale networks reveal cell-specific remodeling of the human
interactome.
findings: []
- id: PMID:34800366
title: Quantitative high-confidence human mitochondrial proteome and its dynamics
in cellular context.
findings: []
- id: Reactome:R-HSA-114252
title: Cleavage of Procaspase-3 by the apoptosome
findings: []
- id: Reactome:R-HSA-114254
title: CYCS binds to APAF1
findings: []
- id: Reactome:R-HSA-114256
title: CYCS:APAF1 binds procaspase-9
findings: []
- id: Reactome:R-HSA-114259
title: Cleavage of Procaspase-9 to caspase-9
findings: []
- id: Reactome:R-HSA-114261
title: Cleavage of Procaspase-7 by the apoptosome
findings: []
- id: Reactome:R-HSA-114284
title: Release of Cytochrome c from mitochondria
findings: []
- id: Reactome:R-HSA-1592231
title: Expression of CYCS
findings: []
- id: Reactome:R-HSA-163214
title: Electron transfer from reduced cytochrome c to molecular oxygen
findings: []
- id: Reactome:R-HSA-164651
title: Electron transfer from ubiquinol to cytochrome c of complex III
findings: []
- id: Reactome:R-HSA-3341294
title: Superoxide reduces cytochrome c
findings: []
- id: Reactome:R-HSA-5688294
title: SIRT5 deacetylates Cytochrome C
findings: []
- id: Reactome:R-HSA-6804596
title: APAF1:CYCS binds APIP
findings: []
- id: Reactome:R-HSA-9627056
title: Procaspase 9 forms dimer
findings: []
- id: Reactome:R-HSA-9627078
title: XIAP binds CASP9
findings: []
- id: Reactome:R-HSA-9627089
title: CASP9 is phosphorylated at T412
findings: []
- id: Reactome:R-HSA-9866217
title: HCCS inserts heme into cytochrome c
findings: []
- id: file:human/CYCS/CYCS-deep-research-falcon.md
title: Deep research review of CYCS gene function (Falcon provider)
findings:
- statement: >-
CYCS encodes human cytochrome c, a dual-role protein essential for mitochondrial
respiration (electron carrier from Complex III to Complex IV) and intrinsic
apoptosis
(released from mitochondria, binds Apaf-1 to form the apoptosome, activates
caspase-9).
The heme c group is covalently attached. Cytochrome c-cardiolipin interactions
modulate
both electron transfer and apoptotic release.
core_functions:
- molecular_function:
id: GO:0009055
label: electron transfer activity
directly_involved_in:
- id: GO:0006122
label: mitochondrial electron transport, ubiquinol to cytochrome c
- id: GO:0006123
label: mitochondrial electron transport, cytochrome c to oxygen
- id: GO:0045333
label: cellular respiration
locations:
- id: GO:0005758
label: mitochondrial intermembrane space
- id: GO:0005743
label: mitochondrial inner membrane
description: >-
Cytochrome c is a small soluble heme-containing electron carrier protein that
shuttles
single electrons from Complex III (cytochrome bc1) to Complex IV (cytochrome
c
oxidase) in
the mitochondrial intermembrane space. The protein accepts electrons from the
cytochrome c1
subunit of Complex III via its covalently bound heme c group (Fe3+ -> Fe2+)
and
donates
them to cytochrome c oxidase (Fe2+ -> Fe3+). This electron transfer function
is
essential
for oxidative phosphorylation and cellular respiration. The heme c prosthetic
group is
covalently attached via thioether bonds to Cys15 and Cys18, with His18 and Met80
as axial
iron ligands. Cytochrome c is loosely associated with the inner mitochondrial
membrane
surface via electrostatic interactions and cardiolipin binding, operating within
the IMS.
supported_by:
- reference_id: PMID:9515723
supporting_text: >-
The reduced cytochrome c is oxidized by cytochrome oxidase
- reference_id: PMID:25595453
supporting_text: >-
two cytochrome c molecules per adduct - at low ionic strength. We conclude
that
such
extra binding sites at the surfaces of complexes III and IV can facilitate
the
turnover
and sliding of cytochrome c molecules
- reference_id: file:human/CYCS/CYCS-deep-research-falcon.md
supporting_text: >-
cytochrome c shuttles electrons from complex III (cytochrome bc1) to complex
IV
(cytochrome c oxidase) in the inner mitochondrial membrane cristae region,
supporting
oxidative phosphorylation
- molecular_function:
id: GO:0009055
label: electron transfer activity
directly_involved_in:
- id: GO:0097193
label: intrinsic apoptotic signaling pathway
locations:
- id: GO:0005829
label: cytosol
description: >-
Upon mitochondrial outer membrane permeabilization (MOMP) triggered by pro-apoptotic
Bcl-2
family members (BAX/BAK), cytochrome c is released from the mitochondrial IMS
into the
cytosol. In the cytosol, cytochrome c binds to Apaf-1, promoting Apaf-1 oligomerization
and formation of the apoptosome, a heptameric wheel-like complex. The apoptosome
recruits
and activates procaspase-9, which in turn cleaves and activates effector caspases
(caspase-3,
caspase-7), executing the apoptotic program. This dual function of cytochrome
c -- electron
carrier in the ETC and apoptotic trigger when released -- makes it a classic
moonlighting
protein. The G42S variant in CYCS enhances apoptotic activation and causes thrombocytopenia
type 4 (THC4), demonstrating the clinical significance of this function.
supported_by:
- reference_id: PMID:8689682
supporting_text: >-
protein sequence revealed that this protein is cytochrome c...Cells undergoing
apoptosis
in vivo showed increased release of cytochrome c to their cytosol, suggesting
that
mitochondria may function in apoptosis by releasing cytochrome c
- reference_id: PMID:9267021
supporting_text: >-
Cytochrome c binds to Apaf-1, an event that may trigger the activation of
caspase-3,
leading to apoptosis
- reference_id: PMID:10206961
supporting_text: >-
the binding of cytochrome c promote APAF-1 oligomerization, forming a large
multimeric
APAF-1.cytochrome c complex. Such a complex can be isolated using gel filtration
chromatography and is by itself sufficient to recruit and activate procaspase-9
in_complex:
id: GO:0043293
label: apoptosome