Existing Annotations Review

GO Term	Evidence	Action	Reason
GO:0043065 positive regulation of apoptotic process	IBA GO_REF:0000033	REMOVE	Summary: positive regulation of apoptotic process should not be retained as a direct Bcl2 annotation. Reason: The term is uninformative, conflicts with Bcl2 anti-apoptotic directionality, or describes an enzymatic/molecular activity not enabled by Bcl2. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 is an anti-apoptotic BCL-2 family regulator of mitochondrial membrane permeability; generic binding, enzymatic, or opposite-direction terms are not informative direct annotations. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports specific anti-apoptotic BCL-2 family activity rather than generic binding, enzymatic, or opposite-direction annotations.
GO:0097192 extrinsic apoptotic signaling pathway in absence of ligand	IBA GO_REF:0000033	MODIFY	Summary: extrinsic apoptotic signaling pathway in absence of ligand has the right biological area but is too generic or has the wrong direction for Bcl2 anti-apoptotic function. Reason: Bcl2 primarily inhibits mitochondrial/intrinsic apoptotic signaling and cytochrome c release. Bcl2 directly controls MOMP at the mitochondrial outer membrane, making it a direct regulator of the intrinsic pathway; the extrinsic pathway annotation does not reflect a direct Bcl2 mechanistic role. Proposed replacements: negative regulation of intrinsic apoptotic signaling pathway Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 prevents mitochondrial cytochrome c release and intrinsic apoptosis; directional or generic terms should be replaced with negative regulation or BH3-domain binding terms where possible. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as an inhibitor of mitochondrial apoptotic signaling and cytochrome c release, so directional or generic terms should be replaced by negative-regulation/BH-domain terms.
GO:0005741 mitochondrial outer membrane	IBA GO_REF:0000033	ACCEPT	Summary: mitochondrial outer membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0008630 intrinsic apoptotic signaling pathway in response to DNA damage	IBA GO_REF:0000033	MODIFY	Summary: Bcl2 inhibits, rather than executes, intrinsic apoptotic signaling in response to DNA damage. Reason: Use a negative-regulation intrinsic apoptotic signaling term without adding unsupported p53-class-mediator specificity. Proposed replacements: negative regulation of intrinsic apoptotic signaling pathway Supporting Evidence: file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. file:mouse/Bcl2/Bcl2-deep-research-falcon.md The primary molecular function of BCL-2 is suppression of intrinsic apoptosis by antagonizing pro-apoptotic BCL-2 family members.
GO:0015267 channel activity	IBA GO_REF:0000033	MARK AS OVER ANNOTATED	Summary: channel activity likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0001836 release of cytochrome c from mitochondria	IBA GO_REF:0000033	MODIFY	Summary: release of cytochrome c from mitochondria has the right biological area but is too generic or has the wrong direction for Bcl2 anti-apoptotic function. Reason: Bcl2 primarily inhibits mitochondrial/intrinsic apoptotic signaling and cytochrome c release. Bcl2 directly controls MOMP at the mitochondrial outer membrane, making it a direct regulator of the intrinsic pathway; the extrinsic pathway annotation does not reflect a direct Bcl2 mechanistic role. Proposed replacements: negative regulation of release of cytochrome c from mitochondria Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 prevents mitochondrial cytochrome c release and intrinsic apoptosis; directional or generic terms should be replaced with negative regulation or BH3-domain binding terms where possible. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as an inhibitor of mitochondrial apoptotic signaling and cytochrome c release, so directional or generic terms should be replaced by negative-regulation/BH-domain terms.
GO:0055085 transmembrane transport	IEA GO_REF:0000108	MARK AS OVER ANNOTATED	Summary: transmembrane transport likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0001541 ovarian follicle development	IEA GO_REF:0000117	KEEP AS NON CORE	Summary: ovarian follicle development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0002931 response to ischemia	IEA GO_REF:0000117	KEEP AS NON CORE	Summary: response to ischemia is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0005737 cytoplasm	IEA GO_REF:0000120	ACCEPT	Summary: cytoplasm is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0005741 mitochondrial outer membrane	IEA GO_REF:0000120	ACCEPT	Summary: mitochondrial outer membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0005789 endoplasmic reticulum membrane	IEA GO_REF:0000120	ACCEPT	Summary: endoplasmic reticulum membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0006914 autophagy	IEA GO_REF:0000043	MARK AS OVER ANNOTATED	Summary: autophagy likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0006915 apoptotic process	IEA GO_REF:0000043	MODIFY	Summary: Broad apoptotic process has the wrong direction for Bcl2, which suppresses apoptosis. Reason: Replace the positive/broad apoptosis process with negative regulation of apoptotic process, consistent with Bcl2 anti-apoptotic activity. Proposed replacements: negative regulation of apoptotic process Supporting Evidence: file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. file:mouse/Bcl2/Bcl2-deep-research-falcon.md The primary molecular function of BCL-2 is suppression of intrinsic apoptosis by antagonizing pro-apoptotic BCL-2 family members.
GO:0008630 intrinsic apoptotic signaling pathway in response to DNA damage	IEA GO_REF:0000117	MODIFY	Summary: Bcl2 inhibits, rather than executes, intrinsic apoptotic signaling in response to DNA damage. Reason: Use a negative-regulation intrinsic apoptotic signaling term without adding unsupported p53-class-mediator specificity. Proposed replacements: negative regulation of intrinsic apoptotic signaling pathway Supporting Evidence: file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. file:mouse/Bcl2/Bcl2-deep-research-falcon.md The primary molecular function of BCL-2 is suppression of intrinsic apoptosis by antagonizing pro-apoptotic BCL-2 family members.
GO:0008637 apoptotic mitochondrial changes	IEA GO_REF:0000117	MODIFY	Summary: Bcl2 does not execute apoptotic mitochondrial changes; it inhibits mitochondrial outer membrane permeabilization and cytochrome c release. Reason: Replace the positive apoptotic mitochondrial changes term with the supported negative-regulation term for Bcl2 anti-apoptotic mitochondrial function. Proposed replacements: negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
GO:0016020 membrane	IEA GO_REF:0000120	ACCEPT	Summary: membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0031965 nuclear membrane	IEA GO_REF:0000120	KEEP AS NON CORE	Summary: nuclear membrane is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0031966 mitochondrial membrane	IEA GO_REF:0000117	ACCEPT	Summary: mitochondrial membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0042981 regulation of apoptotic process	IEA GO_REF:0000002	MODIFY	Summary: regulation of apoptotic process has the right biological area but is too generic or has the wrong direction for Bcl2 anti-apoptotic function. Reason: Bcl2 primarily inhibits mitochondrial/intrinsic apoptotic signaling and cytochrome c release. Bcl2 directly controls MOMP at the mitochondrial outer membrane, making it a direct regulator of the intrinsic pathway; the extrinsic pathway annotation does not reflect a direct Bcl2 mechanistic role. Proposed replacements: negative regulation of apoptotic process Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 prevents mitochondrial cytochrome c release and intrinsic apoptosis; directional or generic terms should be replaced with negative regulation or BH3-domain binding terms where possible. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as an inhibitor of mitochondrial apoptotic signaling and cytochrome c release, so directional or generic terms should be replaced by negative-regulation/BH-domain terms.
GO:0043066 negative regulation of apoptotic process	IEA GO_REF:0000120	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0051384 response to glucocorticoid	IEA GO_REF:0000117	KEEP AS NON CORE	Summary: response to glucocorticoid is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0071456 cellular response to hypoxia	IEA GO_REF:0000117	KEEP AS NON CORE	Summary: cellular response to hypoxia is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0097192 extrinsic apoptotic signaling pathway in absence of ligand	IEA GO_REF:0000117	MODIFY	Summary: extrinsic apoptotic signaling pathway in absence of ligand has the right biological area but is too generic or has the wrong direction for Bcl2 anti-apoptotic function. Reason: Bcl2 primarily inhibits mitochondrial/intrinsic apoptotic signaling and cytochrome c release. Bcl2 directly controls MOMP at the mitochondrial outer membrane, making it a direct regulator of the intrinsic pathway; the extrinsic pathway annotation does not reflect a direct Bcl2 mechanistic role. Proposed replacements: negative regulation of intrinsic apoptotic signaling pathway Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 prevents mitochondrial cytochrome c release and intrinsic apoptosis; directional or generic terms should be replaced with negative regulation or BH3-domain binding terms where possible. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as an inhibitor of mitochondrial apoptotic signaling and cytochrome c release, so directional or generic terms should be replaced by negative-regulation/BH-domain terms.
GO:0005515 protein binding	IPI PMID:16509771 IAN family critically regulates survival and development of ...	KEEP AS NON CORE	Summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding. Reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
GO:0005515 protein binding	IPI PMID:16839884 Mitochondrial rhomboid PARL regulates cytochrome c release d...	KEEP AS NON CORE	Summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding. Reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
GO:0005515 protein binding	IPI PMID:20621101 Upregulation of Bcl2 inhibits apoptosis-driven BAX insertion...	KEEP AS NON CORE	Summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding. Reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
GO:0005515 protein binding	IPI PMID:20819940 Endogenous HMGB1 regulates autophagy.	KEEP AS NON CORE	Summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding. Reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
GO:0005515 protein binding	IPI PMID:21151042 Cyclic-AMP-dependent protein kinase A regulates apoptosis by...	KEEP AS NON CORE	Summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding. Reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
GO:0005515 protein binding	IPI PMID:22258505 Exercise-induced BCL2-regulated autophagy is required for mu...	KEEP AS NON CORE	Summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding. Reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
GO:0005515 protein binding	IPI PMID:29849149 Disruption of the beclin 1-BCL2 autophagy regulatory complex...	KEEP AS NON CORE	Summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding. Reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
GO:0002020 protease binding	ISO GO_REF:0000119	KEEP AS NON CORE	Summary: protease binding is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0005737 cytoplasm	ISO GO_REF:0000119	ACCEPT	Summary: cytoplasm is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0005739 mitochondrion	ISO GO_REF:0000119	ACCEPT	Summary: mitochondrion is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0005741 mitochondrial outer membrane	ISO GO_REF:0000119	ACCEPT	Summary: mitochondrial outer membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0005783 endoplasmic reticulum	ISO GO_REF:0000119	ACCEPT	Summary: endoplasmic reticulum is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0005789 endoplasmic reticulum membrane	ISO GO_REF:0000119	ACCEPT	Summary: endoplasmic reticulum membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0006974 DNA damage response	ISO GO_REF:0000119	KEEP AS NON CORE	Summary: DNA damage response is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0008284 positive regulation of cell population proliferation	ISO GO_REF:0000119	MARK AS OVER ANNOTATED	Summary: positive regulation of cell population proliferation likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0009410 response to xenobiotic stimulus	ISO GO_REF:0000119	MARK AS OVER ANNOTATED	Summary: response to xenobiotic stimulus likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0009636 response to toxic substance	ISO GO_REF:0000119	MARK AS OVER ANNOTATED	Summary: response to toxic substance likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0010039 response to iron ion	ISO GO_REF:0000119	MARK AS OVER ANNOTATED	Summary: response to iron ion likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0010507 negative regulation of autophagy	ISO GO_REF:0000119	KEEP AS NON CORE	Summary: Bcl2 directly inhibits autophagy by binding the BECN1/beclin-1 autophagy regulatory complex, but this is a non-core function relative to its primary anti-apoptotic role. Reason: Retain as direct non-core biology because Bcl2 regulates autophagy through BECN1/AMBRA1 interactions, while the core Bcl2 function remains inhibition of mitochondrial apoptosis. Supporting Evidence: file:mouse/Bcl2/Bcl2-uniprot.txt Also acts as an inhibitor of autophagy: interacts with BECN1 and AMBRA1 during non-starvation conditions and inhibits their autophagy function. PMID:22258505 prevent stimulus-induced disruption of the BCL2-beclin-1 complex and autophagy activation
GO:0015267 channel activity	ISO GO_REF:0000119	MARK AS OVER ANNOTATED	Summary: channel activity likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0016248 channel inhibitor activity	ISO GO_REF:0000119	ACCEPT	Summary: channel inhibitor activity is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0030061 mitochondrial crista	ISO GO_REF:0000096	MODIFY	Summary: Mitochondrial crista localization is not supported for Bcl2; mitochondrial outer membrane is the supported compartment. Reason: Bcl2 is annotated and described as a mitochondrial outer membrane/ER membrane anti-apoptotic protein, not a crista protein. Proposed replacements: mitochondrial outer membrane Supporting Evidence: file:mouse/Bcl2/Bcl2-uniprot.txt SUBCELLULAR LOCATION: Mitochondrion outer membrane file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL-2 is found on ER, mitochondria-associated membranes (MAM), and mitochondria/outer mitochondrial membrane.
GO:0030890 positive regulation of B cell proliferation	ISO GO_REF:0000119	MARK AS OVER ANNOTATED	Summary: positive regulation of B cell proliferation likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0031625 ubiquitin protein ligase binding	ISO GO_REF:0000119	KEEP AS NON CORE	Summary: ubiquitin protein ligase binding is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0031965 nuclear membrane	ISO GO_REF:0000119	KEEP AS NON CORE	Summary: nuclear membrane is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0032848 negative regulation of cellular pH reduction	ISO GO_REF:0000119	KEEP AS NON CORE	Summary: negative regulation of cellular pH reduction is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0032991 protein-containing complex	ISO GO_REF:0000119	ACCEPT	Summary: protein-containing complex is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0035094 response to nicotine	ISO GO_REF:0000119	MARK AS OVER ANNOTATED	Summary: response to nicotine likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0042802 identical protein binding	ISO GO_REF:0000119	ACCEPT	Summary: identical protein binding is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0043066 negative regulation of apoptotic process	ISO GO_REF:0000119	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0046930 pore complex	ISO GO_REF:0000119	MARK AS OVER ANNOTATED	Summary: pore complex likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0046982 protein heterodimerization activity	ISO GO_REF:0000119	ACCEPT	Summary: protein heterodimerization activity is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0050853 B cell receptor signaling pathway	ISO GO_REF:0000119	MARK AS OVER ANNOTATED	Summary: B cell receptor signaling pathway likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0051434 BH3 domain binding	ISO GO_REF:0000119	ACCEPT	Summary: BH3 domain binding is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0051607 defense response to virus	ISO GO_REF:0000119	MARK AS OVER ANNOTATED	Summary: defense response to virus likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0060090 molecular adaptor activity	ISO GO_REF:0000119	KEEP AS NON CORE	Summary: molecular adaptor activity is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0140297 DNA-binding transcription factor binding	ISO GO_REF:0000119	KEEP AS NON CORE	Summary: DNA-binding transcription factor binding is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:2000811 negative regulation of anoikis	ISO GO_REF:0000119	KEEP AS NON CORE	Summary: negative regulation of anoikis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:2001234 negative regulation of apoptotic signaling pathway	ISO GO_REF:0000119	ACCEPT	Summary: negative regulation of apoptotic signaling pathway is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:2001243 negative regulation of intrinsic apoptotic signaling pathway	ISO GO_REF:0000119	ACCEPT	Summary: negative regulation of intrinsic apoptotic signaling pathway is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0002020 protease binding	IEA GO_REF:0000107	KEEP AS NON CORE	Summary: protease binding is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0005634 nucleus	IEA GO_REF:0000107	KEEP AS NON CORE	Summary: nucleus is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0005739 mitochondrion	IEA GO_REF:0000107	ACCEPT	Summary: mitochondrion is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0005783 endoplasmic reticulum	IEA GO_REF:0000107	ACCEPT	Summary: endoplasmic reticulum is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0006974 DNA damage response	IEA GO_REF:0000107	KEEP AS NON CORE	Summary: DNA damage response is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0008284 positive regulation of cell population proliferation	IEA GO_REF:0000107	MARK AS OVER ANNOTATED	Summary: positive regulation of cell population proliferation likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0009636 response to toxic substance	IEA GO_REF:0000107	MARK AS OVER ANNOTATED	Summary: response to toxic substance likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0010039 response to iron ion	IEA GO_REF:0000107	MARK AS OVER ANNOTATED	Summary: response to iron ion likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0010507 negative regulation of autophagy	IEA GO_REF:0000107	KEEP AS NON CORE	Summary: Bcl2 directly inhibits autophagy by binding the BECN1/beclin-1 autophagy regulatory complex, but this is a non-core function relative to its primary anti-apoptotic role. Reason: Retain as direct non-core biology because Bcl2 regulates autophagy through BECN1/AMBRA1 interactions, while the core Bcl2 function remains inhibition of mitochondrial apoptosis. Supporting Evidence: file:mouse/Bcl2/Bcl2-uniprot.txt Also acts as an inhibitor of autophagy: interacts with BECN1 and AMBRA1 during non-starvation conditions and inhibits their autophagy function. PMID:22258505 prevent stimulus-induced disruption of the BCL2-beclin-1 complex and autophagy activation
GO:0015267 channel activity	IEA GO_REF:0000107	MARK AS OVER ANNOTATED	Summary: channel activity likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0016248 channel inhibitor activity	IEA GO_REF:0000107	ACCEPT	Summary: channel inhibitor activity is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0030890 positive regulation of B cell proliferation	IEA GO_REF:0000107	MARK AS OVER ANNOTATED	Summary: positive regulation of B cell proliferation likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0031625 ubiquitin protein ligase binding	IEA GO_REF:0000107	KEEP AS NON CORE	Summary: ubiquitin protein ligase binding is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0032848 negative regulation of cellular pH reduction	IEA GO_REF:0000107	KEEP AS NON CORE	Summary: negative regulation of cellular pH reduction is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0032991 protein-containing complex	IEA GO_REF:0000107	ACCEPT	Summary: protein-containing complex is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0035094 response to nicotine	IEA GO_REF:0000107	MARK AS OVER ANNOTATED	Summary: response to nicotine likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0042802 identical protein binding	IEA GO_REF:0000107	ACCEPT	Summary: identical protein binding is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0043565 sequence-specific DNA binding	IEA GO_REF:0000107	REMOVE	Summary: sequence-specific DNA binding should not be retained as a direct Bcl2 annotation. Reason: The term is uninformative, conflicts with Bcl2 anti-apoptotic directionality, or describes an enzymatic/molecular activity not enabled by Bcl2. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 is an anti-apoptotic BCL-2 family regulator of mitochondrial membrane permeability; generic binding, enzymatic, or opposite-direction terms are not informative direct annotations. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports specific anti-apoptotic BCL-2 family activity rather than generic binding, enzymatic, or opposite-direction annotations.
GO:0046930 pore complex	IEA GO_REF:0000107	MARK AS OVER ANNOTATED	Summary: pore complex likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0046982 protein heterodimerization activity	IEA GO_REF:0000107	ACCEPT	Summary: protein heterodimerization activity is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0050853 B cell receptor signaling pathway	IEA GO_REF:0000107	MARK AS OVER ANNOTATED	Summary: B cell receptor signaling pathway likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0051434 BH3 domain binding	IEA GO_REF:0000107	ACCEPT	Summary: BH3 domain binding is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0051607 defense response to virus	IEA GO_REF:0000107	MARK AS OVER ANNOTATED	Summary: defense response to virus likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0140297 DNA-binding transcription factor binding	IEA GO_REF:0000107	KEEP AS NON CORE	Summary: DNA-binding transcription factor binding is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:2000811 negative regulation of anoikis	IEA GO_REF:0000107	KEEP AS NON CORE	Summary: negative regulation of anoikis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:2001234 negative regulation of apoptotic signaling pathway	IEA GO_REF:0000107	ACCEPT	Summary: negative regulation of apoptotic signaling pathway is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:2001243 negative regulation of intrinsic apoptotic signaling pathway	IEA GO_REF:0000107	ACCEPT	Summary: negative regulation of intrinsic apoptotic signaling pathway is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0097138 BAD-BCL-2 complex	ISO GO_REF:0000119	ACCEPT	Summary: BAD-BCL-2 complex is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0097148 BCL-2 complex	ISO GO_REF:0000119	ACCEPT	Summary: BCL-2 complex is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0005737 cytoplasm	ISO GO_REF:0000096	ACCEPT	Summary: cytoplasm is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0005739 mitochondrion	ISO GO_REF:0000096	ACCEPT	Summary: mitochondrion is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0010667 negative regulation of cardiac muscle cell apoptotic process	ISO GO_REF:0000096	KEEP AS NON CORE	Summary: negative regulation of cardiac muscle cell apoptotic process is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0043066 negative regulation of apoptotic process	ISO GO_REF:0000096	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0044877 protein-containing complex binding	ISO GO_REF:0000096	KEEP AS NON CORE	Summary: protein-containing complex binding is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0045471 response to ethanol	ISO GO_REF:0000096	KEEP AS NON CORE	Summary: response to ethanol is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0048471 perinuclear region of cytoplasm	ISO GO_REF:0000096	KEEP AS NON CORE	Summary: perinuclear region of cytoplasm is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0051400 BH domain binding	ISO GO_REF:0000096	ACCEPT	Summary: BH domain binding is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0000902 cell morphogenesis	IDA PMID:18548006 Osteoclast size is controlled by Fra-2 through LIF/LIF-recep...	KEEP AS NON CORE	Summary: cell morphogenesis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0005737 cytoplasm	IDA PMID:36812915 Exercise-activated hepatic autophagy via the FN1-α5β1 integr...	ACCEPT	Summary: cytoplasm is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0010507 negative regulation of autophagy	IDA PMID:36812915 Exercise-activated hepatic autophagy via the FN1-α5β1 integr...	KEEP AS NON CORE	Summary: Bcl2 directly inhibits autophagy by binding the BECN1/beclin-1 autophagy regulatory complex, but this is a non-core function relative to its primary anti-apoptotic role. Reason: Retain as direct non-core biology because Bcl2 regulates autophagy through BECN1/AMBRA1 interactions, while the core Bcl2 function remains inhibition of mitochondrial apoptosis. Supporting Evidence: file:mouse/Bcl2/Bcl2-uniprot.txt Also acts as an inhibitor of autophagy: interacts with BECN1 and AMBRA1 during non-starvation conditions and inhibits their autophagy function. PMID:22258505 prevent stimulus-induced disruption of the BCL2-beclin-1 complex and autophagy activation
GO:0060090 molecular adaptor activity	IDA PMID:36812915 Exercise-activated hepatic autophagy via the FN1-α5β1 integr...	KEEP AS NON CORE	Summary: molecular adaptor activity is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0009791 post-embryonic development	TAS PMID:10674380 Hair follicle apoptosis and Bcl-2.	KEEP AS NON CORE	Summary: post-embryonic development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0048087 positive regulation of developmental pigmentation	TAS PMID:10674380 Hair follicle apoptosis and Bcl-2.	KEEP AS NON CORE	Summary: positive regulation of developmental pigmentation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0005737 cytoplasm	IDA PMID:29020630 Degradation of Bcl-2 by XIAP and ARTS Promotes Apoptosis.	ACCEPT	Summary: cytoplasm is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0005741 mitochondrial outer membrane	ISS GO_REF:0000024	ACCEPT	Summary: mitochondrial outer membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0005789 endoplasmic reticulum membrane	ISS GO_REF:0000024	ACCEPT	Summary: endoplasmic reticulum membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0010507 negative regulation of autophagy	ISS GO_REF:0000024	KEEP AS NON CORE	Summary: Bcl2 directly inhibits autophagy by binding the BECN1/beclin-1 autophagy regulatory complex, but this is a non-core function relative to its primary anti-apoptotic role. Reason: Retain as direct non-core biology because Bcl2 regulates autophagy through BECN1/AMBRA1 interactions, while the core Bcl2 function remains inhibition of mitochondrial apoptosis. Supporting Evidence: file:mouse/Bcl2/Bcl2-uniprot.txt Also acts as an inhibitor of autophagy: interacts with BECN1 and AMBRA1 during non-starvation conditions and inhibits their autophagy function. PMID:22258505 prevent stimulus-induced disruption of the BCL2-beclin-1 complex and autophagy activation
GO:0048873 homeostasis of number of cells within a tissue	IMP PMID:9241272 Bcl-2 and Bax function independently to regulate cell death.	KEEP AS NON CORE	Summary: homeostasis of number of cells within a tissue is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0005515 protein binding	IPI PMID:10582606 Bax and Bcl-2 interaction in a transgenic mouse model of fam...	KEEP AS NON CORE	Summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding. Reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
GO:0005515 protein binding	IPI PMID:11226327 Bax ablation prevents dopaminergic neurodegeneration in the ...	KEEP AS NON CORE	Summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding. Reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
GO:0005515 protein binding	IPI PMID:7834748 Bad, a heterodimeric partner for Bcl-XL and Bcl-2, displaces...	KEEP AS NON CORE	Summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding. Reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
GO:0005515 protein binding	IPI PMID:8918887 BID: a novel BH3 domain-only death agonist.	KEEP AS NON CORE	Summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding. Reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
GO:0040008 regulation of growth	IMP PMID:7812968 bcl-2 deficiency in mice leads to pleiotropic abnormalities:...	KEEP AS NON CORE	Summary: regulation of growth is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0040008 regulation of growth	IMP PMID:8170972 Targeted disruption of Bcl-2 alpha beta in mice: occurrence ...	KEEP AS NON CORE	Summary: regulation of growth is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0005515 protein binding	IPI PMID:15983387 Frag1, a homolog of alternative replication factor C subunit...	KEEP AS NON CORE	Summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding. Reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
GO:0008630 intrinsic apoptotic signaling pathway in response to DNA damage	IGI PMID:15983387 Frag1, a homolog of alternative replication factor C subunit...	MODIFY	Summary: Bcl2 inhibits, rather than executes, intrinsic apoptotic signaling in response to DNA damage. Reason: Use a negative-regulation intrinsic apoptotic signaling term without adding unsupported p53-class-mediator specificity. Proposed replacements: negative regulation of intrinsic apoptotic signaling pathway Supporting Evidence: file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. file:mouse/Bcl2/Bcl2-deep-research-falcon.md The primary molecular function of BCL-2 is suppression of intrinsic apoptosis by antagonizing pro-apoptotic BCL-2 family members.
GO:0008284 positive regulation of cell population proliferation	IMP PMID:8084613 Antisense oligonucleotides suppress B-cell lymphoma growth i...	MARK AS OVER ANNOTATED	Summary: positive regulation of cell population proliferation likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0030217 T cell differentiation	IGI PMID:9215624 Bcl-2 can rescue T lymphocyte development in interleukin-7 r...	KEEP AS NON CORE	Summary: T cell differentiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0098609 cell-cell adhesion	IMP PMID:15292044 Alterations in cell-adhesive and migratory properties of pro...	KEEP AS NON CORE	Summary: cell-cell adhesion is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0005515 protein binding	IPI PMID:23629966 Deacetylation of p53 induces autophagy by suppressing Bmf ex...	KEEP AS NON CORE	Summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding. Reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
