{ "accession": "F8WDQ9", "retrieved_at": "2026-09-10T14:34:29.655984+00:00", "prediction_url": "https://rest.uniprot.org/uniprotkb/protnlm/F8WDQ9", "prediction_status": 200, "prediction": { "entryType": "UniProtKB unreviewed (TrEMBL)", "primaryAccession": "F8WDQ9", "uniProtkbId": "F8WDQ9_HUMAN", "entryAudit": { "firstPublicDate": "1111-11-10", "lastAnnotationUpdateDate": "1111-11-10", "lastSequenceUpdateDate": "1111-11-10", "entryVersion": 1, "sequenceVersion": 1 }, "annotationScore": 0.0, "proteinExistence": "5: Uncertain", "proteinDescription": { "recommendedName": { "fullName": { "evidences": [ { "evidenceCode": "ECO:0008006", "source": "Google", "id": "ProtNLM2", "properties": [ { "key": "model_score", "value": "1.00" }, { "key": "string_match_text", "value": "UBC core" }, { "key": "string_match_location", "value": "domain" }, { "key": "string_match_type", "value": "exact_sanitized" } ] } ], "value": "UBC core domain-containing protein" } } }, "comments": [ { "commentType": "SUBCELLULAR LOCATION", "subcellularLocations": [ { "location": { "evidences": [ { "evidenceCode": "ECO:0008006", "source": "Google", "id": "ProtNLM2", "properties": [ { "key": "model_score", "value": "0.25" }, { "key": "tmalign_accession", "value": "P63280" }, { "key": "tmalign_score_chain_1", "value": "0.59348" }, { "key": "tmalign_score_chain_2", "value": "0.40013" } ] } ], "value": "Nucleus", "id": "SL-0191" } } ] } ], "references": [ { "referenceNumber": 1, "citation": { "id": "CI-FC84BSHK1H4IL", "citationType": "unpublished observations" }, "referencePositions": [ "required field" ] } ], "uniProtKBCrossReferences": [ { "database": "GO", "id": "GO:0004842", "properties": [ { "key": "GoTerm", "value": "F:ubiquitin-protein transferase activity" }, { "key": "GoEvidenceType", "value": ":-" } ], "evidences": [ { "evidenceCode": "ECO:0008006", "source": "Google", "id": "ProtNLM2", "properties": [ { "key": "model_score", "value": "0.15" }, { "key": "phmmer_accession", "value": "Q6DCZ9" }, { "key": "phmmer_score", "value": "47.0" } ] } ] }, { "database": "GO", "id": "GO:0016567", "properties": [ { "key": "GoTerm", "value": "P:protein ubiquitination" }, { "key": "GoEvidenceType", "value": ":-" } ], "evidences": [ { "evidenceCode": "ECO:0008006", "source": "Google", "id": "ProtNLM2", "properties": [ { "key": "model_score", "value": "0.05" }, { "key": "tmalign_accession", "value": "I1RRW0" }, { "key": "tmalign_score_chain_1", "value": "0.65933" }, { "key": "tmalign_score_chain_2", "value": "0.41121" } ] } ] } ], "extraAttributes": { "countByCommentType": { "SUBCELLULAR LOCATION": 1 } } }, "uniprot_url": "https://rest.uniprot.org/uniprotkb/F8WDQ9.json", "uniprot_status": 200, "uniprot": { "entryType": "UniProtKB unreviewed (TrEMBL)", "primaryAccession": "F8WDQ9", "uniProtkbId": "F8WDQ9_HUMAN", "entryAudit": { "firstPublicDate": "2011-09-21", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2011-09-21", "entryVersion": 79, "sequenceVersion": 1 }, "annotationScore": 1.0, "organism": { "scientificName": "Homo sapiens", "commonName": "Human", "taxonId": 9606, "evidences": [ { "evidenceCode": "ECO:0000313", "source": "Ensembl", "id": "ENSP00000389685.1" }, { "evidenceCode": "ECO:0000313", "source": "Proteomes", "id": "UP000005640" } ], "lineage": [ "Eukaryota", "Metazoa", "Chordata", "Craniata", "Vertebrata", "Euteleostomi", "Mammalia", "Eutheria", "Euarchontoglires", "Primates", "Haplorrhini", "Catarrhini", "Hominidae", "Homo" ] }, "proteinExistence": "1: Evidence at protein level", "proteinDescription": { "submissionNames": [ { "fullName": { "evidences": [ { "evidenceCode": "ECO:0000313", "source": "Ensembl", "id": "ENSP00000389685.1" } ], "value": "Ubiquitin conjugating enzyme E2 F (putative)" } } ] }, "genes": [ { "geneName": { "evidences": [ { "evidenceCode": "ECO:0000313", "source": "Ensembl", "id": "ENSP00000389685.1" } ], "value": "UBE2F" } } ], "comments": [ { "texts": [ { "evidences": [ { "evidenceCode": "ECO:0000256", "source": "PROSITE-ProRule", "id": "PRU00388" } ], "value": "Belongs to the ubiquitin-conjugating enzyme family" } ], "commentType": "SIMILARITY" }, { "texts": [ { "evidences": [ { "evidenceCode": "ECO:0000256", "source": "PROSITE-ProRule", "id": "PRU00388" } ], "value": "Lacks conserved residue(s) required for the propagation of feature annotation" } ], "commentType": "CAUTION" } ], "features": [ { "type": "Domain", "location": { "start": { "value": 32, "modifier": "EXACT" }, "end": { "value": 101, "modifier": "EXACT" } }, "description": "UBC core", "evidences": [ { "evidenceCode": "ECO:0000259", "source": "PROSITE", "id": "PS50127" } ] }, { "type": "Region", "location": { "start": { "value": 1, "modifier": "EXACT" }, "end": { "value": 29, "modifier": "EXACT" } }, "description": "Disordered", "evidences": [ { "evidenceCode": "ECO:0000256", "source": "SAM", "id": "MobiDB-lite" } ] } ], "keywords": [ { "evidences": [ { "evidenceCode": "ECO:0007829", "source": "PeptideAtlas", "id": "F8WDQ9" }, { "evidenceCode": "ECO:0007829", "source": "ProteomicsDB", "id": "F8WDQ9" } ], "id": "KW-1267", "category": "Technical term", "name": "Proteomics identification" }, { "evidences": [ { "evidenceCode": "ECO:0000313", "source": "Proteomes", "id": "UP000005640" } ], "id": "KW-1185", "category": "Technical term", "name": "Reference proteome" } ], "references": [ { "referenceNumber": 1, "citation": { "id": "11237011", "citationType": "journal article", "authoringGroup": [ "International Human Genome Sequencing Consortium" ], "authors": [ "Lander E.S.", "Linton L.M.", "Birren B.", "Nusbaum C.", "Zody M.C.", "Baldwin J.", "Devon K.", "Dewar K.", "Doyle M.", "FitzHugh W.", "Funke R.", "Gage D.", "Harris K.", "Heaford A.", "Howland J.", "Kann L.", "Lehoczky J.", "LeVine R.", "McEwan P.", "McKernan K.", "Meldrim J.", "Mesirov J.P.", "Miranda C.", "Morris W.", "Naylor J.", "Raymond C.", "Rosetti M.", "Santos R.", "Sheridan A.", "Sougnez C.", "Stange-Thomann N.", "Stojanovic N.", "Subramanian A.", "Wyman D.", "Rogers J.", "Sulston J.", "Ainscough R.", "Beck S.", "Bentley D.", "Burton J.", "Clee C.", "Carter N.", "Coulson A.", "Deadman R.", "Deloukas P.", "Dunham A.", "Dunham I.", "Durbin R.", "French L.", "Grafham D.", "Gregory S.", "Hubbard T.", "Humphray S.", "Hunt A.", "Jones M.", "Lloyd C.", "McMurray A.", "Matthews L.", "Mercer S.", "Milne S.", "Mullikin J.C.", "Mungall A.", "Plumb R.", "Ross M.", "Shownkeen R.", "Sims S.", "Waterston R.H.", "Wilson R.K.", "Hillier L.W.", "McPherson J.D.", "Marra M.A.", "Mardis