GLYCTK

Summary: cytoplasm localization is consistent with the UniProt isoform annotation and with GLYCTK acting as a soluble metabolic enzyme.

Reason: Cytoplasmic/cytosolic localization is directly supported for isoform 1 and also applies to isoform 2, so this is a valid cellular component annotation.

Summary: glycerate kinase activity is the specific core molecular function of GLYCTK. The UniProt catalytic activity describes ATP-dependent phosphorylation of (R)-glycerate to (2R)-3-phosphoglycerate, and human disease reports support loss of this enzyme activity in D-glyceric aciduria.

Reason: This term is specific, aspect-correct, and directly matches the characterized enzyme activity of GLYCTK. Experimental, phylogenetic, computational, and mutant-phenotype evidence all converge on glycerate kinase activity as the primary molecular function.

Summary: nucleotide binding is technically compatible with an ATP-dependent kinase but is too broad to add useful information when glycerate kinase activity is already annotated.

Reason: The annotation should be interpreted through the specific GO:0008887 glycerate kinase activity term. Broad parent terms such as nucleotide binding, kinase activity, and transferase activity blur the actual function.

Summary: ATP binding is required for the glycerate kinase reaction because ATP is the phosphate donor for conversion of (R)-glycerate to (2R)-3-phosphoglycerate.

Reason: Although less informative than glycerate kinase activity, ATP binding is mechanistically relevant and supported by the catalytic reaction.

Summary: cytoplasm localization is consistent with the UniProt isoform annotation and with GLYCTK acting as a soluble metabolic enzyme.

Reason: Cytoplasmic/cytosolic localization is directly supported for isoform 1 and also applies to isoform 2, so this is a valid cellular component annotation.

Summary: Mitochondrial localization is supported for GLYCTK isoform 2 and by high-throughput mitochondrial proteomics, but it is isoform/context-specific rather than the main location of GLYCTK.

Reason: ORGANELLES check (2026-10-25). This row is GO_REF:0000044 (UniProt SL-0173 keyword mapping). Synthesis-row and HTP checks below. The organelle claim has two independent lines. (1) UniProt records Mitochondrion for isoform 2 (GLYCTK2) with ECO:0000269 from PMID:16753811, a GFP-fusion study (cached abstract-only) in which both isoforms were cytosolic and GLYCTK2 was also mitochondrial; GO_REF:0000044 maps that SL-0173 location to the gene, so the feature the mapping assumes is present, though only for isoform 2. (2) The HTP row records GLYCTK in MitoCoP (PMID:34800366), a high-confidence proteome built from classified mitochondrial preparations of human cells; the per-protein table is supplementary and not cached, and proteomics does not resolve isoforms. Both lines are real, but the main location is cytosolic and the gene's metabolic role in D-glycerate metabolism (serine catabolism, minor fructose metabolism) is not shown to need the mitochondrial pool, so the claim is kept as non-core. Note that isoform 2 is a truncated product (residues 179-234 replaced, 235-523 missing), while the canonical full-length sequence begins with an arginine-rich, acid-free N-terminus (MAAALQVLPRLARAPLHPLLWRGSVARLASS) typical of a presequence; no transit peptide is annotated by UniProt and none was tested, so this is noted, not used as evidence. Stays at the root under rule 4: no sub-mitochondrial assay, no annotated transit peptide or TM, only the soluble-kinase argument for the matrix, a single line.

Summary: glycerate kinase activity is the specific core molecular function of GLYCTK. The UniProt catalytic activity describes ATP-dependent phosphorylation of (R)-glycerate to (2R)-3-phosphoglycerate, and human disease reports support loss of this enzyme activity in D-glyceric aciduria.

Reason: This term is specific, aspect-correct, and directly matches the characterized enzyme activity of GLYCTK. Experimental, phylogenetic, computational, and mutant-phenotype evidence all converge on glycerate kinase activity as the primary molecular function.

Summary: kinase activity is technically compatible with an ATP-dependent kinase but is too broad to add useful information when glycerate kinase activity is already annotated.

Reason: The annotation should be interpreted through the specific GO:0008887 glycerate kinase activity term. Broad parent terms such as nucleotide binding, kinase activity, and transferase activity blur the actual function.

Summary: transferase activity is technically compatible with an ATP-dependent kinase but is too broad to add useful information when glycerate kinase activity is already annotated.

Reason: The annotation should be interpreted through the specific GO:0008887 glycerate kinase activity term. Broad parent terms such as nucleotide binding, kinase activity, and transferase activity blur the actual function.

Summary: This generic protein binding row comes from high-throughput interactome evidence and does not describe the biochemical function of GLYCTK.

Reason: Protein binding is uninformative here and is not the core molecular role of this metabolic enzyme. The useful GO annotation is glycerate kinase activity.

Summary: This generic protein binding row comes from high-throughput interactome evidence and does not describe the biochemical function of GLYCTK.

Reason: Protein binding is uninformative here and is not the core molecular role of this metabolic enzyme. The useful GO annotation is glycerate kinase activity.

Summary: This generic protein binding row comes from high-throughput interactome evidence and does not describe the biochemical function of GLYCTK.

Reason: Protein binding is uninformative here and is not the core molecular role of this metabolic enzyme. The useful GO annotation is glycerate kinase activity.

Summary: This generic protein binding row comes from high-throughput interactome evidence and does not describe the biochemical function of GLYCTK.

Reason: Protein binding is uninformative here and is not the core molecular role of this metabolic enzyme. The useful GO annotation is glycerate kinase activity.