GO:0042981 regulation of apoptotic process	IGI PMID:8918887 BID: a novel BH3 domain-only death agonist.	MODIFY	Summary: regulation of apoptotic process has the right biological area but is too generic or has the wrong direction for Bcl2 anti-apoptotic function. Reason: Bcl2 primarily inhibits mitochondrial/intrinsic apoptotic signaling and cytochrome c release. Bcl2 directly controls MOMP at the mitochondrial outer membrane, making it a direct regulator of the intrinsic pathway; the extrinsic pathway annotation does not reflect a direct Bcl2 mechanistic role. Proposed replacements: negative regulation of apoptotic process Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 prevents mitochondrial cytochrome c release and intrinsic apoptosis; directional or generic terms should be replaced with negative regulation or BH3-domain binding terms where possible. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as an inhibitor of mitochondrial apoptotic signaling and cytochrome c release, so directional or generic terms should be replaced by negative-regulation/BH-domain terms.
GO:0005515 protein binding	IPI PMID:26949185 BOK Is a Non-canonical BCL-2 Family Effector of Apoptosis Re...	KEEP AS NON CORE	Summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding. Reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
GO:0005515 protein binding	IPI PMID:17475835 Involvement of heat shock protein (Hsp)90 beta but not Hsp90...	KEEP AS NON CORE	Summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding. Reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
GO:0006915 apoptotic process	ISO PMID:8022822 Evidence that BCL-2 represses apoptosis by regulating endopl...	MODIFY	Summary: Broad apoptotic process has the wrong direction for Bcl2, which suppresses apoptosis. Reason: Replace the positive/broad apoptosis process with negative regulation of apoptotic process, consistent with Bcl2 anti-apoptotic activity. Proposed replacements: negative regulation of apoptotic process Supporting Evidence: file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. file:mouse/Bcl2/Bcl2-deep-research-falcon.md The primary molecular function of BCL-2 is suppression of intrinsic apoptosis by antagonizing pro-apoptotic BCL-2 family members.
GO:0006915 apoptotic process	IMP PMID:8170972 Targeted disruption of Bcl-2 alpha beta in mice: occurrence ...	MODIFY	Summary: Broad apoptotic process has the wrong direction for Bcl2, which suppresses apoptosis. Reason: Replace the positive/broad apoptosis process with negative regulation of apoptotic process, consistent with Bcl2 anti-apoptotic activity. Proposed replacements: negative regulation of apoptotic process Supporting Evidence: file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. file:mouse/Bcl2/Bcl2-deep-research-falcon.md The primary molecular function of BCL-2 is suppression of intrinsic apoptosis by antagonizing pro-apoptotic BCL-2 family members.
GO:0006915 apoptotic process	IMP PMID:8372353 Disappearance of the lymphoid system in Bcl-2 homozygous mut...	MODIFY	Summary: Broad apoptotic process has the wrong direction for Bcl2, which suppresses apoptosis. Reason: Replace the positive/broad apoptosis process with negative regulation of apoptotic process, consistent with Bcl2 anti-apoptotic activity. Proposed replacements: negative regulation of apoptotic process Supporting Evidence: file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. file:mouse/Bcl2/Bcl2-deep-research-falcon.md The primary molecular function of BCL-2 is suppression of intrinsic apoptosis by antagonizing pro-apoptotic BCL-2 family members.
GO:0006915 apoptotic process	ISO PMID:8949945 Bcl-2 prevents hippocampal cell death induced by the neurole...	MODIFY	Summary: Broad apoptotic process has the wrong direction for Bcl2, which suppresses apoptosis. Reason: Replace the positive/broad apoptosis process with negative regulation of apoptotic process, consistent with Bcl2 anti-apoptotic activity. Proposed replacements: negative regulation of apoptotic process Supporting Evidence: file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. file:mouse/Bcl2/Bcl2-deep-research-falcon.md The primary molecular function of BCL-2 is suppression of intrinsic apoptosis by antagonizing pro-apoptotic BCL-2 family members.
GO:0042149 cellular response to glucose starvation	IDA PMID:7595537 Bcl-2 protects neural cells from cyanide/aglycemia-induced l...	KEEP AS NON CORE	Summary: cellular response to glucose starvation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0071456 cellular response to hypoxia	IDA PMID:7595537 Bcl-2 protects neural cells from cyanide/aglycemia-induced l...	KEEP AS NON CORE	Summary: cellular response to hypoxia is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0005515 protein binding	IPI PMID:11546872 Bmf: a proapoptotic BH3-only protein regulated by interactio...	KEEP AS NON CORE	Summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding. Reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
GO:2001234 negative regulation of apoptotic signaling pathway	IDA PMID:11546872 Bmf: a proapoptotic BH3-only protein regulated by interactio...	ACCEPT	Summary: negative regulation of apoptotic signaling pathway is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:2001240 negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	ISO GO_REF:0000008	KEEP AS NON CORE	Summary: negative regulation of extrinsic apoptotic signaling pathway in absence of ligand is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0008637 apoptotic mitochondrial changes	IDA PMID:14707049 TCR-independent and caspase-independent apoptosis of murine ...	MODIFY	Summary: Bcl2 does not execute apoptotic mitochondrial changes; it inhibits mitochondrial outer membrane permeabilization and cytochrome c release. Reason: Replace the positive apoptotic mitochondrial changes term with the supported negative-regulation term for Bcl2 anti-apoptotic mitochondrial function. Proposed replacements: negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
GO:0008631 intrinsic apoptotic signaling pathway in response to oxidative stress	IMP PMID:12855558 Bcl2 retards G1/S cell cycle transition by regulating intrac...	KEEP AS NON CORE	Summary: intrinsic apoptotic signaling pathway in response to oxidative stress is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0002931 response to ischemia	IMP PMID:10488913 Targeted disruption of the bcl-2 gene in mice exacerbates fo...	KEEP AS NON CORE	Summary: response to ischemia is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0005515 protein binding	IPI PMID:12082633 Proapoptotic activity of ITM2B(s), a BH3-only protein induce...	KEEP AS NON CORE	Summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding. Reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
GO:0097192 extrinsic apoptotic signaling pathway in absence of ligand	IGI PMID:12082633 Proapoptotic activity of ITM2B(s), a BH3-only protein induce...	MODIFY	Summary: extrinsic apoptotic signaling pathway in absence of ligand has the right biological area but is too generic or has the wrong direction for Bcl2 anti-apoptotic function. Reason: Bcl2 primarily inhibits mitochondrial/intrinsic apoptotic signaling and cytochrome c release. Bcl2 directly controls MOMP at the mitochondrial outer membrane, making it a direct regulator of the intrinsic pathway; the extrinsic pathway annotation does not reflect a direct Bcl2 mechanistic role. Proposed replacements: negative regulation of intrinsic apoptotic signaling pathway Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 prevents mitochondrial cytochrome c release and intrinsic apoptosis; directional or generic terms should be replaced with negative regulation or BH3-domain binding terms where possible. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as an inhibitor of mitochondrial apoptotic signaling and cytochrome c release, so directional or generic terms should be replaced by negative-regulation/BH-domain terms.
GO:0008625 extrinsic apoptotic signaling pathway via death domain receptors	ISO PMID:10597216 Bis, a Bcl-2-binding protein that synergizes with Bcl-2 in p...	KEEP AS NON CORE	Summary: extrinsic apoptotic signaling pathway via death domain receptors is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:2000134 negative regulation of G1/S transition of mitotic cell cycle	IMP PMID:12855558 Bcl2 retards G1/S cell cycle transition by regulating intrac...	KEEP AS NON CORE	Summary: negative regulation of G1/S transition of mitotic cell cycle is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:2000134 negative regulation of G1/S transition of mitotic cell cycle	IDA PMID:14660795 Mono- and multisite phosphorylation enhances Bcl2's antiapop...	KEEP AS NON CORE	Summary: negative regulation of G1/S transition of mitotic cell cycle is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:2000134 negative regulation of G1/S transition of mitotic cell cycle	IMP PMID:14660795 Mono- and multisite phosphorylation enhances Bcl2's antiapop...	KEEP AS NON CORE	Summary: negative regulation of G1/S transition of mitotic cell cycle is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0010506 regulation of autophagy	IMP PMID:22258505 Exercise-induced BCL2-regulated autophagy is required for mu...	MODIFY	Summary: PMID:22258505 supports Bcl2 as a negative regulator of stimulus-induced autophagy through the BCL2-beclin-1 complex. Reason: Use the more specific term negative regulation of autophagy, which captures the direction of Bcl2 action in the BCL2-beclin-1 complex. Proposed replacements: negative regulation of autophagy Supporting Evidence: PMID:22258505 prevent stimulus-induced disruption of the BCL2-beclin-1 complex and autophagy activation file:mouse/Bcl2/Bcl2-uniprot.txt GO; GO:0010507; P:negative regulation of autophagy; IDA:UniProt.
GO:0016020 membrane	IDA PMID:8030757 Bcl-2 protein expression during murine development.	ACCEPT	Summary: membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0043066 negative regulation of apoptotic process	IDA PMID:9560217 Bax directly induces release of cytochrome c from isolated m...	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0005515 protein binding	IPI PMID:18223655 Dual role of proapoptotic BAD in insulin secretion and beta ...	KEEP AS NON CORE	Summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding. Reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
GO:0072593 reactive oxygen species metabolic process	IMP PMID:10726970 Developmental changes in antioxidant enzymes and oxidative d...	KEEP AS NON CORE	Summary: reactive oxygen species metabolic process is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0072593 reactive oxygen species metabolic process	IMP PMID:12855558 Bcl2 retards G1/S cell cycle transition by regulating intrac...	KEEP AS NON CORE	Summary: reactive oxygen species metabolic process is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0072593 reactive oxygen species metabolic process	IMP PMID:9681465 Enhanced oxidative stress and altered antioxidants in brains...	KEEP AS NON CORE	Summary: reactive oxygen species metabolic process is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0001657 ureteric bud development	IMP PMID:8623928 Apoptosis during an early stage of nephrogenesis induces ren...	KEEP AS NON CORE	Summary: ureteric bud development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0019903 protein phosphatase binding	IDA PMID:12617961 Calcium-dependent interaction of calcineurin with Bcl-2 in n...	KEEP AS NON CORE	Summary: protein phosphatase binding is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0051721 protein phosphatase 2A binding	IDA PMID:16717086 PP2A regulates BCL-2 phosphorylation and proteasome-mediated...	KEEP AS NON CORE	Summary: protein phosphatase 2A binding is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0005515 protein binding	IPI PMID:15613488 Proapoptotic BAX and BAK regulate the type 1 inositol trisph...	KEEP AS NON CORE	Summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding. Reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
GO:0030307 positive regulation of cell growth	ISO PMID:8022822 Evidence that BCL-2 represses apoptosis by regulating endopl...	MARK AS OVER ANNOTATED	Summary: positive regulation of cell growth likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0000209 protein polyubiquitination	ISO PMID:16717086 PP2A regulates BCL-2 phosphorylation and proteasome-mediated...	MARK AS OVER ANNOTATED	Summary: protein polyubiquitination likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0005737 cytoplasm	ISO PMID:7546744 Role of BCL-2 in the survival and function of developing and...	ACCEPT	Summary: cytoplasm is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0016020 membrane	ISO PMID:7896880 The intracellular distribution and pattern of expression of ...	ACCEPT	Summary: membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0005739 mitochondrion	HDA PMID:18614015 A mitochondrial protein compendium elucidates complex I dise...	ACCEPT	Summary: mitochondrion is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0005634 nucleus	ISO PMID:7546744 Role of BCL-2 in the survival and function of developing and...	KEEP AS NON CORE	Summary: nucleus is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0005634 nucleus	ISO PMID:7896880 The intracellular distribution and pattern of expression of ...	KEEP AS NON CORE	Summary: nucleus is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0005739 mitochondrion	ISO PMID:7896880 The intracellular distribution and pattern of expression of ...	ACCEPT	Summary: mitochondrion is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0009410 response to xenobiotic stimulus	ISO PMID:8949945 Bcl-2 prevents hippocampal cell death induced by the neurole...	MARK AS OVER ANNOTATED	Summary: response to xenobiotic stimulus likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0009636 response to toxic substance	ISO PMID:16717086 PP2A regulates BCL-2 phosphorylation and proteasome-mediated...	MARK AS OVER ANNOTATED	Summary: response to toxic substance likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0034097 response to cytokine	ISO PMID:9184696 The apoptosis and proliferation of SAC-activated B cells by ...	KEEP AS NON CORE	Summary: response to cytokine is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0042100 B cell proliferation	ISO PMID:1373874 Bcl-2 confers growth and survival advantage to interleukin 7...	MARK AS OVER ANNOTATED	Summary: B cell proliferation likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0043066 negative regulation of apoptotic process	ISO PMID:1373874 Bcl-2 confers growth and survival advantage to interleukin 7...	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0043066 negative regulation of apoptotic process	ISO PMID:7650367 Expression of Bcl-2, Bcl-x, and Bax after T cell activation ...	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0043066 negative regulation of apoptotic process	ISO PMID:7772249 Evolutionary conservation of function among mammalian, avian...	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0043066 negative regulation of apoptotic process	ISO PMID:8050499 bcl-2 gene prevents apoptosis of basic fibroblast growth fac...	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0043066 negative regulation of apoptotic process	ISO PMID:8080725 bcl-2 gene enables rescue from in vitro myelosuppression (bo...	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0043524 negative regulation of neuron apoptotic process	ISO PMID:7546744 Role of BCL-2 in the survival and function of developing and...	ACCEPT	Summary: negative regulation of neuron apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0051924 regulation of calcium ion transport	ISO PMID:8022822 Evidence that BCL-2 represses apoptosis by regulating endopl...	KEEP AS NON CORE	Summary: regulation of calcium ion transport is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0043066 negative regulation of apoptotic process	ISS PMID:15776018 Proapoptotic BAX and BAK control multiple initiator caspases...	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0070059 intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	ISS PMID:15776018 Proapoptotic BAX and BAK control multiple initiator caspases...	MODIFY	Summary: Bcl2 is supported as an inhibitor, not an activator, of ER-stress intrinsic apoptotic signaling. Reason: Replace the positive pathway term with negative regulation of ER-stress-induced intrinsic apoptotic signaling, matching Bcl2 anti-apoptotic biology. Proposed replacements: negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
GO:0005789 endoplasmic reticulum membrane	IDA PMID:15613488 Proapoptotic BAX and BAK regulate the type 1 inositol trisph...	ACCEPT	Summary: endoplasmic reticulum membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0010523 negative regulation of calcium ion transport into cytosol	IGI PMID:15613488 Proapoptotic BAX and BAK regulate the type 1 inositol trisph...	KEEP AS NON CORE	Summary: negative regulation of calcium ion transport into cytosol is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0032469 endoplasmic reticulum calcium ion homeostasis	IGI PMID:15613488 Proapoptotic BAX and BAK regulate the type 1 inositol trisph...	KEEP AS NON CORE	Summary: endoplasmic reticulum calcium ion homeostasis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0033138 positive regulation of peptidyl-serine phosphorylation	IGI PMID:15613488 Proapoptotic BAX and BAK regulate the type 1 inositol trisph...	KEEP AS NON CORE	Summary: positive regulation of peptidyl-serine phosphorylation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0005515 protein binding	IPI PMID:16717086 PP2A regulates BCL-2 phosphorylation and proteasome-mediated...	KEEP AS NON CORE	Summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding. Reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
GO:0001658 branching involved in ureteric bud morphogenesis	IGI PMID:16672320 Suppression of ureteric bud apoptosis rescues nephron endowm...	KEEP AS NON CORE	Summary: branching involved in ureteric bud morphogenesis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0001822 kidney development	IMP PMID:15818405 Polycystic kidney disease prevented by transgenic RNA interf...	KEEP AS NON CORE	Summary: kidney development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0001822 kidney development	IGI PMID:16672320 Suppression of ureteric bud apoptosis rescues nephron endowm...	KEEP AS NON CORE	Summary: kidney development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0002260 lymphocyte homeostasis	IGI PMID:15818405 Polycystic kidney disease prevented by transgenic RNA interf...	KEEP AS NON CORE	Summary: lymphocyte homeostasis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0042981 regulation of apoptotic process	IGI PMID:15818405 Polycystic kidney disease prevented by transgenic RNA interf...	MODIFY	Summary: regulation of apoptotic process has the right biological area but is too generic or has the wrong direction for Bcl2 anti-apoptotic function. Reason: Bcl2 primarily inhibits mitochondrial/intrinsic apoptotic signaling and cytochrome c release. Bcl2 directly controls MOMP at the mitochondrial outer membrane, making it a direct regulator of the intrinsic pathway; the extrinsic pathway annotation does not reflect a direct Bcl2 mechanistic role. Proposed replacements: negative regulation of apoptotic process Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 prevents mitochondrial cytochrome c release and intrinsic apoptosis; directional or generic terms should be replaced with negative regulation or BH3-domain binding terms where possible. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as an inhibitor of mitochondrial apoptotic signaling and cytochrome c release, so directional or generic terms should be replaced by negative-regulation/BH-domain terms.
GO:0043067 regulation of programmed cell death	IGI PMID:16672320 Suppression of ureteric bud apoptosis rescues nephron endowm...	KEEP AS NON CORE	Summary: regulation of programmed cell death is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0048070 regulation of developmental pigmentation	IGI PMID:15818405 Polycystic kidney disease prevented by transgenic RNA interf...	KEEP AS NON CORE	Summary: regulation of developmental pigmentation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0048536 spleen development	IMP PMID:15818405 Polycystic kidney disease prevented by transgenic RNA interf...	KEEP AS NON CORE	Summary: spleen development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0048536 spleen development	IGI PMID:15818405 Polycystic kidney disease prevented by transgenic RNA interf...	KEEP AS NON CORE	Summary: spleen development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0048538 thymus development	IMP PMID:15818405 Polycystic kidney disease prevented by transgenic RNA interf...	KEEP AS NON CORE	Summary: thymus development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0048538 thymus development	IGI PMID:15818405 Polycystic kidney disease prevented by transgenic RNA interf...	KEEP AS NON CORE	Summary: thymus development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0048589 developmental growth	IMP PMID:15818405 Polycystic kidney disease prevented by transgenic RNA interf...	KEEP AS NON CORE	Summary: developmental growth is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0001662 behavioral fear response	IMP PMID:16095731 Increased anxiety-like behaviors and mitochondrial dysfuncti...	KEEP AS NON CORE	Summary: behavioral fear response is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0001822 kidney development	IMP PMID:16282979 Loss of PKD1 and loss of Bcl-2 elicit polycystic kidney dise...	KEEP AS NON CORE	Summary: kidney development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0006470 protein dephosphorylation	IDA PMID:16717086 PP2A regulates BCL-2 phosphorylation and proteasome-mediated...	REMOVE	Summary: protein dephosphorylation should not be retained as a direct Bcl2 annotation. Reason: The term is uninformative, conflicts with Bcl2 anti-apoptotic directionality, or describes an enzymatic/molecular activity not enabled by Bcl2. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 is an anti-apoptotic BCL-2 family regulator of mitochondrial membrane permeability; generic binding, enzymatic, or opposite-direction terms are not informative direct annotations. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports specific anti-apoptotic BCL-2 family activity rather than generic binding, enzymatic, or opposite-direction annotations.
GO:0010332 response to gamma radiation	IMP PMID:10815637 Effects of deficiency in p53 or bcl-2 on the sensitivity of ...	KEEP AS NON CORE	Summary: response to gamma radiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0010332 response to gamma radiation	IMP PMID:17068116 Radiation-induced gastric epithelial apoptosis occurs in the...	KEEP AS NON CORE	Summary: response to gamma radiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0010332 response to gamma radiation	IMP PMID:8170972 Targeted disruption of Bcl-2 alpha beta in mice: occurrence ...	KEEP AS NON CORE	Summary: response to gamma radiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0014911 positive regulation of smooth muscle cell migration	IMP PMID:17382917 c-Myc is essential for urokinase plasminogen activator expre...	KEEP AS NON CORE	Summary: positive regulation of smooth muscle cell migration is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0043029 T cell homeostasis	IGI PMID:17591857 Bim/Bcl-2 balance is critical for maintaining naive and memo...	KEEP AS NON CORE	Summary: T cell homeostasis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0043066 negative regulation of apoptotic process	IMP PMID:17068116 Radiation-induced gastric epithelial apoptosis occurs in the...	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0043066 negative regulation of apoptotic process	IDA PMID:17267035 Regulation of the lifespan in dendritic cell subsets.	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0043066 negative regulation of apoptotic process	IMP PMID:9681465 Enhanced oxidative stress and altered antioxidants in brains...	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0043085 positive regulation of catalytic activity	IMP PMID:17382917 c-Myc is essential for urokinase plasminogen activator expre...	REMOVE	Summary: positive regulation of catalytic activity should not be retained as a direct Bcl2 annotation. Reason: The term is uninformative, conflicts with Bcl2 anti-apoptotic directionality, or describes an enzymatic/molecular activity not enabled by Bcl2. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 is an anti-apoptotic BCL-2 family regulator of mitochondrial membrane permeability; generic binding, enzymatic, or opposite-direction terms are not informative direct annotations. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports specific anti-apoptotic BCL-2 family activity rather than generic binding, enzymatic, or opposite-direction annotations.
GO:0043524 negative regulation of neuron apoptotic process	IMP PMID:9681465 Enhanced oxidative stress and altered antioxidants in brains...	ACCEPT	Summary: negative regulation of neuron apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0045636 positive regulation of melanocyte differentiation	IMP PMID:16427619 Indispensable role of Bcl2 in the development of the melanoc...	KEEP AS NON CORE	Summary: positive regulation of melanocyte differentiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0048873 homeostasis of number of cells within a tissue	IMP PMID:16427619 Indispensable role of Bcl2 in the development of the melanoc...	KEEP AS NON CORE	Summary: homeostasis of number of cells within a tissue is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0050790 regulation of catalytic activity	IMP PMID:9681465 Enhanced oxidative stress and altered antioxidants in brains...	KEEP AS NON CORE	Summary: regulation of catalytic activity is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0051402 neuron apoptotic process	IMP PMID:7546744 Role of BCL-2 in the survival and function of developing and...	MODIFY	Summary: The neuron apoptosis evidence supports Bcl2-dependent neuronal survival, not execution of neuron apoptotic process. Reason: Replace with GO:0043524 negative regulation of neuron apoptotic process to reflect Bcl2 anti-apoptotic function in neurons. Proposed replacements: negative regulation of neuron apoptotic process Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
GO:0001952 regulation of cell-matrix adhesion	IMP PMID:15292044 Alterations in cell-adhesive and migratory properties of pro...	KEEP AS NON CORE	Summary: regulation of cell-matrix adhesion is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0010468 regulation of gene expression	IMP PMID:15292044 Alterations in cell-adhesive and migratory properties of pro...	KEEP AS NON CORE	Summary: regulation of gene expression is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0010559 regulation of glycoprotein biosynthetic process	IMP PMID:15292044 Alterations in cell-adhesive and migratory properties of pro...	KEEP AS NON CORE	Summary: regulation of glycoprotein biosynthetic process is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0030336 negative regulation of cell migration	IMP PMID:15292044 Alterations in cell-adhesive and migratory properties of pro...	KEEP AS NON CORE	Summary: negative regulation of cell migration is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0048041 focal adhesion assembly	IMP PMID:15292044 Alterations in cell-adhesive and migratory properties of pro...	KEEP AS NON CORE	Summary: focal adhesion assembly is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0018105 peptidyl-serine phosphorylation	IDA PMID:14660795 Mono- and multisite phosphorylation enhances Bcl2's antiapop...	REMOVE	Summary: peptidyl-serine phosphorylation should not be retained as a direct Bcl2 annotation. Reason: The term is uninformative, conflicts with Bcl2 anti-apoptotic directionality, or describes an enzymatic/molecular activity not enabled by Bcl2. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 is an anti-apoptotic BCL-2 family regulator of mitochondrial membrane permeability; generic binding, enzymatic, or opposite-direction terms are not informative direct annotations. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports specific anti-apoptotic BCL-2 family activity rather than generic binding, enzymatic, or opposite-direction annotations.
GO:0018107 peptidyl-threonine phosphorylation	IDA PMID:14660795 Mono- and multisite phosphorylation enhances Bcl2's antiapop...	REMOVE	Summary: peptidyl-threonine phosphorylation should not be retained as a direct Bcl2 annotation. Reason: The term is uninformative, conflicts with Bcl2 anti-apoptotic directionality, or describes an enzymatic/molecular activity not enabled by Bcl2. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 is an anti-apoptotic BCL-2 family regulator of mitochondrial membrane permeability; generic binding, enzymatic, or opposite-direction terms are not informative direct annotations. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports specific anti-apoptotic BCL-2 family activity rather than generic binding, enzymatic, or opposite-direction annotations.