E.R.", "Fulton L.A.", "Chinwalla A.T.", "Pepin K.H.", "Gish W.R.", "Chissoe S.L.", "Wendl M.C.", "Delehaunty K.D.", "Miner T.L.", "Delehaunty A.", "Kramer J.B.", "Cook L.L.", "Fulton R.S.", "Johnson D.L.", "Minx P.J.", "Clifton S.W.", "Hawkins T.", "Branscomb E.", "Predki P.", "Richardson P.", "Wenning S.", "Slezak T.", "Doggett N.", "Cheng J.F.", "Olsen A.", "Lucas S.", "Elkin C.", "Uberbacher E.", "Frazier M.", "Gibbs R.A.", "Muzny D.M.", "Scherer S.E.", "Bouck J.B.", "Sodergren E.J.", "Worley K.C.", "Rives C.M.", "Gorrell J.H.", "Metzker M.L.", "Naylor S.L.", "Kucherlapati R.S.", "Nelson D.L.", "Weinstock G.M.", "Sakaki Y.", "Fujiyama A.", "Hattori M.", "Yada T.", "Toyoda A.", "Itoh T.", "Kawagoe C.", "Watanabe H.", "Totoki Y.", "Taylor T.", "Weissenbach J.", "Heilig R.", "Saurin W.", "Artiguenave F.", "Brottier P.", "Bruls T.", "Pelletier E.", "Robert C.", "Wincker P.", "Smith D.R.", "Doucette-Stamm L.", "Rubenfield M.", "Weinstock K.", "Lee H.M.", "Dubois J.", "Rosenthal A.", "Platzer M.", "Nyakatura G.", "Taudien S.", "Rump A.", "Yang H.", "Yu J.", "Wang J.", "Huang G.", "Gu J.", "Hood L.", "Rowen L.", "Madan A.", "Qin S.", "Davis R.W.", "Federspiel N.A.", "Abola A.P.", "Proctor M.J.", "Myers R.M.", "Schmutz J.", "Dickson M.", "Grimwood J.", "Cox D.R.", "Olson M.V.", "Kaul R.", "Raymond C.", "Shimizu N.", "Kawasaki K.", "Minoshima S.", "Evans G.A.", "Athanasiou M.", "Schultz R.", "Roe B.A.", "Chen F.", "Pan H.", "Ramser J.", "Lehrach H.", "Reinhardt R.", "McCombie W.R.", "de la Bastide M.", "Dedhia N.", "Blocker H.", "Hornischer K.", "Nordsiek G.", "Agarwala R.", "Aravind L.", "Bailey J.A.", "Bateman A.", "Batzoglou S.", "Birney E.", "Bork P.", "Brown D.G.", "Burge C.B.", "Cerutti L.", "Chen H.C.", "Church D.", "Clamp M.", "Copley R.R.", "Doerks T.", "Eddy S.R.", "Eichler E.E.", "Furey T.S.", "Galagan J.", "Gilbert J.G.", "Harmon C.", "Hayashizaki Y.", "Haussler D.", "Hermjakob H.", "Hokamp K.", "Jang W.", "Johnson L.S.", "Jones T.A.", "Kasif S.", "Kaspryzk A.", "Kennedy S.", "Kent W.J.", "Kitts P.", "Koonin E.V.", "Korf I.", "Kulp D.", "Lancet D.", "Lowe T.M.", "McLysaght A.", "Mikkelsen T.", "Moran J.V.", "Mulder N.", "Pollara V.J.", "Ponting C.P.", "Schuler G.", "Schultz J.", "Slater G.", "Smit A.F.", "Stupka E.", "Szustakowski J.", "Thierry-Mieg D.", "Thierry-Mieg J.", "Wagner L.", "Wallis J.", "Wheeler R.", "Williams A.", "Wolf Y.I.", "Wolfe K.H.", "Yang S.P.", "Yeh R.F.", "Collins F.", "Guyer M.S.", "Peterson J.", "Felsenfeld A.", "Wetterstrand K.A.", "Patrinos A.", "Morgan M.J.", "de Jong P.", "Catanese J.J.", "Osoegawa K.", "Shizuya H.", "Choi S.", "Chen Y.J." ], "citationCrossReferences": [ { "database": "PubMed", "id": "11237011" }, { "database": "DOI", "id": "10.1038/35057062" } ], "title": "Initial sequencing and analysis of the human genome.", "publicationDate": "2001", "journal": "Nature", "firstPage": "860", "lastPage": "921", "volume": "409" }, "referencePositions": [ "NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]" ], "evidences": [ { "evidenceCode": "ECO:0000313", "source": "Ensembl", "id": "ENSP00000389685.1" }, { "evidenceCode": "ECO:0000313", "source": "Proteomes", "id": "UP000005640" } ] }, { "referenceNumber": 2, "citation": { "id": "15496913", "citationType": "journal