Summary: cytosol localization is consistent with the UniProt isoform annotation and with GLYCTK acting as a soluble metabolic enzyme.

Reason: Cytoplasmic/cytosolic localization is directly supported for isoform 1 and also applies to isoform 2, so this is a valid cellular component annotation.

Summary: GLYCTK participates in fructose catabolism by phosphorylating D-glycerate, a metabolite generated downstream of fructose metabolism, to 3-phosphoglycerate.

Reason: The Reactome pathway context is appropriate for GLYCTK. The direct molecular function remains glycerate kinase activity, but the biological-process placement in fructose catabolism is supported. GO:0061624 is obsolete in the GO release 2026-07-26 as a pathway variant (replaced_by GO:0006001, its former is_a parent), so the annotation moves to fructose catabolic process.

Proposed replacements: fructose catabolic process

Summary: glycerate kinase activity is the specific core molecular function of GLYCTK. The UniProt catalytic activity describes ATP-dependent phosphorylation of (R)-glycerate to (2R)-3-phosphoglycerate, and human disease reports support loss of this enzyme activity in D-glyceric aciduria.

Reason: This term is specific, aspect-correct, and directly matches the characterized enzyme activity of GLYCTK. Experimental, phylogenetic, computational, and mutant-phenotype evidence all converge on glycerate kinase activity as the primary molecular function.

Summary: Mitochondrial localization is supported for GLYCTK isoform 2 and by high-throughput mitochondrial proteomics, but it is isoform/context-specific rather than the main location of GLYCTK.

Reason: ORGANELLES check (2026-10-25). This row is a direct HTP proteomic detection (rule 2): an organelle-level assay that cannot resolve a sub-compartment, kept as non-core with the IEA row on the same term. Synthesis-row and HTP checks below. The organelle claim has two independent lines. (1) UniProt records Mitochondrion for isoform 2 (GLYCTK2) with ECO:0000269 from PMID:16753811, a GFP-fusion study (cached abstract-only) in which both isoforms were cytosolic and GLYCTK2 was also mitochondrial; GO_REF:0000044 maps that SL-0173 location to the gene, so the feature the mapping assumes is present, though only for isoform 2. (2) The HTP row records GLYCTK in MitoCoP (PMID:34800366), a high-confidence proteome built from classified mitochondrial preparations of human cells; the per-protein table is supplementary and not cached, and proteomics does not resolve isoforms. Both lines are real, but the main location is cytosolic and the gene's metabolic role in D-glycerate metabolism (serine catabolism, minor fructose metabolism) is not shown to need the mitochondrial pool, so the claim is kept as non-core. Note that isoform 2 is a truncated product (residues 179-234 replaced, 235-523 missing), while the canonical full-length sequence begins with an arginine-rich, acid-free N-terminus (MAAALQVLPRLARAPLHPLLWRGSVARLASS) typical of a presequence; no transit peptide is annotated by UniProt and none was tested, so this is noted, not used as evidence. Stays at the root under rule 4: no sub-mitochondrial assay, no annotated transit peptide or TM, only the soluble-kinase argument for the matrix, a single line.

Summary: glycerate kinase activity is the specific core molecular function of GLYCTK. The UniProt catalytic activity describes ATP-dependent phosphorylation of (R)-glycerate to (2R)-3-phosphoglycerate, and human disease reports support loss of this enzyme activity in D-glyceric aciduria.

Reason: This term is specific, aspect-correct, and directly matches the characterized enzyme activity of GLYCTK. Experimental, phylogenetic, computational, and mutant-phenotype evidence all converge on glycerate kinase activity as the primary molecular function.

Summary: glycerate kinase activity is the specific core molecular function of GLYCTK. The UniProt catalytic activity describes ATP-dependent phosphorylation of (R)-glycerate to (2R)-3-phosphoglycerate, and human disease reports support loss of this enzyme activity in D-glyceric aciduria.

Reason: This term is specific, aspect-correct, and directly matches the characterized enzyme activity of GLYCTK. Experimental, phylogenetic, computational, and mutant-phenotype evidence all converge on glycerate kinase activity as the primary molecular function.

Summary: cytosol localization is consistent with the UniProt isoform annotation and with GLYCTK acting as a soluble metabolic enzyme.

Reason: Cytoplasmic/cytosolic localization is directly supported for isoform 1 and also applies to isoform 2, so this is a valid cellular component annotation.

Summary: cytoplasm localization is consistent with the UniProt isoform annotation and with GLYCTK acting as a soluble metabolic enzyme.

Reason: Cytoplasmic/cytosolic localization is directly supported for isoform 1 and also applies to isoform 2, so this is a valid cellular component annotation.

Summary: GLYCTK is a small-molecule glycerate kinase, not a protein kinase. Its catalytic activity phosphorylates (R)-glycerate to (2R)-3-phosphoglycerate and does not support protein phosphorylation.

Reason: This is an aspect-correct BP term for protein kinases but a wrong biological-process annotation for GLYCTK. The evidence supports glycerate phosphorylation in metabolism, not phosphorylation of protein substrates.

Summary: glycerate kinase activity is the specific core molecular function of GLYCTK. The UniProt catalytic activity describes ATP-dependent phosphorylation of (R)-glycerate to (2R)-3-phosphoglycerate, and human disease reports support loss of this enzyme activity in D-glyceric aciduria.

Reason: This term is specific, aspect-correct, and directly matches the characterized enzyme activity of GLYCTK. Experimental, phylogenetic, computational, and mutant-phenotype evidence all converge on glycerate kinase activity as the primary molecular function.