GO:0031647 regulation of protein stability	IMP PMID:14660795 Mono- and multisite phosphorylation enhances Bcl2's antiapop...	KEEP AS NON CORE	Summary: regulation of protein stability is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0043066 negative regulation of apoptotic process	IDA PMID:14660795 Mono- and multisite phosphorylation enhances Bcl2's antiapop...	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0043066 negative regulation of apoptotic process	IMP PMID:14660795 Mono- and multisite phosphorylation enhances Bcl2's antiapop...	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0001658 branching involved in ureteric bud morphogenesis	IDA PMID:14699151 Interaction of bcl-2 with Paxillin through its BH4 domain is...	KEEP AS NON CORE	Summary: branching involved in ureteric bud morphogenesis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0006979 response to oxidative stress	IMP PMID:12855558 Bcl2 retards G1/S cell cycle transition by regulating intrac...	KEEP AS NON CORE	Summary: response to oxidative stress is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0010468 regulation of gene expression	IMP PMID:12855558 Bcl2 retards G1/S cell cycle transition by regulating intrac...	KEEP AS NON CORE	Summary: regulation of gene expression is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0030308 negative regulation of cell growth	IMP PMID:12855558 Bcl2 retards G1/S cell cycle transition by regulating intrac...	KEEP AS NON CORE	Summary: negative regulation of cell growth is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0034097 response to cytokine	IMP PMID:12855558 Bcl2 retards G1/S cell cycle transition by regulating intrac...	KEEP AS NON CORE	Summary: response to cytokine is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0042542 response to hydrogen peroxide	IMP PMID:12855558 Bcl2 retards G1/S cell cycle transition by regulating intrac...	KEEP AS NON CORE	Summary: response to hydrogen peroxide is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0001782 B cell homeostasis	IMP PMID:7650488 Bcl-XL and Bcl-2 repress a common pathway of cell death.	KEEP AS NON CORE	Summary: B cell homeostasis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0001782 B cell homeostasis	IMP PMID:8170972 Targeted disruption of Bcl-2 alpha beta in mice: occurrence ...	KEEP AS NON CORE	Summary: B cell homeostasis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0002260 lymphocyte homeostasis	IMP PMID:8170972 Targeted disruption of Bcl-2 alpha beta in mice: occurrence ...	KEEP AS NON CORE	Summary: lymphocyte homeostasis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0009791 post-embryonic development	IMP PMID:8170972 Targeted disruption of Bcl-2 alpha beta in mice: occurrence ...	KEEP AS NON CORE	Summary: post-embryonic development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0009887 animal organ morphogenesis	IMP PMID:8170972 Targeted disruption of Bcl-2 alpha beta in mice: occurrence ...	KEEP AS NON CORE	Summary: animal organ morphogenesis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0030183 B cell differentiation	IMP PMID:8170972 Targeted disruption of Bcl-2 alpha beta in mice: occurrence ...	KEEP AS NON CORE	Summary: B cell differentiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0030217 T cell differentiation	IMP PMID:8170972 Targeted disruption of Bcl-2 alpha beta in mice: occurrence ...	KEEP AS NON CORE	Summary: T cell differentiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0030318 melanocyte differentiation	IMP PMID:12086670 Bcl2 regulation by the melanocyte master regulator Mitf modu...	KEEP AS NON CORE	Summary: melanocyte differentiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0030318 melanocyte differentiation	IGI PMID:12086670 Bcl2 regulation by the melanocyte master regulator Mitf modu...	KEEP AS NON CORE	Summary: melanocyte differentiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0033077 T cell differentiation in thymus	IMP PMID:8170972 Targeted disruption of Bcl-2 alpha beta in mice: occurrence ...	KEEP AS NON CORE	Summary: T cell differentiation in thymus is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0043029 T cell homeostasis	IMP PMID:7650488 Bcl-XL and Bcl-2 repress a common pathway of cell death.	KEEP AS NON CORE	Summary: T cell homeostasis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0043029 T cell homeostasis	IMP PMID:8170972 Targeted disruption of Bcl-2 alpha beta in mice: occurrence ...	KEEP AS NON CORE	Summary: T cell homeostasis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0043066 negative regulation of apoptotic process	IMP PMID:8170972 Targeted disruption of Bcl-2 alpha beta in mice: occurrence ...	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0043375 CD8-positive, alpha-beta T cell lineage commitment	IMP PMID:8170972 Targeted disruption of Bcl-2 alpha beta in mice: occurrence ...	KEEP AS NON CORE	Summary: CD8-positive, alpha-beta T cell lineage commitment is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0043583 ear development	IMP PMID:8170972 Targeted disruption of Bcl-2 alpha beta in mice: occurrence ...	KEEP AS NON CORE	Summary: ear development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0048066 developmental pigmentation	IMP PMID:8170972 Targeted disruption of Bcl-2 alpha beta in mice: occurrence ...	KEEP AS NON CORE	Summary: developmental pigmentation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0048545 response to steroid hormone	IMP PMID:8170972 Targeted disruption of Bcl-2 alpha beta in mice: occurrence ...	KEEP AS NON CORE	Summary: response to steroid hormone is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0001822 kidney development	IMP PMID:11709185 Degenerative disorders caused by Bcl-2 deficiency prevented ...	KEEP AS NON CORE	Summary: kidney development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0001822 kidney development	IGI PMID:11709185 Degenerative disorders caused by Bcl-2 deficiency prevented ...	KEEP AS NON CORE	Summary: kidney development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0002260 lymphocyte homeostasis	IMP PMID:11709185 Degenerative disorders caused by Bcl-2 deficiency prevented ...	KEEP AS NON CORE	Summary: lymphocyte homeostasis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0002260 lymphocyte homeostasis	IGI PMID:11709185 Degenerative disorders caused by Bcl-2 deficiency prevented ...	KEEP AS NON CORE	Summary: lymphocyte homeostasis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0006582 melanin metabolic process	IMP PMID:11709185 Degenerative disorders caused by Bcl-2 deficiency prevented ...	KEEP AS NON CORE	Summary: melanin metabolic process is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0009791 post-embryonic development	IMP PMID:11709185 Degenerative disorders caused by Bcl-2 deficiency prevented ...	KEEP AS NON CORE	Summary: post-embryonic development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0009791 post-embryonic development	IGI PMID:11709185 Degenerative disorders caused by Bcl-2 deficiency prevented ...	KEEP AS NON CORE	Summary: post-embryonic development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0030318 melanocyte differentiation	IMP PMID:11709185 Degenerative disorders caused by Bcl-2 deficiency prevented ...	KEEP AS NON CORE	Summary: melanocyte differentiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0031966 mitochondrial membrane	IDA PMID:11980919 Intrinsic and extrinsic pathway signaling during neuronal ap...	ACCEPT	Summary: mitochondrial membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0040018 positive regulation of multicellular organism growth	IMP PMID:11709185 Degenerative disorders caused by Bcl-2 deficiency prevented ...	KEEP AS NON CORE	Summary: positive regulation of multicellular organism growth is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0043583 ear development	IMP PMID:11709185 Degenerative disorders caused by Bcl-2 deficiency prevented ...	KEEP AS NON CORE	Summary: ear development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0043583 ear development	IGI PMID:11709185 Degenerative disorders caused by Bcl-2 deficiency prevented ...	KEEP AS NON CORE	Summary: ear development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0048066 developmental pigmentation	IMP PMID:11709185 Degenerative disorders caused by Bcl-2 deficiency prevented ...	KEEP AS NON CORE	Summary: developmental pigmentation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0048066 developmental pigmentation	IGI PMID:11709185 Degenerative disorders caused by Bcl-2 deficiency prevented ...	KEEP AS NON CORE	Summary: developmental pigmentation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0021747 cochlear nucleus development	IMP PMID:11027399 Patterns of cell death in mouse anteroventral cochlear nucle...	KEEP AS NON CORE	Summary: cochlear nucleus development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0043524 negative regulation of neuron apoptotic process	IMP PMID:11027399 Patterns of cell death in mouse anteroventral cochlear nucle...	ACCEPT	Summary: negative regulation of neuron apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0048743 positive regulation of skeletal muscle fiber development	IMP PMID:11146504 Pro- and anti-apoptotic members of the Bcl-2 family in skele...	KEEP AS NON CORE	Summary: positive regulation of skeletal muscle fiber development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0008283 cell population proliferation	IGI PMID:10762311 Differences in bcl-2- and bax-independent function in regula...	KEEP AS NON CORE	Summary: cell population proliferation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0051402 neuron apoptotic process	IGI PMID:10762311 Differences in bcl-2- and bax-independent function in regula...	MODIFY	Summary: The neuron apoptosis evidence supports Bcl2-dependent neuronal survival, not execution of neuron apoptotic process. Reason: Replace with GO:0043524 negative regulation of neuron apoptotic process to reflect Bcl2 anti-apoptotic function in neurons. Proposed replacements: negative regulation of neuron apoptotic process Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-falcon.md BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
GO:0043524 negative regulation of neuron apoptotic process	IMP PMID:10762311 Differences in bcl-2- and bax-independent function in regula...	ACCEPT	Summary: negative regulation of neuron apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0009636 response to toxic substance	IMP PMID:10602483 Damage-induced apoptosis in intestinal epithelia from bcl-2-...	MARK AS OVER ANNOTATED	Summary: response to toxic substance likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0043066 negative regulation of apoptotic process	IMP PMID:10602483 Damage-induced apoptosis in intestinal epithelia from bcl-2-...	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0043066 negative regulation of apoptotic process	IMP PMID:10321489 Retinal ganglion cell loss after the period of naturally occ...	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0046671 negative regulation of retinal cell programmed cell death	IMP PMID:10321489 Retinal ganglion cell loss after the period of naturally occ...	KEEP AS NON CORE	Summary: negative regulation of retinal cell programmed cell death is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0001822 kidney development	IMP PMID:9950951 Nuclear localization of beta-catenin and loss of apical brus...	KEEP AS NON CORE	Summary: kidney development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0007015 actin filament organization	IMP PMID:9950951 Nuclear localization of beta-catenin and loss of apical brus...	KEEP AS NON CORE	Summary: actin filament organization is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0032880 regulation of protein localization	IMP PMID:9950951 Nuclear localization of beta-catenin and loss of apical brus...	KEEP AS NON CORE	Summary: regulation of protein localization is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0010224 response to UV-B	IMP PMID:10200548 Alterations in cell death and cell cycle progression in the ...	KEEP AS NON CORE	Summary: response to UV-B is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0043066 negative regulation of apoptotic process	IMP PMID:10200548 Alterations in cell death and cell cycle progression in the ...	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0051726 regulation of cell cycle	IMP PMID:10200548 Alterations in cell death and cell cycle progression in the ...	KEEP AS NON CORE	Summary: regulation of cell cycle is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0000902 cell morphogenesis	IMP PMID:10193316 The bcl-2 knockout mouse exhibits marked changes in osteobla...	KEEP AS NON CORE	Summary: cell morphogenesis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0001503 ossification	IMP PMID:10193316 The bcl-2 knockout mouse exhibits marked changes in osteobla...	KEEP AS NON CORE	Summary: ossification is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0033689 negative regulation of osteoblast proliferation	IMP PMID:10193316 The bcl-2 knockout mouse exhibits marked changes in osteobla...	KEEP AS NON CORE	Summary: negative regulation of osteoblast proliferation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0014042 positive regulation of neuron maturation	IMP PMID:9547242 Bcl-2 accelerates the maturation of early sensory neurons.	KEEP AS NON CORE	Summary: positive regulation of neuron maturation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0043066 negative regulation of apoptotic process	IMP PMID:9374413 Bcl-2 is required for cranial sensory neuron survival at def...	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0001822 kidney development	IGI PMID:9241272 Bcl-2 and Bax function independently to regulate cell death.	KEEP AS NON CORE	Summary: kidney development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0006808 regulation of nitrogen utilization	IGI PMID:9241272 Bcl-2 and Bax function independently to regulate cell death.	KEEP AS NON CORE	Summary: regulation of nitrogen utilization is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0008584 male gonad development	IGI PMID:9241272 Bcl-2 and Bax function independently to regulate cell death.	KEEP AS NON CORE	Summary: male gonad development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0009791 post-embryonic development	IGI PMID:9241272 Bcl-2 and Bax function independently to regulate cell death.	KEEP AS NON CORE	Summary: post-embryonic development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0045930 negative regulation of mitotic cell cycle	IDA PMID:9241272 Bcl-2 and Bax function independently to regulate cell death.	KEEP AS NON CORE	Summary: negative regulation of mitotic cell cycle is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0048087 positive regulation of developmental pigmentation	IGI PMID:9241272 Bcl-2 and Bax function independently to regulate cell death.	KEEP AS NON CORE	Summary: positive regulation of developmental pigmentation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0048538 thymus development	IMP PMID:9241272 Bcl-2 and Bax function independently to regulate cell death.	KEEP AS NON CORE	Summary: thymus development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0043066 negative regulation of apoptotic process	IMP PMID:9153592 Susceptibility of cerebellar granule neurons derived from Bc...	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0033033 negative regulation of myeloid cell apoptotic process	IDA PMID:9202146 Differential involvement of caspases in apoptosis of myeloid...	KEEP AS NON CORE	Summary: negative regulation of myeloid cell apoptotic process is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0009410 response to xenobiotic stimulus	IDA PMID:9098922 Valproic acid-induced changes in gene expression during neur...	MARK AS OVER ANNOTATED	Summary: response to xenobiotic stimulus likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0007409 axonogenesis	IMP PMID:9009190 Bcl-2 promotes regeneration of severed axons in mammalian CN...	KEEP AS NON CORE	Summary: axonogenesis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0031103 axon regeneration	IDA PMID:9009190 Bcl-2 promotes regeneration of severed axons in mammalian CN...	KEEP AS NON CORE	Summary: axon regeneration is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0001776 leukocyte homeostasis	IMP PMID:9028316 Role of bcl-2 in the development of lymphoid cells from the ...	KEEP AS NON CORE	Summary: leukocyte homeostasis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0002320 lymphoid progenitor cell differentiation	IMP PMID:9028316 Role of bcl-2 in the development of lymphoid cells from the ...	KEEP AS NON CORE	Summary: lymphoid progenitor cell differentiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0030183 B cell differentiation	IMP PMID:9028316 Role of bcl-2 in the development of lymphoid cells from the ...	KEEP AS NON CORE	Summary: B cell differentiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0033077 T cell differentiation in thymus	IMP PMID:9028316 Role of bcl-2 in the development of lymphoid cells from the ...	KEEP AS NON CORE	Summary: T cell differentiation in thymus is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0030279 negative regulation of ossification	IMP PMID:9008714 Bcl-2 lies downstream of parathyroid hormone-related peptide...	KEEP AS NON CORE	Summary: negative regulation of ossification is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0043066 negative regulation of apoptotic process	IDA PMID:7834747 Cloning and functional analysis of BAG-1: a novel Bcl-2-bind...	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0043066 negative regulation of apoptotic process	IGI PMID:7834747 Cloning and functional analysis of BAG-1: a novel Bcl-2-bind...	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0001822 kidney development	IMP PMID:8760259 Abnormal postpartum renal development and cystogenesis in th...	KEEP AS NON CORE	Summary: kidney development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0003014 renal system process	IMP PMID:8760259 Abnormal postpartum renal development and cystogenesis in th...	KEEP AS NON CORE	Summary: renal system process is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0043066 negative regulation of apoptotic process	IMP PMID:8760259 Abnormal postpartum renal development and cystogenesis in th...	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0030318 melanocyte differentiation	IMP PMID:8758925 Accelerated disappearance of melanocytes in bcl-2-deficient ...	KEEP AS NON CORE	Summary: melanocyte differentiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0048753 pigment granule organization	IMP PMID:8758925 Accelerated disappearance of melanocytes in bcl-2-deficient ...	KEEP AS NON CORE	Summary: pigment granule organization is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0001656 metanephros development	IMP PMID:8623928 Apoptosis during an early stage of nephrogenesis induces ren...	KEEP AS NON CORE	Summary: metanephros development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0009791 post-embryonic development	IMP PMID:8755480 Inactivation of bcl-2 results in progressive degeneration of...	KEEP AS NON CORE	Summary: post-embryonic development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0014031 mesenchymal cell development	IMP PMID:8623928 Apoptosis during an early stage of nephrogenesis induces ren...	KEEP AS NON CORE	Summary: mesenchymal cell development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0032835 glomerulus development	IMP PMID:8623928 Apoptosis during an early stage of nephrogenesis induces ren...	KEEP AS NON CORE	Summary: glomerulus development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0035265 organ growth	IMP PMID:8623928 Apoptosis during an early stage of nephrogenesis induces ren...	KEEP AS NON CORE	Summary: organ growth is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0043066 negative regulation of apoptotic process	IMP PMID:8623928 Apoptosis during an early stage of nephrogenesis induces ren...	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0008285 negative regulation of cell population proliferation	IMP PMID:8663032 Diminished cell proliferation associated with the death-prot...	KEEP AS NON CORE	Summary: negative regulation of cell population proliferation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0043066 negative regulation of apoptotic process	IMP PMID:8663032 Diminished cell proliferation associated with the death-prot...	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0002326 B cell lineage commitment	IMP PMID:8788039 Distinct patterns of Fas cell surface expression during deve...	KEEP AS NON CORE	Summary: B cell lineage commitment is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0002360 T cell lineage commitment	IMP PMID:8788039 Distinct patterns of Fas cell surface expression during deve...	KEEP AS NON CORE	Summary: T cell lineage commitment is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0043524 negative regulation of neuron apoptotic process	IDA PMID:7472523 Bcl-2 overexpression prevents motoneuron cell body loss but ...	ACCEPT	Summary: negative regulation of neuron apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0005737 cytoplasm	IDA PMID:7675327 Up-regulation of bax and down-regulation of bcl-2 is associa...	ACCEPT	Summary: cytoplasm is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0001541 ovarian follicle development	IMP PMID:7628407 Ablation of bcl-2 gene expression decreases the numbers of o...	KEEP AS NON CORE	Summary: ovarian follicle development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0048599 oocyte development	IMP PMID:7628407 Ablation of bcl-2 gene expression decreases the numbers of o...	KEEP AS NON CORE	Summary: oocyte development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0005737 cytoplasm	IDA PMID:7563251 Differential regulation of bcl-2, bax, c-fos, junB, and krox...	ACCEPT	Summary: cytoplasm is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0001656 metanephros development	IMP PMID:7840250 Fulminant metanephric apoptosis and abnormal kidney developm...	KEEP AS NON CORE	Summary: metanephros development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0001822 kidney development	IMP PMID:7840250 Fulminant metanephric apoptosis and abnormal kidney developm...	KEEP AS NON CORE	Summary: kidney development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0043066 negative regulation of apoptotic process	IMP PMID:7840250 Fulminant metanephric apoptosis and abnormal kidney developm...	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0043066 negative regulation of apoptotic process	IDA PMID:7751019 Apoptosis and Bcl-2 expression in cultured murine splenic T ...	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0001822 kidney development	IMP PMID:7812968 bcl-2 deficiency in mice leads to pleiotropic abnormalities:...	KEEP AS NON CORE	Summary: kidney development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0002520 immune system development	IMP PMID:7812968 bcl-2 deficiency in mice leads to pleiotropic abnormalities:...	KEEP AS NON CORE	Summary: immune system development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0009791 post-embryonic development	IMP PMID:7812968 bcl-2 deficiency in mice leads to pleiotropic abnormalities:...	KEEP AS NON CORE	Summary: post-embryonic development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0022612 gland morphogenesis	IMP PMID:7812968 bcl-2 deficiency in mice leads to pleiotropic abnormalities:...	KEEP AS NON CORE	Summary: gland morphogenesis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0030097 hemopoiesis	IMP PMID:7812968 bcl-2 deficiency in mice leads to pleiotropic abnormalities:...	KEEP AS NON CORE	Summary: hemopoiesis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0035265 organ growth	IMP PMID:7812968 bcl-2 deficiency in mice leads to pleiotropic abnormalities:...	KEEP AS NON CORE	Summary: organ growth is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0048546 digestive tract morphogenesis	IMP PMID:7812968 bcl-2 deficiency in mice leads to pleiotropic abnormalities:...	KEEP AS NON CORE	Summary: digestive tract morphogenesis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0005634 nucleus	IDA PMID:7945396 Bcl-2 overexpression abolishes early calcium waving precedin...	KEEP AS NON CORE	Summary: nucleus is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0005739 mitochondrion	IDA PMID:7945396 Bcl-2 overexpression abolishes early calcium waving precedin...	ACCEPT	Summary: mitochondrion is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0006874 intracellular calcium ion homeostasis	IDA PMID:7945396 Bcl-2 overexpression abolishes early calcium waving precedin...	KEEP AS NON CORE	Summary: intracellular calcium ion homeostasis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0005634 nucleus	IDA PMID:7953633 Expression of Bcl-2 protein in murine neural cells in cultur...	KEEP AS NON CORE	Summary: nucleus is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0005739 mitochondrion	IDA PMID:7953633 Expression of Bcl-2 protein in murine neural cells in cultur...	ACCEPT	Summary: mitochondrion is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0043209 myelin sheath	IDA PMID:7953633 Expression of Bcl-2 protein in murine neural cells in cultur...	MARK AS OVER ANNOTATED	Summary: myelin sheath likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0002520 immune system development	IMP PMID:8372353 Disappearance of the lymphoid system in Bcl-2 homozygous mut...	KEEP AS NON CORE	Summary: immune system development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0005634 nucleus	IDA PMID:8030757 Bcl-2 protein expression during murine development.	KEEP AS NON CORE	Summary: nucleus is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0005737 cytoplasm	IDA PMID:8030757 Bcl-2 protein expression during murine development.	ACCEPT	Summary: cytoplasm is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0005783 endoplasmic reticulum	IDA PMID:8030757 Bcl-2 protein expression during murine development.	ACCEPT	Summary: endoplasmic reticulum is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0005829 cytosol	IDA PMID:8030757 Bcl-2 protein expression during murine development.	REMOVE	Summary: cytosol should not be retained as a direct Bcl2 annotation. Reason: The term is uninformative, conflicts with Bcl2 anti-apoptotic directionality, or describes an enzymatic/molecular activity not enabled by Bcl2. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 is an anti-apoptotic BCL-2 family regulator of mitochondrial membrane permeability; generic binding, enzymatic, or opposite-direction terms are not informative direct annotations. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports specific anti-apoptotic BCL-2 family activity rather than generic binding, enzymatic, or opposite-direction annotations.
GO:0010332 response to gamma radiation	IMP PMID:8372353 Disappearance of the lymphoid system in Bcl-2 homozygous mut...	KEEP AS NON CORE	Summary: response to gamma radiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0031965 nuclear membrane	IDA PMID:8030757 Bcl-2 protein expression during murine development.	KEEP AS NON CORE	Summary: nuclear membrane is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0043066 negative regulation of apoptotic process	IDA PMID:8313913 Developmental regulation of the Bcl-2 protein and susceptibi...	ACCEPT	Summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0051384 response to glucocorticoid	IDA PMID:8313913 Developmental regulation of the Bcl-2 protein and susceptibi...	KEEP AS NON CORE	Summary: response to glucocorticoid is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0051384 response to glucocorticoid	IMP PMID:8372353 Disappearance of the lymphoid system in Bcl-2 homozygous mut...	KEEP AS NON CORE	Summary: response to glucocorticoid is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function. Reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
GO:0005739 mitochondrion	HDA PMID:14651853 Integrated analysis of protein composition, tissue diversity...	ACCEPT	Summary: mitochondrion is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0008284 positive regulation of cell population proliferation	IDA PMID:11983915 bcl-2 overexpression promotes myocyte proliferation.	MARK AS OVER ANNOTATED	Summary: positive regulation of cell population proliferation likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0031069 hair follicle morphogenesis	IMP PMID:8402909 Bcl-2-deficient mice demonstrate fulminant lymphoid apoptosi...	MARK AS OVER ANNOTATED	Summary: hair follicle morphogenesis likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0043473 pigmentation	IMP PMID:8402909 Bcl-2-deficient mice demonstrate fulminant lymphoid apoptosi...	MARK AS OVER ANNOTATED	Summary: pigmentation likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0045069 regulation of viral genome replication	IDA PMID:16950491 Role of Bcl-2 expression for productive herpes simplex virus...	MARK AS OVER ANNOTATED	Summary: regulation of viral genome replication likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function. Reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
GO:0001836 release of cytochrome c from mitochondria	IDA PMID:9843949 Bax interacts with the permeability transition pore to induc...	MODIFY	Summary: release of cytochrome c from mitochondria has the right biological area but is too generic or has the wrong direction for Bcl2 anti-apoptotic function. Reason: Bcl2 primarily inhibits mitochondrial/intrinsic apoptotic signaling and cytochrome c release. Bcl2 directly controls MOMP at the mitochondrial outer membrane, making it a direct regulator of the intrinsic pathway; the extrinsic pathway annotation does not reflect a direct Bcl2 mechanistic role. Proposed replacements: negative regulation of release of cytochrome c from mitochondria Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 prevents mitochondrial cytochrome c release and intrinsic apoptosis; directional or generic terms should be replaced with negative regulation or BH3-domain binding terms where possible. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports Bcl2 as an inhibitor of mitochondrial apoptotic signaling and cytochrome c release, so directional or generic terms should be replaced by negative-regulation/BH-domain terms.
GO:0046902 regulation of mitochondrial membrane permeability	IDA PMID:9843949 Bax interacts with the permeability transition pore to induc...	ACCEPT	Summary: regulation of mitochondrial membrane permeability is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0051881 regulation of mitochondrial membrane potential	IDA PMID:9843949 Bax interacts with the permeability transition pore to induc...	ACCEPT	Summary: regulation of mitochondrial membrane potential is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0043524 negative regulation of neuron apoptotic process	IDA PMID:8625820 Bax promotes neuronal survival and antagonises the survival ...	ACCEPT	Summary: negative regulation of neuron apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners. Reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
GO:0005829 cytosol	IDA PMID:14551195 Targeted disruption of the PDZK1 gene in mice causes tissue-...	REMOVE	Summary: PMID:14551195 does not provide Bcl2 cytosol-localization evidence. Reason: The cited PMID:14551195 is a PDZK1/SR-BI lipoprotein study with no Bcl2-specific localization evidence; removed on evidential grounds. Supporting Evidence: PMID:14551195 Targeted disruption of the PDZK1 gene in mice causes tissue-specific depletion of the high density lipoprotein receptor scavenger receptor class B type I and altered lipoprotein metabolism.
GO:0043066 negative regulation of apoptotic process	IDA PMID:14551195 Targeted disruption of the PDZK1 gene in mice causes tissue-...	REMOVE	Summary: PMID:14551195 does not support a Bcl2 negative-regulation-of-apoptosis annotation. Reason: The cached publication is a PDZK1/SR-BI lipoprotein metabolism study and does not provide direct Bcl2 apoptosis evidence. Supporting Evidence: PMID:14551195 Targeted disruption of the PDZK1 gene in mice causes tissue-specific depletion of the high density lipoprotein receptor scavenger receptor class B type I and altered lipoprotein metabolism.
GO:0005739 mitochondrion	IDA PMID:12420306 Sorting specificity of spermatogenic cell specific region of...	REMOVE	Summary: PMID:12420306 does not support a Bcl2 mitochondrion annotation. Reason: The cached publication concerns mouse hexokinase-s sorting and provides no accessible Bcl2-specific localization evidence. Supporting Evidence: PMID:12420306 Sorting specificity of spermatogenic cell specific region of mouse hexokinase-s
GO:0005829 cytosol	IDA PMID:12050152 A novel transactivating factor that regulates interferon-gam...	REMOVE	Summary: cytosol should not be retained as a direct Bcl2 annotation. Reason: The term is uninformative, conflicts with Bcl2 anti-apoptotic directionality, or describes an enzymatic/molecular activity not enabled by Bcl2. Supporting Evidence: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 is an anti-apoptotic BCL-2 family regulator of mitochondrial membrane permeability; generic binding, enzymatic, or opposite-direction terms are not informative direct annotations. file:mouse/Bcl2/Bcl2-uniprot.txt Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Falcon synthesis supports specific anti-apoptotic BCL-2 family activity rather than generic binding, enzymatic, or opposite-direction annotations.
GO:1901029 negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	IC file:mouse/Bcl2/Bcl2-uniprot.txt	NEW	Summary: Bcl2 prevents mitochondrial outer membrane permeabilization, the central mechanism by which it blocks intrinsic apoptosis and cytochrome c release. Reason: This directly captures Bcl2 anti-apoptotic mechanism more specifically than broad negative regulation of apoptosis terms. Supporting Evidence: file:mouse/Bcl2/Bcl2-uniprot.txt Regulates cell death by controlling the mitochondrial membrane permeability. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria. file:mouse/Bcl2/Bcl2-deep-research-bioreason.md Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability and preventing cytochrome c release. file:mouse/Bcl2/Bcl2-deep-research-falcon.md Mouse Bcl2 prevents mitochondrial outer membrane permeabilization and cytochrome-c release, directly supporting this added GO annotation.