article", "authoringGroup": [ "International Human Genome Sequencing Consortium" ], "citationCrossReferences": [ { "database": "PubMed", "id": "15496913" }, { "database": "DOI", "id": "10.1038/nature03001" } ], "title": "Finishing the euchromatic sequence of the human genome.", "publicationDate": "2004", "journal": "Nature", "firstPage": "931", "lastPage": "945", "volume": "431" }, "referencePositions": [ "NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]" ], "evidences": [ { "evidenceCode": "ECO:0000313", "source": "Ensembl", "id": "ENSP00000389685.1" }, { "evidenceCode": "ECO:0000313", "source": "Proteomes", "id": "UP000005640" } ] }, { "referenceNumber": 3, "citation": { "id": "15815621", "citationType": "journal article", "authors": [ "Hillier L.W.", "Graves T.A.", "Fulton R.S.", "Fulton L.A.", "Pepin K.H.", "Minx P.", "Wagner-McPherson C.", "Layman D.", "Wylie K.", "Sekhon M.", "Becker M.C.", "Fewell G.A.", "Delehaunty K.D.", "Miner T.L.", "Nash W.E.", "Kremitzki C.", "Oddy L.", "Du H.", "Sun H.", "Bradshaw-Cordum H.", "Ali J.", "Carter J.", "Cordes M.", "Harris A.", "Isak A.", "van Brunt A.", "Nguyen C.", "Du F.", "Courtney L.", "Kalicki J.", "Ozersky P.", "Abbott S.", "Armstrong J.", "Belter E.A.", "Caruso L.", "Cedroni M.", "Cotton M.", "Davidson T.", "Desai A.", "Elliott G.", "Erb T.", "Fronick C.", "Gaige T.", "Haakenson W.", "Haglund K.", "Holmes A.", "Harkins R.", "Kim K.", "Kruchowski S.S.", "Strong C.M.", "Grewal N.", "Goyea E.", "Hou S.", "Levy A.", "Martinka S.", "Mead K.", "McLellan M.D.", "Meyer R.", "Randall-Maher J.", "Tomlinson C.", "Dauphin-Kohlberg S.", "Kozlowicz-Reilly A.", "Shah N.", "Swearengen-Shahid S.", "Snider J.", "Strong J.T.", "Thompson J.", "Yoakum M.", "Leonard S.", "Pearman C.", "Trani L.", "Radionenko M.", "Waligorski J.E.", "Wang C.", "Rock S.M.", "Tin-Wollam A.M.", "Maupin R.", "Latreille P.", "Wendl M.C.", "Yang S.P.", "Pohl C.", "Wallis J.W.", "Spieth J.", "Bieri T.A.", "Berkowicz N.", "Nelson J.O.", "Osborne J.", "Ding L.", "Meyer R.", "Sabo A.", "Shotland Y.", "Sinha P.", "Wohldmann P.E.", "Cook L.L.", "Hickenbotham M.T.", "Eldred J.", "Williams D.", "Jones T.A.", "She X.", "Ciccarelli F.D.", "Izaurralde E.", "Taylor J.", "Schmutz J.", "Myers R.M.", "Cox D.R.", "Huang X.", "McPherson J.D.", "Mardis E.R.", "Clifton S.W.", "Warren W.C.", "Chinwalla A.T.", "Eddy S.R.", "Marra M.A.", "Ovcharenko I.", "Furey T.S.", "Miller W.", "Eichler E.E.", "Bork P.", "Suyama M.", "Torrents D.", "Waterston R.H.", "Wilson R.K." ], "citationCrossReferences": [ { "database": "PubMed", "id": "15815621" }, { "database": "DOI", "id": "10.1038/nature03466" } ], "title": "Generation and annotation of the DNA sequences of human chromosomes 2 and 4.", "publicationDate": "2005", "journal": "Nature", "firstPage": "724", "lastPage": "731", "volume": "434" }, "referencePositions": [ "NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]" ], "evidences": [ { "evidenceCode": "ECO:0000313", "source": "Ensembl", "id": "ENSP00000389685.1" }, { "evidenceCode": "ECO:0000313", "source": "Proteomes", "id": "UP000005640" } ] }, { "referenceNumber": 4, "citation": { "id": "CI-20IM145UGQVF7", "citationType": "submission", "authoringGroup": [ "Ensembl" ], "publicationDate": "JAN-2026", "submissionDatabase": "UniProtKB" }, "referencePositions": [ "IDENTIFICATION" ], "evidences": [ { "evidenceCode": "ECO:0000313", "source": "Ensembl", "id": "ENSP00000389685.1" } ] } ], "uniProtKBCrossReferences": [ { "database": "EMBL", "id": "AC016776", "properties": [ { "key": "ProteinId", "value": "-" }, { "key": "Status", "value": "NOT_ANNOTATED_CDS" }, { "key": "MoleculeType", "value": "Genomic_DNA" } ] }, { "database": "EMBL", "id": "KF510802", "properties": [ { "key": "ProteinId", "value": "-" }, { "key": "Status", "value": "NOT_ANNOTATED_CDS" }, { "key": "MoleculeType", "value": "Genomic_DNA" } ] }, { "database": "AlphaFoldDB", "id": "F8WDQ9", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "SMR", "id": "F8WDQ9", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "MassIVE", "id": "F8WDQ9", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "ProteomicsDB", "id": "31581", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "Ensembl", "id": "ENST00000455999.5", "properties": [ { "key": "ProteinId", "value": "ENSP00000389685.1" }, { "key": "GeneId", "value": "ENSG00000184182.20" } ] }, { "database": "UCSC", "id": "uc061ucb.1", "properties": [ { "key": "OrganismName", "value": "human" } ] }, { "database": "HGNC", "id": "HGNC:12480", "properties": [ { "key": "GeneName", "value": "UBE2F" } ] }, { "database": "VEuPathDB", "id": "HostDB:ENSG00000184182", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "GeneTree", "id": "ENSGT00940000154349", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "OrthoDB", "id": "10249039at2759", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "Proteomes", "id": "UP000005640", "properties": [ { "key": "Component", "value": "Chromosome 2" } ] }, { "database": "Bgee", "id": "ENSG00000184182", "properties": [ { "key": "ExpressionPatterns", "value": "Expressed in body of pancreas and 189 other cell types or tissues" } ] }, { "database": "ExpressionAtlas", "id": "F8WDQ9", "properties": [ { "key": "ExpressionPatterns", "value": "baseline and differential" } ] }, { "database": "CDD", "id": "cd23794", "properties": [ { "key": "EntryName", "value": "UBCc_UBE2F_UBE2M" }, { "key": "MatchStatus", "value": "1" } ] }, { "database": "Gene3D", "id": "3.10.110.10", "properties": [ { "key": "EntryName", "value": "Ubiquitin Conjugating Enzyme" }, { "key": "MatchStatus", "value": "1" } ] }, { "database": "InterPro", "id": "IPR000608", "properties": [ { "key": "EntryName", "value": "UBC" } ] }, { "database": "InterPro", "id": "IPR016135", "properties": [ { "key": "EntryName", "value": "UBQ-conjugating_enzyme/RWD" } ] }, { "database": "SUPFAM", "id": "SSF54495", "properties": [ { "key": "EntryName", "value": "UBC-like" }, { "key": "MatchStatus", "value": "1" } ] }, { "database": "PROSITE", "id": "PS50127", "properties": [ { "key": "EntryName", "value": "UBC_2" }, { "key": "MatchStatus", "value": "1" } ] } ], "sequence": { "value": "MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVFIERTFN", "length": 101, "molWeight": 11401, "crc64": "07346460F5FAB17D", "md5": "325F2550533F0F86D90BE7BED0A50650" }, "extraAttributes": { "countByCommentType": { "SIMILARITY": 1, "CAUTION": 1 }, "countByFeatureType": { "Domain": 1, "Region": 1 }, "uniParcId": "UPI00018819CD" } } }