Core Functions

Bcl2 suppresses intrinsic apoptosis by controlling mitochondrial outer membrane permeability and preventing cytochrome c release, thereby blocking downstream caspase activation.

Molecular Function:

BH3 domain binding

Directly Involved In:

negative regulation of apoptotic process negative regulation of intrinsic apoptotic signaling pathway negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

Cellular Locations:

mitochondrial outer membrane endoplasmic reticulum membrane

Supporting Evidence:

file:mouse/Bcl2/Bcl2-uniprot.txt
Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria.
file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability and preventing cytochrome c release.
file:mouse/Bcl2/Bcl2-deep-research-falcon.md
BCL-2 binds BH3-containing pro-apoptotic proteins and prevents mitochondrial outer membrane permeabilization and cytochrome-c release.

Bcl2 forms homo- and heterodimeric BCL-2 family complexes with pro-apoptotic partners such as Bax, Bad, and Bak; these interactions are required for anti-apoptotic activity and family-specific regulation.

Molecular Function:

BH domain binding

Directly Involved In:

negative regulation of apoptotic signaling pathway

Cellular Locations:

mitochondrial outer membrane

In Complex:

BCL-2 complex

Supporting Evidence:

file:mouse/Bcl2/Bcl2-uniprot.txt
Forms homodimers, and heterodimers with BAX, BAD, BAK and Bcl-X(L). Heterodimerization with BAX requires intact BH1 and BH2 motifs, and is necessary for anti-apoptotic activity.
file:mouse/Bcl2/Bcl2-deep-research-falcon.md
BCL-2 binds BH3-containing pro-apoptotic proteins and prevents mitochondrial outer membrane permeabilization and cytochrome-c release.

References

GO_REF:0000002

Gene Ontology annotation through association of InterPro records with GO terms

GO_REF:0000008

Gene Ontology annotation by the MGI curatorial staff, curated orthology

GO_REF:0000024

Manual transfer of experimentally-verified manual GO annotation data to orthologs by curator judgment of sequence similarity

GO_REF:0000033

Annotation inferences using phylogenetic trees

GO_REF:0000043

Gene Ontology annotation based on UniProtKB/Swiss-Prot keyword mapping

GO_REF:0000096

Automated transfer of experimentally-verified manual GO annotation data to mouse-rat orthologs

GO_REF:0000107

Automatic transfer of experimentally verified manual GO annotation data to orthologs using Ensembl Compara

GO_REF:0000108

Automatic assignment of GO terms using logical inference, based on on inter-ontology links

GO_REF:0000117

Electronic Gene Ontology annotations created by ARBA machine learning models

GO_REF:0000119

Automated transfer of experimentally-verified manual GO annotation data to mouse-human orthologs

GO_REF:0000120

Combined Automated Annotation using Multiple IEA Methods

PMID:10193316

The bcl-2 knockout mouse exhibits marked changes in osteoblast phenotype and collagen deposition in bone as well as a mild growth plate phenotype.

PMID:10200548

Alterations in cell death and cell cycle progression in the UV-irradiated epidermis of bcl-2-deficient mice.

PMID:10321489

Retinal ganglion cell loss after the period of naturally occurring cell death in bcl-2-/- mice.

PMID:10488913

Targeted disruption of the bcl-2 gene in mice exacerbates focal ischemic brain injury.

PMID:10582606

Bax and Bcl-2 interaction in a transgenic mouse model of familial amyotrophic lateral sclerosis.

PMID:10597216

Bis, a Bcl-2-binding protein that synergizes with Bcl-2 in preventing cell death.

PMID:10602483

Damage-induced apoptosis in intestinal epithelia from bcl-2-null and bax-null mice: investigations of the mechanistic determinants of epithelial apoptosis in vivo.

PMID:10674380

Hair follicle apoptosis and Bcl-2.

PMID:10726970

Developmental changes in antioxidant enzymes and oxidative damage in kidneys, liver and brain of bcl-2 knockout mice.

PMID:10762311

Differences in bcl-2- and bax-independent function in regulating apoptosis in sensory neuron populations.

PMID:10815637

Effects of deficiency in p53 or bcl-2 on the sensitivity of clonogenic cells in the small intestine to low dose-rate irradiation.

PMID:11027399

Patterns of cell death in mouse anteroventral cochlear nucleus neurons after unilateral cochlea removal.

PMID:11146504

Pro- and anti-apoptotic members of the Bcl-2 family in skeletal muscle: a distinct role for Bcl-2 in later stages of myogenesis.

PMID:11226327

Bax ablation prevents dopaminergic neurodegeneration in the 1-methyl- 4-phenyl-1,2,3,6-tetrahydropyridine mouse model of Parkinson's disease.

PMID:11546872

Bmf: a proapoptotic BH3-only protein regulated by interaction with the myosin V actin motor complex, activated by anoikis.

PMID:11709185

Degenerative disorders caused by Bcl-2 deficiency prevented by loss of its BH3-only antagonist Bim.

PMID:11980919

Intrinsic and extrinsic pathway signaling during neuronal apoptosis: lessons from the analysis of mutant mice.

PMID:11983915

bcl-2 overexpression promotes myocyte proliferation.

PMID:12050152

A novel transactivating factor that regulates interferon-gamma-dependent gene expression.

PMID:12082633

Proapoptotic activity of ITM2B(s), a BH3-only protein induced upon IL-2-deprivation which interacts with Bcl-2.

PMID:12086670

Bcl2 regulation by the melanocyte master regulator Mitf modulates lineage survival and melanoma cell viability.

PMID:12420306

Sorting specificity of spermatogenic cell specific region of mouse hexokinase-s (mHk1-s).

PMID:12617961

Calcium-dependent interaction of calcineurin with Bcl-2 in neuronal tissue.

PMID:12855558

Bcl2 retards G1/S cell cycle transition by regulating intracellular ROS.

PMID:1373874

Bcl-2 confers growth and survival advantage to interleukin 7-dependent early pre-B cells which become factor independent by a multistep process in culture.

PMID:14551195

Targeted disruption of the PDZK1 gene in mice causes tissue-specific depletion of the high density lipoprotein receptor scavenger receptor class B type I and altered lipoprotein metabolism.

PMID:14651853

Integrated analysis of protein composition, tissue diversity, and gene regulation in mouse mitochondria.

PMID:14660795

Mono- and multisite phosphorylation enhances Bcl2's antiapoptotic function and inhibition of cell cycle entry functions.

PMID:14699151

Interaction of bcl-2 with Paxillin through its BH4 domain is important during ureteric bud branching.

PMID:14707049

TCR-independent and caspase-independent apoptosis of murine thymocytes by CD24 cross-linking.

PMID:15292044

Alterations in cell-adhesive and migratory properties of proximal tubule and collecting duct cells from bcl-2 -/- mice.

PMID:15613488

Proapoptotic BAX and BAK regulate the type 1 inositol trisphosphate receptor and calcium leak from the endoplasmic reticulum.

PMID:15776018

Proapoptotic BAX and BAK control multiple initiator caspases.

PMID:15818405

Polycystic kidney disease prevented by transgenic RNA interference.

PMID:15983387

Frag1, a homolog of alternative replication factor C subunits, links replication stress surveillance with apoptosis.

PMID:16095731

Increased anxiety-like behaviors and mitochondrial dysfunction in mice with targeted mutation of the Bcl-2 gene: further support for the involvement of mitochondrial function in anxiety disorders.

PMID:16282979

Loss of PKD1 and loss of Bcl-2 elicit polycystic kidney disease through distinct mechanisms.

PMID:16427619

Indispensable role of Bcl2 in the development of the melanocyte stem cell.

PMID:16509771

IAN family critically regulates survival and development of T lymphocytes.

PMID:16672320

Suppression of ureteric bud apoptosis rescues nephron endowment and adult renal function in Pax2 mutant mice.

PMID:16717086

PP2A regulates BCL-2 phosphorylation and proteasome-mediated degradation at the endoplasmic reticulum.

PMID:16839884

Mitochondrial rhomboid PARL regulates cytochrome c release during apoptosis via OPA1-dependent cristae remodeling.

PMID:16950491

Role of Bcl-2 expression for productive herpes simplex virus 2 replication.

PMID:17068116

Radiation-induced gastric epithelial apoptosis occurs in the proliferative zone and is regulated by p53, bak, bax, and bcl-2.

PMID:17267035

Regulation of the lifespan in dendritic cell subsets.

PMID:17382917

c-Myc is essential for urokinase plasminogen activator expression on hypoxia-induced vascular smooth muscle cells.

PMID:17475835

Involvement of heat shock protein (Hsp)90 beta but not Hsp90 alpha in antiapoptotic effect of CpG-B oligodeoxynucleotide.

PMID:17591857

Bim/Bcl-2 balance is critical for maintaining naive and memory T cell homeostasis.

PMID:18223655

Dual role of proapoptotic BAD in insulin secretion and beta cell survival.

PMID:18548006

Osteoclast size is controlled by Fra-2 through LIF/LIF-receptor signalling and hypoxia.

PMID:18614015

A mitochondrial protein compendium elucidates complex I disease biology.

PMID:20621101

Upregulation of Bcl2 inhibits apoptosis-driven BAX insertion but favors BAX relocalization in mitochondria.

PMID:20819940

Endogenous HMGB1 regulates autophagy.

PMID:21151042

Cyclic-AMP-dependent protein kinase A regulates apoptosis by stabilizing the BH3-only protein Bim.

PMID:22258505

Exercise-induced BCL2-regulated autophagy is required for muscle glucose homeostasis.

PMID:23629966

Deacetylation of p53 induces autophagy by suppressing Bmf expression.

PMID:26949185

BOK Is a Non-canonical BCL-2 Family Effector of Apoptosis Regulated by ER-Associated Degradation.

PMID:29020630

Degradation of Bcl-2 by XIAP and ARTS Promotes Apoptosis.

PMID:29849149

Disruption of the beclin 1-BCL2 autophagy regulatory complex promotes longevity in mice.

PMID:36812915

Exercise-activated hepatic autophagy via the FN1-α5β1 integrin pathway drives metabolic benefits of exercise.

PMID:7472523

Bcl-2 overexpression prevents motoneuron cell body loss but not axonal degeneration in a mouse model of a neurodegenerative disease.

PMID:7546744

Role of BCL-2 in the survival and function of developing and mature sympathetic neurons.

PMID:7563251

Differential regulation of bcl-2, bax, c-fos, junB, and krox-24 expression in the cerebellum of Purkinje cell degeneration mutant mice.

PMID:7595537

Bcl-2 protects neural cells from cyanide/aglycemia-induced lipid oxidation, mitochondrial injury, and loss of viability.

PMID:7628407

Ablation of bcl-2 gene expression decreases the numbers of oocytes and primordial follicles established in the post-natal female mouse gonad.

PMID:7650367

Expression of Bcl-2, Bcl-x, and Bax after T cell activation and IL-2 withdrawal.

PMID:7650488

Bcl-XL and Bcl-2 repress a common pathway of cell death.

PMID:7675327

Up-regulation of bax and down-regulation of bcl-2 is associated with kainate-induced apoptosis in mouse brain.

PMID:7751019

Apoptosis and Bcl-2 expression in cultured murine splenic T cells.

PMID:7772249

Evolutionary conservation of function among mammalian, avian, and viral homologs of the Bcl-2 oncoprotein.

PMID:7812968

bcl-2 deficiency in mice leads to pleiotropic abnormalities: accelerated lymphoid cell death in thymus and spleen, polycystic kidney, hair hypopigmentation, and distorted small intestine.

PMID:7834747

Cloning and functional analysis of BAG-1: a novel Bcl-2-binding protein with anti-cell death activity.

PMID:7834748

Bad, a heterodimeric partner for Bcl-XL and Bcl-2, displaces Bax and promotes cell death.

PMID:7840250

Fulminant metanephric apoptosis and abnormal kidney development in bcl-2-deficient mice.

PMID:7896880

The intracellular distribution and pattern of expression of Mcl-1 overlap with, but are not identical to, those of Bcl-2.

PMID:7945396

Bcl-2 overexpression abolishes early calcium waving preceding apoptosis in NIH-3T3 murine fibroblasts.

PMID:7953633

Expression of Bcl-2 protein in murine neural cells in culture.

PMID:8022822

Evidence that BCL-2 represses apoptosis by regulating endoplasmic reticulum-associated Ca2+ fluxes.

PMID:8030757

Bcl-2 protein expression during murine development.

PMID:8050499

bcl-2 gene prevents apoptosis of basic fibroblast growth factor-deprived murine aortic endothelial cells.

PMID:8080725

bcl-2 gene enables rescue from in vitro myelosuppression (bone marrow cell death) induced by chemotherapy.

PMID:8084613

Antisense oligonucleotides suppress B-cell lymphoma growth in a SCID-hu mouse model.

PMID:8170972

Targeted disruption of Bcl-2 alpha beta in mice: occurrence of gray hair, polycystic kidney disease, and lymphocytopenia.

PMID:8313913

Developmental regulation of the Bcl-2 protein and susceptibility to cell death in B lymphocytes.

PMID:8372353

Disappearance of the lymphoid system in Bcl-2 homozygous mutant chimeric mice.

PMID:8402909

Bcl-2-deficient mice demonstrate fulminant lymphoid apoptosis, polycystic kidneys, and hypopigmented hair.

PMID:8623928

Apoptosis during an early stage of nephrogenesis induces renal hypoplasia in bcl-2-deficient mice.

PMID:8625820

Bax promotes neuronal survival and antagonises the survival effects of neurotrophic factors.

PMID:8663032

Diminished cell proliferation associated with the death-protective activity of Bcl-2.

PMID:8755480

Inactivation of bcl-2 results in progressive degeneration of motoneurons, sympathetic and sensory neurons during early postnatal development.

PMID:8758925

Accelerated disappearance of melanocytes in bcl-2-deficient mice.

PMID:8760259

Abnormal postpartum renal development and cystogenesis in the bcl-2 (-/-) mouse.

PMID:8788039

Distinct patterns of Fas cell surface expression during development of T- or B-lymphocyte lineages in normal, scid, and mutant mice lacking or overexpressing p53, bcl-2, or rag-2 genes.

PMID:8918887

BID: a novel BH3 domain-only death agonist.

PMID:8949945

Bcl-2 prevents hippocampal cell death induced by the neuroleptic drug haloperidol.

PMID:9008714

Bcl-2 lies downstream of parathyroid hormone-related peptide in a signaling pathway that regulates chondrocyte maturation during skeletal development.

PMID:9009190

Bcl-2 promotes regeneration of severed axons in mammalian CNS.

PMID:9028316

Role of bcl-2 in the development of lymphoid cells from the hematopoietic stem cell.

PMID:9098922

Valproic acid-induced changes in gene expression during neurulation in a mouse model.

PMID:9153592

Susceptibility of cerebellar granule neurons derived from Bcl-2-deficient and transgenic mice to cell death.

PMID:9184696

The apoptosis and proliferation of SAC-activated B cells by IL-10 are associated with changes in Bcl-2, Bcl-xL, and Mcl-1 expression.

PMID:9202146

Differential involvement of caspases in apoptosis of myeloid leukemic cells induced by chemotherapy versus growth factor withdrawal.

PMID:9215624

Bcl-2 can rescue T lymphocyte development in interleukin-7 receptor-deficient mice but not in mutant rag-1-/- mice.

PMID:9241272

Bcl-2 and Bax function independently to regulate cell death.

PMID:9374413

Bcl-2 is required for cranial sensory neuron survival at defined stages of embryonic development.

PMID:9547242

Bcl-2 accelerates the maturation of early sensory neurons.

PMID:9560217

Bax directly induces release of cytochrome c from isolated mitochondria.

PMID:9681465

Enhanced oxidative stress and altered antioxidants in brains of Bcl-2-deficient mice.

PMID:9843949

Bax interacts with the permeability transition pore to induce permeability transition and cytochrome c release in isolated mitochondria.

PMID:9950951

Nuclear localization of beta-catenin and loss of apical brush border actin in cystic tubules of bcl-2 -/- mice.

file:mouse/Bcl2/Bcl2-uniprot.txt

UniProt record for mouse Bcl2

Bcl2 suppresses apoptosis by controlling mitochondrial permeability and preventing cytochrome c release.

"Regulates cell death by controlling the mitochondrial membrane permeability."

file:mouse/Bcl2/Bcl2-deep-research-bioreason.md

Bioreason deep research report on mouse Bcl2

Bcl2 is an anti-apoptotic BCL-2 family regulator whose core function is suppression of intrinsic apoptosis at mitochondrial membranes.

file:mouse/Bcl2/Bcl2-deep-research-falcon.md

Falcon deep research report on mouse Bcl2

Falcon synthesis identifies mouse Bcl2/P10417 as an anti-apoptotic BCL-2 family protein that prevents MOMP and cytochrome-c release through BH-domain partner interactions.

"Mouse Bcl2 (P10417) encodes an anti-apoptotic BCL-2 family protein whose primary function is to prevent MOMP by binding/sequestering BH3-containing pro-apoptotic partners."

Suggested Experiments

Experiment: Use Bcl2 BH-domain mutant rescue in mouse primary cells to test which survival and autophagy annotations require canonical BCL-2 family partner binding.

Experiment: Measure mitochondrial outer membrane permeabilization, cytochrome c release, and caspase activation in Bcl2 knockout and add-back mouse cells across apoptotic stimuli.

📚 Additional Documentation

Deep Research Bioreason

(Bcl2-deep-research-bioreason.md)

BioReason Chat Export

Exported on March 22, 2026 at 03:12 AM

Organism: Mus musculus

Sequence:

MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Thinking Trace

I begin with the InterPro architecture. The sequence is saturated with Bcl-2 family signatures that define a canonical anti-apoptotic scaffold: IPR013278 (Apoptosis regulator, Bcl-2 family, residues 1–218) and IPR004725 (Apoptosis regulator, Bcl-2/Bcl-X family, residues 4–236) frame the entire polypeptide as a member of the eukaryotic apoptosis-regulatory module. This is reinforced by IPR026298 (Bcl-2 family, residues 5–202) and the broader IPR036834 (Bcl-2-like superfamily, residues 6–220), indicating a conserved helical bundle fold used for regulated protein–protein interactions. The N-terminal IPR003093 (BH4 domain, residues 7–33) together with its conserved site IPR020731 (BH4 motif, residues 10–30) establishes an amphipathic helix that stabilizes anti-apoptotic activity and modulates binding affinity. The central-to-C-terminal core displays the hallmark BH1–BH3 module: IPR046371 (Bcl-2 homology region 1–3, residues 94–192) and IPR002475 (Bcl2-like, residues 94–194) define the canonical hydrophobic groove that recognizes BH3 motifs from other Bcl-2 family members. This binding platform is specified by three conserved-site annotations: IPR020728 (BH3 motif conserved site, residues 90–104), IPR020717 (BH1 motif conserved site, residues 134–152), and IPR020726 (BH2 motif conserved site, residues 185–196). The ordered presence of BH4 followed by BH1–BH3 establishes the classic anti-apoptotic architecture that sequesters pro-apoptotic partners and prevents mitochondrial outer membrane permeabilization.

From this architecture, the molecular function resolves as protein binding mediated by a BH-groove that captures BH3-containing ligands. The BH1–BH3 core (IPR046371/IPR002475) generates a hydrophobic cleft that binds pro-apoptotic effectors; thus the primary function is high-specificity protein binding that inhibits assembly of apoptotic complexes—captured by GO:0005515 molecular function as the operative biochemical capability of this fold.

This binding-driven mechanism causes anti-apoptotic regulation at the level of mitochondrial outer membrane integrity. By sequestering BH3-only activators and multi-domain effectors, the protein prevents pore formation and cytochrome c release, thereby blocking downstream caspase activation. This situates the protein squarely in the biological process of apoptosis control, most parsimoniously formalized as GO:0006915 apoptotic process, with directionality toward suppression of execution pathways.

Cellular placement follows from both the domain logic and the annotated subcellular distribution. Anti-apoptotic Bcl-2 modules commonly associate peripherally with membranes via their helical bundle and C-terminal amphipathic elements; here, the annotation specifies cytoplasm and cytoplasmic vesicles, with peripheral membrane association. This soluble/peripheral distribution is consistent with a regulator that shuttles between cytosol and vesicular surfaces to intercept BH3-only ligands and restrain mitochondrial pathway priming. Thus the cellular component is best captured by cytoplasm and cytoplasmic vesicle, with a peripheral membrane mode of association.

Mechanistically, the BH4–BH1–BH3 ensemble forms a modular trap that binds BH3-containing partners, preventing assembly of pro-apoptotic complexes. I hypothesize interactions with pro-apoptotic Bcl-2 family members that present BH3 motifs (such as effectors and sensitizers), with mitochondrial pathway adaptors at vesicle–mitochondria interfaces, and with cytosolic caspase-activating assemblies. The vesicle-proximal pool likely buffers apoptotic triggers by transiently sequestering BH3-only ligands before they reach mitochondria, thereby tuning the threshold for apoptosis initiation.

Functional Summary

An anti-apoptotic regulator in mouse that uses a conserved helical bundle to bind and neutralize pro-apoptotic partners. By assembling a BH domain platform that captures BH3-containing ligands, it prevents mitochondrial pathway activation and caspase engagement. The protein operates predominantly in the cytoplasm and on cytoplasmic vesicles as a peripheral membrane factor, where it sequesters apoptotic triggers and tunes the threshold for apoptosis initiation.

UniProt Summary

May prevent apoptosis.

InterPro Domains

Apoptosis regulator, Bcl-2 (IPR013278, family) — residues 1-218
Apoptosis regulator, Bcl-2/ BclX (IPR004725, family) — residues 4-236
Bcl-2 family (IPR026298, family) — residues 5-202
Bcl-2-like superfamily (IPR036834, homologous_superfamily) — residues 6-220
Apoptosis regulator, Bcl-2 protein, BH4 (IPR003093, domain) — residues 7-33
Apoptosis regulator, Bcl-2, BH4 motif, conserved site (IPR020731, conserved_site) — residues 10-30
Apoptosis regulator, Bcl-2, BH3 motif, conserved site (IPR020728, conserved_site) — residues 90-104
Bcl2-like (IPR002475, family) — residues 94-194
Bcl-2, Bcl-2 homology region 1-3 (IPR046371, domain) — residues 94-192
Apoptosis regulator, Bcl-2, BH1 motif, conserved site (IPR020717, conserved_site) — residues 134-152
Apoptosis regulator, Bcl-2, BH2 motif, conserved site (IPR020726, conserved_site) — residues 185-196

GO Terms

Molecular Function: molecular_function (GO:0003674), binding (GO:0005488), protein binding (GO:0005515), enzyme binding (GO:0019899), phosphatase binding (GO:0019902), protein phosphatase binding (GO:0019903), protein phosphatase 2A binding (GO:0051721)

Biological Process: biological_process (GO:0008150), localization (GO:0051179), signaling (GO:0023052), biological regulation (GO:0065007), response to stimulus (GO:0050896), pigmentation (GO:0043473), reproductive process (GO:0022414), growth (GO:0040007), negative regulation of biological process (GO:0048519), positive regulation of biological process (GO:0048518), regulation of biological process (GO:0050789), reproduction (GO:0000003), multicellular organismal process (GO:0032501), developmental process (GO:0032502), cellular process (GO:0009987), metabolic process (GO:0008152), homeostatic process (GO:0042592), immune system process (GO:0002376), sexual reproduction (GO:0019953), cellular localization (GO:0051641), anatomical structure development (GO:0048856), negative regulation of signaling (GO:0023057), molting cycle (GO:0042303), cell cycle process (GO:0022402), positive regulation of multicellular organismal process (GO:0051240), cellular component organization or biogenesis (GO:0071840), regulation of multicellular organismal process (GO:0051239), secondary metabolic process (GO:0019748), developmental process involved in reproduction (GO:0003006), multicellular organismal-level homeostasis (GO:0048871), negative regulation of metabolic process (GO:0009892), regulation of biological quality (GO:0065008), cellular homeostasis (GO:0019725), cellular process involved in reproduction in multicellular organism (GO:0022412), multicellular organismal response to stress (GO:0033555), cellular pigmentation (GO:0033059), regulation of cellular process (GO:0050794), regulation of response to stimulus (GO:0048583), cellular response to stimulus (GO:0051716), developmental maturation (GO:0021700), leukocyte homeostasis (GO:0001776), negative regulation of cellular process (GO:0048523), regulation of locomotion (GO:0040012), cellular developmental process (GO:0048869), response to abiotic stimulus (GO:0009628), organ growth (GO:0035265), regulation of metabolic process (GO:0019222), establishment of localization (GO:0051234), molting cycle process (GO:0022404), ossification (GO:0001503), regulation of molecular function (GO:0065009), actin filament-based process (GO:0030029), cell communication (GO:0007154), positive regulation of cellular process (GO:0048522), response to external stimulus (GO:0009605), developmental growth (GO:0048589), anatomical structure morphogenesis (GO:0009653), response to chemical (GO:0042221), cell motility (GO:0048870), transmembrane transport (GO:0055085), leukocyte activation (GO:0045321), cell population proliferation (GO:0008283), pigment metabolic process (GO:0042440), nitrogen compound metabolic process (GO:0006807), negative regulation of multicellular organismal process (GO:0051241), multicellular organism reproduction (GO:0032504), positive regulation of growth (GO:0045927), post-embryonic development (GO:0009791), regulation of developmental process (GO:0050793), response to endogenous stimulus (GO:0009719), cell death (GO:0008219), positive regulation of locomotion (GO:0040017), negative regulation of locomotion (GO:0040013), positive regulation of developmental pigmentation (GO:0048087), regulation of signaling (GO:0023051), negative regulation of developmental process (GO:0051093), developmental pigmentation (GO:0048066), signal transduction (GO:0007165), cell activation (GO:0001775), multicellular organism development (GO:0007275), negative regulation of transport (GO:0051051), behavior (GO:0007610), cell adhesion (GO:0007155), regulation of localization (GO:0032879), cell cycle (GO:0007049), organic substance metabolic process (GO:0071704), T cell selection (GO:0045058), system process (GO:0003008), chemical homeostasis (GO:0048878), cellular metabolic process (GO:0044237), immune system development (GO:0002520), positive regulation of metabolic process (GO:0009893), regulation of pigmentation (GO:0120305), regulation of viral process (GO:0050792), response to stress (GO:0006950), negative regulation of growth (GO:0045926), morphogenesis of a branching structure (GO:0001763), positive regulation of developmental process (GO:0051094), multicellular organismal reproductive process (GO:0048609), negative regulation of response to stimulus (GO:0048585), regulation of growth (GO:0040008), primary metabolic process (GO:0044238), cellular component morphogenesis (GO:0032989), response to acid chemical (GO:0001101), hair cycle (GO:0042633), cellular component biogenesis (GO:0044085), regulation of cell motility (GO:2000145), reactive oxygen species metabolic process (GO:0072593), response to radiation (GO:0009314), animal organ development (GO:0048513), pons development (GO:0021548), regulation of signal transduction (GO:0009966), behavioral defense response (GO:0002209), regulation of macromolecule metabolic process (GO:0060255), regulation of response to external stimulus (GO:0032101), cellular aromatic compound metabolic process (GO:0006725), monoatomic ion transmembrane transport (GO:0034220), negative regulation of cell cycle process (GO:0010948), response to hormone (GO:0009725), intracellular chemical homeostasis (GO:0055082), response to inorganic substance (GO:0010035), intracellular transport (GO:0046907), positive T cell selection (GO:0043368), regulation of membrane potential (GO:0042391), negative regulation of cell cycle (GO:0045786), cellular response to extracellular stimulus (GO:0031668), nephron development (GO:0072006), regulation of cell cycle process (GO:0010564), melanin metabolic process (GO:0006582), positive regulation of nitrogen compound metabolic process (GO:0051173), regulation of membrane permeability (GO:0090559), positive regulation of cell differentiation (GO:0045597), regulation of catalytic activity (GO:0050790), germ cell development (GO:0007281), positive regulation of molecular function (GO:0044093), positive regulation of macromolecule metabolic process (GO:0010604), positive regulation of muscle tissue development (GO:1901863), regulation of cellular localization (GO:0060341), negative regulation of cell population proliferation (GO:0008285), protein metabolic process (GO:0019538), regulation of cell growth (GO:0001558), hindbrain development (GO:0030902), establishment of localization in cell (GO:0051649), response to oxygen-containing compound (GO:1901700), regulation of protein stability (GO:0031647), regulation of developmental pigmentation (GO:0048070), positive regulation of developmental growth (GO:0048639), macromolecule metabolic process (GO:0043170), positive regulation of cell motility (GO:2000147), homeostasis of number of cells (GO:0048872), muscle structure development (GO:0061061), regulation of cell population proliferation (GO:0042127), regulation of cell death (GO:0010941), response to starvation (GO:0042594), response to nitrogen compound (GO:1901698), regulation of multicellular organism growth (GO:0040014), positive regulation of cellular metabolic process (GO:0031325), cellular response to stress (GO:0033554), transport (GO:0006810), negative regulation of monoatomic ion transport (GO:0043271), regulation of cellular metabolic process (GO:0031323), negative regulation of catabolic process (GO:0009895), ovarian follicle development (GO:0001541), hair cycle process (GO:0022405), regulation of primary metabolic process (GO:0080090), male sex differentiation (GO:0046661), regulation of muscle tissue development (GO:1901861), positive regulation of multicellular organism growth (GO:0040018), lymphocyte homeostasis (GO:0002260), response to hypoxia (GO:0001666), negative regulation of signal transduction (GO:0009968), regulation of viral genome replication (GO:0045069), programmed cell death (GO:0012501), tissue morphogenesis (GO:0048729), negative regulation of cell death (GO:0060548), cell development (GO:0048468), response to xenobiotic stimulus (GO:0009410), cell differentiation (GO:0030154), inorganic ion transmembrane transport (GO:0098660), system development (GO:0048731), response to oxygen levels (GO:0070482), regulation of cell adhesion (GO:0030155), renal system process (GO:0003014), development of primary sexual characteristics (GO:0045137), negative regulation of ossification (GO:0030279), lymphocyte activation (GO:0046649), neuron death (GO:0070997), phosphorus metabolic process (GO:0006793), anatomical structure maturation (GO:0071695), negative regulation of transmembrane transport (GO:0034763), tube development (GO:0035295), regulation of cell cycle (GO:0051726), cell morphogenesis (GO:0000902), regulation of catabolic process (GO:0009894), regulation of retinal cell programmed cell death (GO:0046668), animal organ morphogenesis (GO:0009887), organic cyclic compound metabolic process (GO:1901360), positive regulation of cytosolic calcium ion concentration (GO:0007204), cell maturation (GO:0048469), apoptotic signaling pathway (GO:0097190), negative regulation of cell growth (GO:0030308), negative regulation of cytosolic calcium ion concentration (GO:0051481), nephron morphogenesis (GO:0072028), regulation of nitrogen compound metabolic process (GO:0051171), programmed cell death involved in cell development (GO:0010623), hair follicle development (GO:0001942), regulation of cell differentiation (GO:0045595), cellular component organization (GO:0016043), cell surface receptor signaling pathway (GO:0007166), oocyte differentiation (GO:0009994), sex differentiation (GO:0007548), pigment granule organization (GO:0048753), regulation of cellular component organization (GO:0051128), reproductive structure development (GO:0048608), cellular response to external stimulus (GO:0071496), regulation of ossification (GO:0030278), cell-substrate adhesion (GO:0031589), regulation of developmental growth (GO:0048638), positive regulation of cell population proliferation (GO:0008284), cell migration (GO:0016477), negative regulation of cell motility (GO:2000146), tube morphogenesis (GO:0035239), female sex differentiation (GO:0046660), monoatomic ion homeostasis (GO:0050801), gamete generation (GO:0007276), organic hydroxy compound metabolic process (GO:1901615), negative regulation of cell communication (GO:0010648), regulation of transport (GO:0051049), organonitrogen compound metabolic process (GO:1901564), mitotic cell cycle process (GO:1903047), intracellular signal transduction (GO:0035556), response to wounding (GO:0009611), cell-cell adhesion (GO:0098609), response to oxidative stress (GO:0006979), hair follicle morphogenesis (GO:0031069), response to toxic substance (GO:0009636), regulation of transmembrane transport (GO:0034762), defense response (GO:0006952), morphogenesis of a branching epithelium (GO:0061138), inorganic ion homeostasis (GO:0098771), fear response (GO:0042596), cell death in response to oxidative stress (GO:0036473), neural nucleus development (GO:0048857), negative regulation of cellular metabolic process (GO:0031324), metencephalon development (GO:0022037), actin cytoskeleton organization (GO:0030036), signal transduction in absence of ligand (GO:0038034), response to organic substance (GO:0010033), anatomical structure homeostasis (GO:0060249), response to extracellular stimulus (GO:0009991), cell fate commitment (GO:0045165), regulation of viral life cycle (GO:1903900), tissue development (GO:0009888), head development (GO:0060322), regulation of cell communication (GO:0010646), cellular response to chemical stimulus (GO:0070887), regulation of calcium ion transport into cytosol (GO:0010522), regulation of biosynthetic process (GO:0009889), cell cycle phase transition (GO:0044770), pigment cell differentiation (GO:0050931), glomerulus development (GO:0032835), tissue homeostasis (GO:0001894), hematopoietic or lymphoid organ development (GO:0048534), regeneration (GO:0031099), mitotic cell cycle (GO:0000278), response to ischemia (GO:0002931), epithelial tube morphogenesis (GO:0060562), nephron epithelium development (GO:0072009), cell projection organization (GO:0030030), T cell lineage commitment (GO:0002360), regulation of macromolecule biosynthetic process (GO:0010556), cellular response to oxygen levels (GO:0071453), regulation of protein metabolic process (GO:0051246), cell cycle G1/S phase transition (GO:0044843), sensory system development (GO:0048880), negative regulation of reactive oxygen species metabolic process (GO:2000378), response to steroid hormone (GO:0048545), gonad development (GO:0008406), melanocyte differentiation (GO:0030318), B cell homeostasis (GO:0001782), development of primary male sexual characteristics (GO:0046546), neuron projection regeneration (GO:0031102), regulation of mitochondrial membrane potential (GO:0051881), kidney morphogenesis (GO:0060993), thymus development (GO:0048538), regulation of gene expression (GO:0010468), phenol-containing compound metabolic process (GO:0018958), cell-matrix adhesion (GO:0007160), regulation of cell maturation (GO:1903429), macromolecule modification (GO:0043412), negative regulation of autophagy (GO:0010507), muscle cell differentiation (GO:0042692), oocyte development (GO:0048599), response to decreased oxygen levels (GO:0036293), negative regulation of mitotic cell cycle (GO:0045930), positive regulation of cell migration (GO:0030335), intrinsic apoptotic signaling pathway (GO:0097193), mesonephric tubule development (GO:0072164), hematopoietic progenitor cell differentiation (GO:0002244), positive regulation of catalytic activity (GO:0043085), cell projection morphogenesis (GO:0048858), B cell activation (GO:0042113), actin filament organization (GO:0007015), mitochondrial transport (GO:0006839), cellular response to hypoxia (GO:0071456), response to light stimulus (GO:0009416), extrinsic apoptotic signaling pathway in absence of ligand (GO:0097192), leukocyte differentiation (GO:0002521), regulation of reactive oxygen species metabolic process (GO:2000377), cellular response to DNA damage stimulus (GO:0006974), cellular response to organic substance (GO:0071310), muscle cell development (GO:0055001), cellular response to chemical stress (GO:0062197), regulation of monoatomic ion transmembrane transport (GO:0034765), regulation of cell development (GO:0060284), sensory organ development (GO:0007423), oogenesis (GO:0048477), regulation of autophagy (GO:0010506), regulation of neuron death (GO:1901214), negative regulation of apoptotic signaling pathway (GO:2001234), regulation of protein localization (GO:0032880), intracellular monoatomic ion homeostasis (GO:0006873), regulation of muscle cell differentiation (GO:0051147), CD4-positive or CD8-positive, alpha-beta T cell lineage commitment (GO:0043369), protein modification process (GO:0036211), neurogenesis (GO:0022008), inorganic cation transmembrane transport (GO:0098662), neuron apoptotic process (GO:0051402), behavioral fear response (GO:0001662), response to lipid (GO:0033993), organic substance transport (GO:0071702), muscle tissue development (GO:0060537), apoptotic process (GO:0006915), regulation of cellular biosynthetic process (GO:0031326), T cell homeostasis (GO:0043029), regulation of osteoblast proliferation (GO:0033688), extrinsic apoptotic signaling pathway (GO:0097191), response to hydrogen peroxide (GO:0042542), muscle organ development (GO:0007517), epithelium development (GO:0060429), cell junction organization (GO:0034330), gland morphogenesis (GO:0022612), cellular response to nutrient levels (GO:0031669), supramolecular fiber organization (GO:0097435), response to reactive oxygen species (GO:0000302), negative regulation of cell cycle phase transition (GO:1901988), cellular response to oxidative stress (GO:0034599), monoatomic cation transmembrane transport (GO:0098655), regulation of neuron differentiation (GO:0045664), stem cell development (GO:0048864), regulation of mitotic cell cycle (GO:0007346), digestive system development (GO:0055123), negative regulation of programmed cell death (GO:0043069), regulation of programmed cell death (GO:0043067), regulation of cell-substrate adhesion (GO:0010810), negative regulation of cellular catabolic process (GO:0031330), cell part morphogenesis (GO:0032990), nephron epithelium morphogenesis (GO:0072088), gland development (GO:0048732), sensory organ morphogenesis (GO:0090596), morphogenesis of an epithelium (GO:0002009), skin development (GO:0043588), regulation of cell migration (GO:0030334), spleen development (GO:0048536), lymphocyte differentiation (GO:0030098), neuron development (GO:0048666), branching morphogenesis of an epithelial tube (GO:0048754), cellular component assembly (GO:0022607), brain development (GO:0007420), positive regulation of skeletal muscle tissue development (GO:0048643), cell morphogenesis involved in differentiation (GO:0000904), renal tubule development (GO:0061326), regulation of skeletal muscle tissue development (GO:0048641), nervous system development (GO:0007399), negative regulation of monoatomic ion transmembrane transport (GO:0034766), female gamete generation (GO:0007292), epidermis development (GO:0008544), response to nutrient levels (GO:0031667), central nervous system development (GO:0007417), positive regulation of cell maturation (GO:1903431), mesenchymal cell differentiation (GO:0048762), response to ionizing radiation (GO:0010212), release of cytochrome c from mitochondria (GO:0001836), muscle cell migration (GO:0014812), membrane organization (GO:0061024), renal system development (GO:0072001), hemopoiesis (GO:0030097), reproductive system development (GO:0061458), response to cytokine (GO:0034097), negative regulation of neuron death (GO:1901215), neuron maturation (GO:0042551), response to amino acid (GO:0043200), positive regulation of phosphorus metabolic process (GO:0010562), cellular response to starvation (GO:0009267), positive regulation of cell development (GO:0010720), phosphate-containing compound metabolic process (GO:0006796), mesenchyme development (GO:0060485), regulation of glycoprotein metabolic process (GO:1903018), regulation of apoptotic signaling pathway (GO:2001233), digestive tract morphogenesis (GO:0048546), monoatomic ion transport (GO:0006811), regulation of response to extracellular stimulus (GO:0032104), calcium ion homeostasis (GO:0055074), negative regulation of cell migration (GO:0030336), response to axon injury (GO:0048678), positive regulation of muscle cell differentiation (GO:0051149), mitotic cell cycle phase transition (GO:0044772), regulation of mitochondrial membrane permeability (GO:0046902), stem cell differentiation (GO:0048863), intrinsic apoptotic signaling pathway in response to oxidative stress (GO:0008631), monoatomic cation homeostasis (GO:0055080), response to organonitrogen compound (GO:0010243), development of primary female sexual characteristics (GO:0046545), regulation of cell cycle phase transition (GO:1901987), calcium ion transport into cytosol (GO:0060402), positive regulation of protein metabolic process (GO:0051247), T cell activation (GO:0042110), negative regulation of calcium ion transport (GO:0051926), response to organic cyclic compound (GO:0014070), homeostasis of number of cells within a tissue (GO:0048873), regulation of monoatomic ion transport (GO:0043269), regulation of cellular catabolic process (GO:0031329), organelle organization (GO:0006996), kidney development (GO:0001822), digestive tract development (GO:0048565), neuron differentiation (GO:0030182), regulation of phosphorus metabolic process (GO:0051174), nephron tubule development (GO:0072080), mitochondrion organization (GO:0007005), regulation of apoptotic process (GO:0042981), female gonad development (GO:0008585), mesonephros development (GO:0001823), response to corticosteroid (GO:0031960), vesicle organization (GO:0016050), positive regulation of phosphate metabolic process (GO:0045937), ear development (GO:0043583), regulation of cell-matrix adhesion (GO:0001952), plasma membrane bounded cell projection morphogenesis (GO:0120039), skin epidermis development (GO:0098773), regulation of neuron apoptotic process (GO:0043523), peptidyl-amino acid modification (GO:0018193), cell junction assembly (GO:0034329), phosphorylation (GO:0016310), intracellular monoatomic cation homeostasis (GO:0030003), skeletal muscle tissue development (GO:0007519), renal tubule morphogenesis (GO:0061333), regulation of neuron maturation (GO:0014041), branching involved in ureteric bud morphogenesis (GO:0001658), intrinsic apoptotic signaling pathway in response to DNA damage (GO:0008630), negative regulation of neuron apoptotic process (GO:0043524), regulation of cellular macromolecule biosynthetic process (GO:2000112), negative regulation of calcium ion transmembrane transport (GO:1903170), regulation of monoatomic cation transmembrane transport (GO:1904062), cellular response to glucose starvation (GO:0042149), intracellular calcium ion homeostasis (GO:0006874), epithelial cell apoptotic process (GO:1904019), positive regulation of protein modification process (GO:0031401), positive regulation of smooth muscle cell migration (GO:0014911), dephosphorylation (GO:0016311), positive regulation of neuron maturation (GO:0014042), kidney epithelium development (GO:0072073), plasma membrane bounded cell projection organization (GO:0120036), negative regulation of cation transmembrane transport (GO:1904063), regulation of smooth muscle cell migration (GO:0014910), response to gamma radiation (GO:0010332), calcium ion transmembrane transport (GO:0070588), male gonad development (GO:0008584), regulation of response to nutrient levels (GO:0032107), neuron projection development (GO:0031175), alpha-beta T cell lineage commitment (GO:0002363), focal adhesion assembly (GO:0048041), negative regulation of cell cycle G1/S phase transition (GO:1902807), myeloid cell apoptotic process (GO:0033028), nephron tubule morphogenesis (GO:0072078), alpha-beta T cell activation (GO:0046631), eye morphogenesis (GO:0048592), monoatomic cation transport (GO:0006812), apoptotic mitochondrial changes (GO:0008637), metanephros development (GO:0001656), protein dephosphorylation (GO:0006470), regulation of metal ion transport (GO:0010959), visual system development (GO:0150063), regulation of glycoprotein biosynthetic process (GO:0010559), cytoskeleton organization (GO:0007010), epidermis morphogenesis (GO:0048730), G1/S transition of mitotic cell cycle (GO:0000082), mononuclear cell differentiation (GO:1903131), response to UV (GO:0009411), ureteric bud development (GO:0001657), generation of neurons (GO:0048699), mitochondrial membrane organization (GO:0007006), mesonephric tubule morphogenesis (GO:0072171), cell morphogenesis involved in neuron differentiation (GO:0048667), eye development (GO:0001654), regulation of protein modification process (GO:0031399), T cell differentiation (GO:0030217), smooth muscle cell migration (GO:0014909), negative regulation of mitotic cell cycle phase transition (GO:1901991), hematopoietic stem cell differentiation (GO:0060218), skeletal muscle organ development (GO:0060538)

Cellular Component: cellular_component (GO:0005575), cellular anatomical entity (GO:0110165), intracellular anatomical structure (GO:0005622), organelle (GO:0043226), membrane (GO:0016020), cytosol (GO:0005829), organelle subcompartment (GO:0031984), myelin sheath (GO:0043209), envelope (GO:0031975), cytoplasm (GO:0005737), endomembrane system (GO:0012505), organelle membrane (GO:0031090), organelle envelope (GO:0031967), intracellular organelle (GO:0043229), endoplasmic reticulum subcompartment (GO:0098827), nuclear outer membrane-endoplasmic reticulum membrane network (GO:0042175), mitochondrion (GO:0005739), endoplasmic reticulum (GO:0005783), nuclear envelope (GO:0005635), membrane-bounded organelle (GO:0043227), nuclear membrane (GO:0031965), mitochondrial envelope (GO:0005740), intracellular membrane-bounded organelle (GO:0043231), endoplasmic reticulum membrane (GO:0005789), mitochondrial membrane (GO:0031966), nucleus (GO:0005634)

Generated by BioReason

Deep Research Bioreason Rl

(Bcl2-deep-research-bioreason-rl.md)

BioReason Chat Export

Exported on March 22, 2026 at 03:12 AM

Organism: Mus musculus

Sequence:

MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Thinking Trace

Functional Summary

UniProt Summary

May prevent apoptosis.

InterPro Domains

Apoptosis regulator, Bcl-2 (IPR013278, family) — residues 1-218
Apoptosis regulator, Bcl-2/ BclX (IPR004725, family) — residues 4-236
Bcl-2 family (IPR026298, family) — residues 5-202
Bcl-2-like superfamily (IPR036834, homologous_superfamily) — residues 6-220
Apoptosis regulator, Bcl-2 protein, BH4 (IPR003093, domain) — residues 7-33
Apoptosis regulator, Bcl-2, BH4 motif, conserved site (IPR020731, conserved_site) — residues 10-30
Apoptosis regulator, Bcl-2, BH3 motif, conserved site (IPR020728, conserved_site) — residues 90-104
Bcl2-like (IPR002475, family) — residues 94-194
Bcl-2, Bcl-2 homology region 1-3 (IPR046371, domain) — residues 94-192
Apoptosis regulator, Bcl-2, BH1 motif, conserved site (IPR020717, conserved_site) — residues 134-152
Apoptosis regulator, Bcl-2, BH2 motif, conserved site (IPR020726, conserved_site) — residues 185-196

GO Terms

Generated by BioReason

Deep Research Falcon

(Bcl2-deep-research-falcon.md)

provider: falcon
model: Edison Scientific Literature
cached: false
start_time: '2026-05-03T13:30:50.057227'
end_time: '2026-05-03T13:45:16.036185'
duration_seconds: 865.98
template_file: templates/gene_research_go_focused.md
template_variables:
organism: mouse
gene_id: Bcl2
gene_symbol: Bcl2
uniprot_accession: P10417
protein_description: 'RecName: Full=Apoptosis regulator Bcl-2;'
gene_info: Name=Bcl2; Synonyms=Bcl-2;
organism_full: Mus musculus (Mouse).
protein_family: Belongs to the Bcl-2 family. .
protein_domains: Apop_reg_Bcl2. (IPR013278); Bcl-2-like_sf. (IPR036834); Bcl-2_BH1-3.
(IPR046371); Bcl-2_fam. (IPR026298); Bcl2-like. (IPR002475)
provider_config:
timeout: 600
max_retries: 3
parameters:
allowed_domains: []
temperature: 0.1
citation_count: 34

Question

Gene Research for Functional Annotation

⚠️ CRITICAL: Gene/Protein Identification Context

BEFORE YOU BEGIN RESEARCH: You MUST verify you are researching the CORRECT gene/protein. Gene symbols can be ambiguous, especially for less well-characterized genes from non-model organisms.

Target Gene/Protein Identity (from UniProt):

UniProt Accession: P10417
Protein Description: RecName: Full=Apoptosis regulator Bcl-2;
Gene Information: Name=Bcl2; Synonyms=Bcl-2;
Organism (full): Mus musculus (Mouse).
Protein Family: Belongs to the Bcl-2 family. .
Key Domains: Apop_reg_Bcl2. (IPR013278); Bcl-2-like_sf. (IPR036834); Bcl-2_BH1-3. (IPR046371); Bcl-2_fam. (IPR026298); Bcl2-like. (IPR002475)

MANDATORY VERIFICATION STEPS:

Check if the gene symbol "Bcl2" matches the protein description above
Verify the organism is correct: Mus musculus (Mouse).
Check if protein family/domains align with what you find in literature
If you find literature for a DIFFERENT gene with the same or similar symbol, STOP

If Gene Symbol is Ambiguous or You Cannot Find Relevant Literature:

DO NOT PROCEED WITH RESEARCH ON A DIFFERENT GENE. Instead:
- State clearly: "The gene symbol 'Bcl2' is ambiguous or literature is limited for this specific protein"
- Explain what you found (e.g., "Found extensive literature on a different gene with the same symbol in a different organism")
- Describe the protein based ONLY on the UniProt information provided above
- Suggest that the protein function can be inferred from domain/family information

Research Target:

Please provide a comprehensive research report on the gene Bcl2 (gene ID: Bcl2, UniProt: P10417) in mouse.

The research report should be a detailed narrative explaining the function, biological processes, and localization of the gene product. Citations should be given for all claims.

You should prioritize authoritative reviews and primary scientific literature when conducting research. You can supplement
this with annotations you find in gene/protein databases, but these can be outdated or inaccurate.

We are specifically interested in the primary function of the gene - for enzymes, what reaction is catalyzed, and what is the substrate specificity? For transporters, what is the substrate? For structural proteins or adapters, what is the broader structural role? For signaling molecules, what is the role in the pathway.

We are interested in where in or outside the cell the gene product carries out its function.

We are also interested in the signaling or biochemical pathways in which the gene functions. We are less interested in broad pleiotropic effects, except where these elucidate the precise role.

Include evidence where possible. We are interested in both experimental evidence as well as inference from structure, evolution, or bioinformatic analysis. Precise studies should be prioritized over high-throughput, where available.

Output

Question: You are an expert researcher providing comprehensive, well-cited information.

Provide detailed information focusing on:
1. Key concepts and definitions with current understanding
2. Recent developments and latest research (prioritize 2023-2024 sources)
3. Current applications and real-world implementations
4. Expert opinions and analysis from authoritative sources
5. Relevant statistics and data from recent studies

Format as a comprehensive research report with proper citations. Include URLs and publication dates where available.
Always prioritize recent, authoritative sources and provide specific citations for all major claims.

Gene Research for Functional Annotation

⚠️ CRITICAL: Gene/Protein Identification Context

BEFORE YOU BEGIN RESEARCH: You MUST verify you are researching the CORRECT gene/protein. Gene symbols can be ambiguous, especially for less well-characterized genes from non-model organisms.

Target Gene/Protein Identity (from UniProt):

UniProt Accession: P10417
Protein Description: RecName: Full=Apoptosis regulator Bcl-2;
Gene Information: Name=Bcl2; Synonyms=Bcl-2;
Organism (full): Mus musculus (Mouse).
Protein Family: Belongs to the Bcl-2 family. .
Key Domains: Apop_reg_Bcl2. (IPR013278); Bcl-2-like_sf. (IPR036834); Bcl-2_BH1-3. (IPR046371); Bcl-2_fam. (IPR026298); Bcl2-like. (IPR002475)

MANDATORY VERIFICATION STEPS:

Check if the gene symbol "Bcl2" matches the protein description above
Verify the organism is correct: Mus musculus (Mouse).
Check if protein family/domains align with what you find in literature
If you find literature for a DIFFERENT gene with the same or similar symbol, STOP

If Gene Symbol is Ambiguous or You Cannot Find Relevant Literature:

Research Target:

Please provide a comprehensive research report on the gene Bcl2 (gene ID: Bcl2, UniProt: P10417) in mouse.

The research report should be a detailed narrative explaining the function, biological processes, and localization of the gene product. Citations should be given for all claims.

We are interested in where in or outside the cell the gene product carries out its function.

We are also interested in the signaling or biochemical pathways in which the gene functions. We are less interested in broad pleiotropic effects, except where these elucidate the precise role.

Research Report: Mouse Bcl2 (UniProt P10417) — Functional Annotation and Translational Context

0) Target verification (mandatory)

Primary literature explicitly identifies mouse BCL-2 as UniProt accession P10417 by searching against the UniProt mouse protein database in a murine proteomics workflow, confirming that the UniProt record provided (P10417) corresponds to Mus musculus apoptosis regulator Bcl-2 (gene symbol Bcl2). This supports that the literature summarized here is aligned to the specified target and not to paralogs (e.g., Bcl2l1/Bcl-xL) or non-mouse orthologs. (scully2023cancercellmembrane media a50dc067)

1) Key concepts and definitions (current understanding)

1.1 Intrinsic (mitochondrial) apoptosis and MOMP

Intrinsic apoptosis is initiated by intracellular stresses and converges on mitochondrial outer membrane permeabilization (MOMP), which releases apoptogenic factors such as cytochrome c and activates caspases. In this pathway, the BCL-2 family is the core regulatory module governing whether MOMP occurs. (saddam2024emergingbiomarkersand pages 6-8, zielonka2024mechanismsofresistance pages 1-3)

1.2 BCL-2 family logic: anti-apoptotic, effectors, and BH3-only proteins

Modern BCL-2 family models group proteins into: (i) anti-apoptotic pro-survival members (including BCL-2), (ii) pore-forming effectors (BAX, BAK, and in some contexts BOK), and (iii) BH3-only proteins (e.g., BID, BIM, PUMA, NOXA, BAD), which act as stress sensors and either activate effectors or neutralize anti-apoptotic proteins. (saddam2024emergingbiomarkersand pages 4-6, saddam2024emergingbiomarkersand pages 9-10, saddam2024emergingbiomarkersand pages 8-9)

1.3 Structural determinants: BH domains, hydrophobic groove, and TM helix

Anti-apoptotic BCL-2 family proteins are multi-domain proteins with BH1–BH4 motifs. Their BH1–BH3 regions form a hydrophobic groove that binds BH3 motifs from pro-apoptotic partners, enabling sequestration and inhibition of apoptosis. Many family members also have a C-terminal transmembrane helix (often termed α9/TM) that targets/anchors them to intracellular membranes (notably ER and/or mitochondrial outer membrane), aligning localization with function. (saddam2024emergingbiomarkersand pages 9-10, saddam2024emergingbiomarkersand pages 4-6, saddam2024emergingbiomarkersand pages 8-9)

2) Bcl2 (P10417) molecular function in mouse (what it does)

2.1 Primary function: anti-apoptotic sequestration to prevent MOMP

The primary molecular function of BCL-2 is suppression of intrinsic apoptosis by antagonizing pro-apoptotic BCL-2 family members. Mechanistically, BCL-2 binds BH3-containing partners through its groove, thereby preventing downstream BAX/BAK oligomerization and pore formation in the mitochondrial outer membrane that would otherwise cause MOMP and apoptosis. (saddam2024emergingbiomarkersand pages 4-6, saddam2024emergingbiomarkersand pages 9-10, zielonka2024mechanismsofresistance pages 1-3)

A BCL-2 isoform described in reviews (BCL-2α) can bind BAX via BH1 and BH2, and BCL-2 overexpression blocks BAX-mediated cytochrome-c release and caspase activation. (saddam2024emergingbiomarkersand pages 9-10)

2.2 Network context: BH3-only activators/sensitizers and effector activation

BH3-only proteins are described as upstream regulators that either directly activate BAX/BAK or act as sensitizers by binding anti-apoptotic proteins (e.g., BCL-2), freeing effectors to oligomerize. Activated BAX and BAK form oligomers that generate pores in the mitochondrial outer membrane, a key step in the intrinsic apoptotic pathway. (saddam2024emergingbiomarkersand pages 6-8, saddam2024emergingbiomarkersand pages 8-9)

3) Subcellular localization: where BCL-2 acts

3.1 ER, MAM, and mitochondria localization (dynamic model)

A mechanistic localization study reports that in resting cells Bcl2 is predominantly localized to the endoplasmic reticulum (ER) and upon apoptotic induction partially relocates to mitochondria-associated membranes (MAM) and mitochondria. This establishes BCL-2 as a regulator positioned at both the ER and mitochondria, including ER–mitochondria contact sites. (lalier2021tom20mediatedtransferof pages 1-2, lalier2021tom20mediatedtransferof pages 3-5)

3.2 TOM20-mediated transfer between ER/MAM and mitochondria

The same study identifies TOM20 (a mitochondrial outer membrane import receptor) as controlling Bcl2’s interaction with mitochondria and reports that BCL2–TOM20 proximity/interaction increases during early apoptosis, supporting a regulated trafficking or recruitment step. (lalier2021tom20mediatedtransferof pages 1-2, lalier2021tom20mediatedtransferof pages 3-5)

3.3 ER-localized regulation of calcium signaling via IP3R

Recent work and synthesis emphasize that BCL-2 can regulate apoptosis from the ER by binding IP3 receptors (IP3R), linking BCL-2 to ER-to-mitochondria Ca2+ signaling that can influence apoptotic commitment. (lalier2021tom20mediatedtransferof pages 8-10, beigl2024bcl2andbok pages 1-2)

4) Recent developments (prioritizing 2023–2024)

4.1 2024: Transmembrane-domain (TMD) interactions add BH3-independent regulation

A 2024 EMBO Reports paper demonstrates that BCL-2’s C-terminal transmembrane domain is not merely a localization tag: it forms a direct TMD–TMD interaction with BOK at the ER, and BCL-2 inhibition of BOK-induced apoptosis depends specifically on these transmembrane domains. This supports a BH3-independent interface contributing to apoptosis control.
- Publication: May 2024; URL: https://doi.org/10.1038/s44319-024-00206-6 (beigl2024bcl2andbok pages 1-2, beigl2024bcl2andbok pages 2-3)

4.2 2023: Expanding mechanistic views of pore-forming effectors and TM regulation

A 2023 BioEssays review synthesizes that mitochondrial “poration” (MOMP) is executed by a growing list of pore-forming BCL-2 family proteins (BAX/BAK plus additional effectors in specific contexts) and highlights the importance of C-terminal TM segments in localization and regulation (e.g., cytosolic sequestration versus constitutive mitochondrial anchoring).
- Publication: Jan 2023; URL: https://doi.org/10.1002/bies.202200221 (moldoveanu2023apoptoticmitochondrialporation pages 8-10)

4.3 2023–2024: Clinical resistance mechanisms map back to BCL-2’s binding groove and network redundancy

Recent reviews of venetoclax (a selective BCL-2 BH3 mimetic) resistance emphasize that resistance can arise through:
- On-target mutations in the BCL-2 binding groove that reduce drug affinity (e.g., G101V reduces binding ~180-fold in CLL), and/or
- Network rewiring toward alternative pro-survival proteins (e.g., MCL-1, BCL-XL) that can substitute for BCL-2 in sequestering pro-apoptotic partners.
- Publications: Nov 2024 (CLL review); URL: https://doi.org/10.3390/cells13221922 (li2024bcl2ibasedtherapiesand pages 4-5, li2024bcl2ibasedtherapiesand pages 7-8)
- Publication: Jun 2024 (AML review); URL: https://doi.org/10.1038/s41419-024-06810-7 (nwosu2024venetoclaxtherapyand pages 1-2)

5) Current applications and real-world implementations

5.1 BH3 mimetics (venetoclax) as a pathway-directed implementation of BCL-2 biology

Venetoclax is a BH3 mimetic designed to bind and antagonize BCL-2, thereby freeing pro-apoptotic signaling to proceed through BAX/BAK and MOMP. Reviews emphasize its clinical impact (especially in hematologic malignancies) and describe resistance mechanisms that mirror the redundancy of the BCL-2 network (e.g., MCL-1 upregulation). (nwosu2024venetoclaxtherapyand pages 1-2, zielonka2024mechanismsofresistance pages 1-3)

5.2 Solid tumor drug-delivery implementation using a mouse model (2023)

A 2023 Molecular Pharmaceutics study implemented ABT-737 (a BCL-2/BCL-XL inhibitor) delivery in a syngeneic orthotopic 4T1 murine triple-negative breast cancer model using cancer-cell-membrane wrapped PLGA nanoparticles (CCNPs). Key quantitative outcomes included:
- >2-fold increased tumor accumulation of CCNPs vs PEG-PLGA NPs (reported as ~2.4-fold by IVIS and ~2.2-fold by tumor homogenate fluorescence). (scully2023cancercellmembrane media c901409d)
- Biomarker shifts consistent with on-target pro-apoptotic effects: reduced intratumoral Bcl-2 staining and increased active caspase-3 with CCNP treatment. (scully2023cancercellmembrane media c901409d)
- Publication: Jul 2023; URL: https://doi.org/10.1021/acs.molpharmaceut.3c00009 (scully2023cancercellmembrane pages 1-2, scully2023cancercellmembrane media c901409d)

6) Expert opinions and analysis (authoritative perspectives)

Authoritative reviews converge on the interpretation that BCL-2 functions as a central checkpoint that suppresses intrinsic apoptosis by binding BH3 motifs and restraining effector activation/oligomerization, and that this can be therapeutically exploited by BH3 mimetics that occupy the BH3-binding cleft. These syntheses also emphasize that apparent “single-node” targeting (BCL-2 inhibition) frequently triggers compensatory adaptation (e.g., MCL-1/BCL-XL upregulation), reflecting the networked design of apoptosis control. (saddam2024emergingbiomarkersand pages 4-6, zielonka2024mechanismsofresistance pages 1-3)

7) Recent statistics and data (2023–2024 prioritized)

7.1 AML outcomes and limitations (2024)

A 2024 review reports that approximately 30% of AML patients fail to respond to venetoclax-based regimens and that almost all initial responders eventually relapse, emphasizing durability limitations despite strong initial activity.
- Publication: Jun 2024; URL: https://doi.org/10.1038/s41419-024-06810-7 (nwosu2024venetoclaxtherapyand pages 1-2)

7.2 VIALE-A-type regimen outcome statistics (summarized in 2025 review but directly about the venetoclax+azacitidine standard)

A 2025 review summarizing VIALE-A reports median overall survival 14.7 vs 9.6 months and 3-year survival 25% vs 10% (venetoclax+azacitidine vs azacitidine), quantifying clinical benefit of BCL-2 targeting in combination therapy.
- Publication: Sep 2025; URL: https://doi.org/10.3389/fonc.2025.1577908 (diamantidis2025factorsaffectingresponse pages 1-2)

7.3 CLL venetoclax response and resistance genetics (2024)

A 2024 review reports venetoclax monotherapy produces overall response rates around ~80% with complete response ~6–20%, and identifies BCL2 G101V as reducing BH3-pocket binding ~180-fold, emerging in relapsed patients after 19–42 months.
- Publication: Nov 2024; URL: https://doi.org/10.3390/cells13221922 (li2024bcl2ibasedtherapiesand pages 4-5)

7.4 Quantitative in vivo delivery and pharmacodynamic effects (2023, mouse)

The 2023 CCNP delivery paper reports >2-fold tumor accumulation improvements and histology consistent with increased apoptosis (active caspase-3) and decreased Bcl-2 staining. (scully2023cancercellmembrane media c901409d)

Summary for functional annotation (mouse Bcl2 / P10417)

Mouse Bcl2 (P10417) encodes an anti-apoptotic BCL-2 family protein whose primary function is to prevent MOMP by binding/sequestering BH3-containing pro-apoptotic partners and restraining effector activation. It localizes prominently to the ER in resting cells and can redistribute to MAM and mitochondria during apoptosis initiation, a process regulated by TOM20 and ER–mitochondria contact-site integrity. Recent 2024 work adds that BCL-2’s transmembrane domain can mediate BH3-independent inhibition of the ER-localized effector BOK, expanding the mechanistic repertoire beyond the canonical BH3:groove paradigm. Clinically and translationally, this biology is implemented via BH3 mimetics (e.g., venetoclax) and via emerging delivery strategies (e.g., ABT-737 nanoparticles in mouse solid tumor models), while resistance statistics underscore the robustness and redundancy of the BCL-2 network.

Aspect	Summary
Verified identity	Mouse Bcl2 / apoptosis regulator Bcl-2 / UniProt P10417. Evidence in a mouse proteomics study explicitly maps BCL-2 to UniProt P10417 in the UniProt Mus database; family/domain reviews place BCL-2 among anti-apoptotic BCL-2 family proteins localized to intracellular membranes, especially mitochondria and ER (saddam2024emergingbiomarkersand pages 4-6, saddam2024emergingbiomarkersand pages 9-10)
Primary molecular function	Anti-apoptotic regulator of intrinsic (mitochondrial) apoptosis. BCL-2 binds and sequesters BH3-containing pro-apoptotic proteins and/or restrains BAX/BAK activation, thereby preventing mitochondrial outer membrane permeabilization (MOMP), cytochrome-c release, caspase activation, and cell death (saddam2024emergingbiomarkersand pages 1-2, saddam2024emergingbiomarkersand pages 4-6, saddam2024emergingbiomarkersand pages 9-10, zielonka2024mechanismsofresistance pages 1-3)
Key domains / structural features	BCL-2 is a multi-BH-domain anti-apoptotic protein with BH1-BH4 regions; BH1-BH3 form the canonical hydrophobic BH3-binding groove, BH4 supports pro-survival activity, and the C-terminal transmembrane helix (TM, α9) anchors the protein to intracellular membranes. Reviews note BCL-2-family proteins share a helical fold and membrane-targeting TM segment critical for localization/function (saddam2024emergingbiomarkersand pages 9-10, saddam2024emergingbiomarkersand pages 2-4, silva2026bcl2andbclxl pages 8-10, saddam2024emergingbiomarkersand pages 8-9)
Key interactors / mechanism	BH3-only proteins (e.g., BID, BIM, PUMA, BAD, NOXA) engage the groove; BAX/BAK are restrained to block pore formation and MOMP; BOK can be inhibited by a distinct TMD-TMD interaction with BCL-2 at the ER; TOM20 helps mediate BCL-2 transfer from ER to MAM/mitochondria during apoptosis; IP3R binds BCL-2 at the ER, linking BCL-2 to Ca2+ control and ER-mitochondria signaling (saddam2024emergingbiomarkersand pages 6-8, beigl2024broughttolight pages 33-36, beigl2024bcl2andbok pages 1-2, saddam2024emergingbiomarkersand pages 9-10, lalier2021tom20mediatedtransferof pages 1-2, beigl2024bcl2andbok pages 2-3)
Subcellular localization	BCL-2 is found on ER, mitochondria-associated membranes (MAM), and mitochondria/outer mitochondrial membrane. Multiple sources indicate substantial ER localization in non-apoptotic cells, with movement to MAM and mitochondria during early apoptosis; family reviews also describe localization at MOM and/or ER (saddam2024emergingbiomarkersand pages 4-6, lalier2021tom20mediatedtransferof pages 1-2, lalier2021tom20mediatedtransferof pages 8-10, lalier2021tom20mediatedtransferof pages 3-5, beigl2024broughttolight pages 102-107)
2023–2024 notable developments	2024 EMBO Reports: direct BCL-2–BOK C-terminal TMD interaction at the ER adds a BH3-independent regulatory layer to apoptosis control (beigl2024bcl2andbok pages 1-2, beigl2024bcl2andbok pages 2-3). 2024 resistance reviews: venetoclax resistance is increasingly linked to BCL2 groove mutations, BAX loss, and adaptive shifts to MCL-1/BCL-xL dependence in AML/CLL (li2024bcl2ibasedtherapiesand pages 4-5, li2024bcl2ibasedtherapiesand pages 7-8, nwosu2024venetoclaxtherapyand pages 1-2, zielonka2024mechanismsofresistance pages 1-3). 2023 translational implementation: biomimetic nanoparticles delivering ABT-737 improved tumor targeting in a murine TNBC model (scully2023cancercellmembrane pages 14-15, scully2023cancercellmembrane pages 1-2, scully2023cancercellmembrane pages 2-3)
Quantitative statistics / translational relevance	AML: ~30% of patients fail to respond to venetoclax-based regimens and almost all responders eventually relapse; VIALE-A reported median OS 14.7 vs 9.6 months for venetoclax+azacitidine vs azacitidine, with 3-year survival 25% vs 10% (nwosu2024venetoclaxtherapyand pages 1-2, diamantidis2025factorsaffectingresponse pages 1-2). CLL: venetoclax monotherapy ORR ~80%, CR 6–20%; relapse-associated BCL2 G101V reduces binding ~180-fold and can emerge after 19–42 months (li2024bcl2ibasedtherapiesand pages 4-5, li2024bcl2ibasedtherapiesand pages 7-8). AML genetics: TP53-wildtype/non-TP53 cases showed 70% response and 23.4 mo OS vs 41% response and 5.2 mo OS for TP53-mutant disease; ~17% of relapsed AML after VEN-based therapy harbor BAX inactivation (chatzilygeroudi2025unravelingvenetoclaxresistance pages 4-6). Solid-tumor delivery: BCL-2 inhibitor nanoparticles increased orthotopic TNBC tumor accumulation by >2-fold, raised uptake by ~17× vs bare NPs and ~30× vs non-target cells, and lowered intratumoral Bcl-2 by 2.2×–2.9× at ~2 mg/kg ABT-737 without obvious systemic toxicity (scully2023cancercellmembrane pages 14-15, scully2023cancercellmembrane pages 1-2, scully2023cancercellmembrane pages 2-3)

Table: This table condenses identity verification, molecular function, structural features, localization, key interactors, and recent 2023-2024 translational developments for mouse Bcl2 (UniProt P10417). It is useful as a high-density evidence map linking core biology to current therapeutic relevance.

References

(scully2023cancercellmembrane media a50dc067): Mackenzie A. Scully, Dana E. Wilkins, Megan N. Dang, Elise C. Hoover, Sara B. Aboeleneen, and Emily S. Day. Cancer cell membrane wrapped nanoparticles for the delivery of a bcl-2 inhibitor to triple-negative breast cancer. Molecular pharmaceutics, 20:3895-3913, Jul 2023. URL: https://doi.org/10.1021/acs.molpharmaceut.3c00009, doi:10.1021/acs.molpharmaceut.3c00009. This article has 29 citations and is from a domain leading peer-reviewed journal.
(saddam2024emergingbiomarkersand pages 6-8): Md. Saddam, Shamrat Kumar Paul, Mohammad Ahsan Habib, Md. Abrar Fahim, Afsana Mimi, Saiful Islam, Bristi Paul, and Md Mostofa Uddin Helal. Emerging biomarkers and potential therapeutics of the bcl-2 protein family: the apoptotic and anti-apoptotic context. Egyptian Journal of Medical Human Genetics, Jan 2024. URL: https://doi.org/10.1186/s43042-024-00485-7, doi:10.1186/s43042-024-00485-7. This article has 99 citations and is from a peer-reviewed journal.
(zielonka2024mechanismsofresistance pages 1-3): Klaudia Zielonka and Krzysztof Jamroziak. Mechanisms of resistance to venetoclax in hematologic malignancies. Advances in clinical and experimental medicine : official organ Wroclaw Medical University, 33:1421-1433, Mar 2024. URL: https://doi.org/10.17219/acem/181145, doi:10.17219/acem/181145. This article has 13 citations.
(saddam2024emergingbiomarkersand pages 4-6): Md. Saddam, Shamrat Kumar Paul, Mohammad Ahsan Habib, Md. Abrar Fahim, Afsana Mimi, Saiful Islam, Bristi Paul, and Md Mostofa Uddin Helal. Emerging biomarkers and potential therapeutics of the bcl-2 protein family: the apoptotic and anti-apoptotic context. Egyptian Journal of Medical Human Genetics, Jan 2024. URL: https://doi.org/10.1186/s43042-024-00485-7, doi:10.1186/s43042-024-00485-7. This article has 99 citations and is from a peer-reviewed journal.
(saddam2024emergingbiomarkersand pages 9-10): Md. Saddam, Shamrat Kumar Paul, Mohammad Ahsan Habib, Md. Abrar Fahim, Afsana Mimi, Saiful Islam, Bristi Paul, and Md Mostofa Uddin Helal. Emerging biomarkers and potential therapeutics of the bcl-2 protein family: the apoptotic and anti-apoptotic context. Egyptian Journal of Medical Human Genetics, Jan 2024. URL: https://doi.org/10.1186/s43042-024-00485-7, doi:10.1186/s43042-024-00485-7. This article has 99 citations and is from a peer-reviewed journal.
(saddam2024emergingbiomarkersand pages 8-9): Md. Saddam, Shamrat Kumar Paul, Mohammad Ahsan Habib, Md. Abrar Fahim, Afsana Mimi, Saiful Islam, Bristi Paul, and Md Mostofa Uddin Helal. Emerging biomarkers and potential therapeutics of the bcl-2 protein family: the apoptotic and anti-apoptotic context. Egyptian Journal of Medical Human Genetics, Jan 2024. URL: https://doi.org/10.1186/s43042-024-00485-7, doi:10.1186/s43042-024-00485-7. This article has 99 citations and is from a peer-reviewed journal.
(lalier2021tom20mediatedtransferof pages 1-2): Lisenn Lalier, Vincent Mignard, Marie-Pierre Joalland, Didier Lanoé, Pierre-François Cartron, Stéphen Manon, and François M. Vallette. Tom20-mediated transfer of bcl2 from er to mam and mitochondria upon induction of apoptosis. Cell Death & Disease, Feb 2021. URL: https://doi.org/10.1038/s41419-021-03471-8, doi:10.1038/s41419-021-03471-8. This article has 69 citations and is from a peer-reviewed journal.
(lalier2021tom20mediatedtransferof pages 3-5): Lisenn Lalier, Vincent Mignard, Marie-Pierre Joalland, Didier Lanoé, Pierre-François Cartron, Stéphen Manon, and François M. Vallette. Tom20-mediated transfer of bcl2 from er to mam and mitochondria upon induction of apoptosis. Cell Death & Disease, Feb 2021. URL: https://doi.org/10.1038/s41419-021-03471-8, doi:10.1038/s41419-021-03471-8. This article has 69 citations and is from a peer-reviewed journal.
(lalier2021tom20mediatedtransferof pages 8-10): Lisenn Lalier, Vincent Mignard, Marie-Pierre Joalland, Didier Lanoé, Pierre-François Cartron, Stéphen Manon, and François M. Vallette. Tom20-mediated transfer of bcl2 from er to mam and mitochondria upon induction of apoptosis. Cell Death & Disease, Feb 2021. URL: https://doi.org/10.1038/s41419-021-03471-8, doi:10.1038/s41419-021-03471-8. This article has 69 citations and is from a peer-reviewed journal.
(beigl2024bcl2andbok pages 1-2): Tobias B. Beigl, Alexander Paul, Thomas Fellmeth, Dang Nguyen, Lynn Barber, Sandra Weller, Benjamin Schäfer, Bernhard F. Gillissen, Walter E. Aulitzky, Hans-Georg Kopp, Markus Rehm, David W. Andrews, Kristyna Pluhackova, and Frank Essmann. Bcl-2 and bok regulate apoptosis by interaction of their c-terminal transmembrane domains. EMBO Reports, 25:3896-3924, May 2024. URL: https://doi.org/10.1038/s44319-024-00206-6, doi:10.1038/s44319-024-00206-6. This article has 17 citations and is from a highest quality peer-reviewed journal.
(beigl2024bcl2andbok pages 2-3): Tobias B. Beigl, Alexander Paul, Thomas Fellmeth, Dang Nguyen, Lynn Barber, Sandra Weller, Benjamin Schäfer, Bernhard F. Gillissen, Walter E. Aulitzky, Hans-Georg Kopp, Markus Rehm, David W. Andrews, Kristyna Pluhackova, and Frank Essmann. Bcl-2 and bok regulate apoptosis by interaction of their c-terminal transmembrane domains. EMBO Reports, 25:3896-3924, May 2024. URL: https://doi.org/10.1038/s44319-024-00206-6, doi:10.1038/s44319-024-00206-6. This article has 17 citations and is from a highest quality peer-reviewed journal.
(moldoveanu2023apoptoticmitochondrialporation pages 8-10): Tudor Moldoveanu. Apoptotic mitochondrial poration by a growing list of pore‐forming bcl‐2 family proteins. BioEssays, Jan 2023. URL: https://doi.org/10.1002/bies.202200221, doi:10.1002/bies.202200221. This article has 19 citations and is from a peer-reviewed journal.
(li2024bcl2ibasedtherapiesand pages 4-5): Wing Fai Li, Eleftheria Atalla, Jiaxin Dong, and Marina Y Konopleva. Bcl2i-based therapies and emerging resistance in chronic lymphocytic leukemia. Cells, 13:1922, Nov 2024. URL: https://doi.org/10.3390/cells13221922, doi:10.3390/cells13221922. This article has 8 citations.
(li2024bcl2ibasedtherapiesand pages 7-8): Wing Fai Li, Eleftheria Atalla, Jiaxin Dong, and Marina Y Konopleva. Bcl2i-based therapies and emerging resistance in chronic lymphocytic leukemia. Cells, 13:1922, Nov 2024. URL: https://doi.org/10.3390/cells13221922, doi:10.3390/cells13221922. This article has 8 citations.
(nwosu2024venetoclaxtherapyand pages 1-2): Gus O. Nwosu, David M. Ross, Jason A. Powell, and Stuart M. Pitson. Venetoclax therapy and emerging resistance mechanisms in acute myeloid leukaemia. Cell Death & Disease, Jun 2024. URL: https://doi.org/10.1038/s41419-024-06810-7, doi:10.1038/s41419-024-06810-7. This article has 68 citations and is from a peer-reviewed journal.
(scully2023cancercellmembrane media c901409d): Mackenzie A. Scully, Dana E. Wilkins, Megan N. Dang, Elise C. Hoover, Sara B. Aboeleneen, and Emily S. Day. Cancer cell membrane wrapped nanoparticles for the delivery of a bcl-2 inhibitor to triple-negative breast cancer. Molecular pharmaceutics, 20:3895-3913, Jul 2023. URL: https://doi.org/10.1021/acs.molpharmaceut.3c00009, doi:10.1021/acs.molpharmaceut.3c00009. This article has 29 citations and is from a domain leading peer-reviewed journal.
(scully2023cancercellmembrane pages 1-2): Mackenzie A. Scully, Dana E. Wilkins, Megan N. Dang, Elise C. Hoover, Sara B. Aboeleneen, and Emily S. Day. Cancer cell membrane wrapped nanoparticles for the delivery of a bcl-2 inhibitor to triple-negative breast cancer. Molecular pharmaceutics, 20:3895-3913, Jul 2023. URL: https://doi.org/10.1021/acs.molpharmaceut.3c00009, doi:10.1021/acs.molpharmaceut.3c00009. This article has 29 citations and is from a domain leading peer-reviewed journal.
(diamantidis2025factorsaffectingresponse pages 1-2): Michael D. Diamantidis. Factors affecting response and resistance to venetoclax in acute myeloid leukemia. Frontiers in Oncology, Sep 2025. URL: https://doi.org/10.3389/fonc.2025.1577908, doi:10.3389/fonc.2025.1577908. This article has 4 citations.
(saddam2024emergingbiomarkersand pages 1-2): Md. Saddam, Shamrat Kumar Paul, Mohammad Ahsan Habib, Md. Abrar Fahim, Afsana Mimi, Saiful Islam, Bristi Paul, and Md Mostofa Uddin Helal. Emerging biomarkers and potential therapeutics of the bcl-2 protein family: the apoptotic and anti-apoptotic context. Egyptian Journal of Medical Human Genetics, Jan 2024. URL: https://doi.org/10.1186/s43042-024-00485-7, doi:10.1186/s43042-024-00485-7. This article has 99 citations and is from a peer-reviewed journal.
(saddam2024emergingbiomarkersand pages 2-4): Md. Saddam, Shamrat Kumar Paul, Mohammad Ahsan Habib, Md. Abrar Fahim, Afsana Mimi, Saiful Islam, Bristi Paul, and Md Mostofa Uddin Helal. Emerging biomarkers and potential therapeutics of the bcl-2 protein family: the apoptotic and anti-apoptotic context. Egyptian Journal of Medical Human Genetics, Jan 2024. URL: https://doi.org/10.1186/s43042-024-00485-7, doi:10.1186/s43042-024-00485-7. This article has 99 citations and is from a peer-reviewed journal.
(silva2026bcl2andbclxl pages 8-10): João P. N. Silva, Bárbara Pinto, Patrícia M. A. Silva, and Hassan Bousbaa. Bcl-2 and bcl-xl in cancer: regulation, function, and therapeutic targeting. International Journal of Molecular Sciences, 27:1123, Jan 2026. URL: https://doi.org/10.3390/ijms27021123, doi:10.3390/ijms27021123. This article has 4 citations.
(beigl2024broughttolight pages 33-36): Tobias B. Beigl. Brought to light: the bcl-2 transmembrane domain interactome elucidated by a bimolecular split luciferase assay and its impact on apoptosis signalling. Collection, Sep 2024. URL: https://doi.org/10.18419/opus-14911, doi:10.18419/opus-14911. This article has 0 citations.
(beigl2024broughttolight pages 102-107): Tobias B. Beigl. Brought to light: the bcl-2 transmembrane domain interactome elucidated by a bimolecular split luciferase assay and its impact on apoptosis signalling. Collection, Sep 2024. URL: https://doi.org/10.18419/opus-14911, doi:10.18419/opus-14911. This article has 0 citations.
(scully2023cancercellmembrane pages 14-15): Mackenzie A. Scully, Dana E. Wilkins, Megan N. Dang, Elise C. Hoover, Sara B. Aboeleneen, and Emily S. Day. Cancer cell membrane wrapped nanoparticles for the delivery of a bcl-2 inhibitor to triple-negative breast cancer. Molecular pharmaceutics, 20:3895-3913, Jul 2023. URL: https://doi.org/10.1021/acs.molpharmaceut.3c00009, doi:10.1021/acs.molpharmaceut.3c00009. This article has 29 citations and is from a domain leading peer-reviewed journal.
(scully2023cancercellmembrane pages 2-3): Mackenzie A. Scully, Dana E. Wilkins, Megan N. Dang, Elise C. Hoover, Sara B. Aboeleneen, and Emily S. Day. Cancer cell membrane wrapped nanoparticles for the delivery of a bcl-2 inhibitor to triple-negative breast cancer. Molecular pharmaceutics, 20:3895-3913, Jul 2023. URL: https://doi.org/10.1021/acs.molpharmaceut.3c00009, doi:10.1021/acs.molpharmaceut.3c00009. This article has 29 citations and is from a domain leading peer-reviewed journal.
(chatzilygeroudi2025unravelingvenetoclaxresistance pages 4-6): Theodora Chatzilygeroudi, Theodoros Karantanos, and Vasiliki Pappa. Unraveling venetoclax resistance: navigating the future of hma/venetoclax-refractory aml in the molecular era. Cancers, 17:1586, May 2025. URL: https://doi.org/10.3390/cancers17091586, doi:10.3390/cancers17091586. This article has 11 citations.

Citations

saddam2024emergingbiomarkersand pages 9-10
moldoveanu2023apoptoticmitochondrialporation pages 8-10
nwosu2024venetoclaxtherapyand pages 1-2
diamantidis2025factorsaffectingresponse pages 1-2
chatzilygeroudi2025unravelingvenetoclaxresistance pages 4-6
saddam2024emergingbiomarkersand pages 6-8
zielonka2024mechanismsofresistance pages 1-3
saddam2024emergingbiomarkersand pages 4-6
saddam2024emergingbiomarkersand pages 8-9
scully2023cancercellmembrane pages 1-2
saddam2024emergingbiomarkersand pages 1-2
saddam2024emergingbiomarkersand pages 2-4
beigl2024broughttolight pages 33-36
beigl2024broughttolight pages 102-107
scully2023cancercellmembrane pages 14-15
scully2023cancercellmembrane pages 2-3
https://doi.org/10.1038/s44319-024-00206-6
https://doi.org/10.1002/bies.202200221
https://doi.org/10.3390/cells13221922
https://doi.org/10.1038/s41419-024-06810-7
https://doi.org/10.1021/acs.molpharmaceut.3c00009
https://doi.org/10.3389/fonc.2025.1577908
https://doi.org/10.1021/acs.molpharmaceut.3c00009,
https://doi.org/10.1186/s43042-024-00485-7,
https://doi.org/10.17219/acem/181145,
https://doi.org/10.1038/s41419-021-03471-8,
https://doi.org/10.1038/s44319-024-00206-6,
https://doi.org/10.1002/bies.202200221,
https://doi.org/10.3390/cells13221922,
https://doi.org/10.1038/s41419-024-06810-7,
https://doi.org/10.3389/fonc.2025.1577908,
https://doi.org/10.3390/ijms27021123,
https://doi.org/10.18419/opus-14911,
https://doi.org/10.3390/cancers17091586,

Bioreason Rl Review

(Bcl2-bioreason-rl-review.md)

BioReason-Pro RL Review: Bcl2 (mouse)

Source: Bcl2-deep-research-bioreason-rl.md

Correctness: 4/5
Completeness: 3/5

Functional Summary Review

The BioReason functional summary captures the essential anti-apoptotic role:

An anti-apoptotic regulator in mouse that uses a conserved helical bundle to bind and neutralize pro-apoptotic partners. By assembling a BH domain platform that captures BH3-containing ligands, it prevents mitochondrial pathway activation and caspase engagement. The protein operates predominantly in the cytoplasm and on cytoplasmic vesicles as a peripheral membrane factor, where it sequesters apoptotic triggers and tunes the threshold for apoptosis initiation.

This is largely correct. The identification of the BH1-BH4 domain architecture and the mechanism of sequestering pro-apoptotic BH3-only proteins is accurate and aligns with GO:0006915 (apoptotic process) and GO:0043066 (negative regulation of apoptotic process). The description of Bcl2 as preventing mitochondrial outer membrane permeabilization (MOMP) is the established canonical mechanism.

However, there is a notable localization inaccuracy. BioReason describes Bcl2 as operating "predominantly in the cytoplasm and on cytoplasmic vesicles as a peripheral membrane factor." In reality, Bcl2 is primarily an integral membrane protein anchored to the mitochondrial outer membrane, ER membrane, and nuclear envelope via its C-terminal transmembrane domain. The curated review lists GO:0005741 (mitochondrial outer membrane) as a key IBA annotation. Describing it as a "peripheral membrane factor" on "cytoplasmic vesicles" is misleading -- Bcl2 has a bona fide transmembrane anchor, not merely a peripheral association.

The summary also omits Bcl2's roles beyond apoptosis, including regulation of autophagy, calcium homeostasis at the ER, and its emerging roles in cellular metabolism. These are secondary functions but contribute to completeness.

Comparison with interpro2go:

The curated review has one GO_REF:0000002 annotation: GO:0042981 (regulation of apoptotic process). BioReason's functional summary is consistent with this but goes further by specifying the anti-apoptotic direction and the BH3-sequestration mechanism. BioReason does not recapitulate the interpro2go error pattern -- instead it adds mechanistic depth. However, both BioReason and interpro2go miss the transmembrane anchoring, with BioReason actively getting it wrong by calling the protein a "peripheral membrane factor."

Notes on thinking trace

The trace correctly interprets the BH4-BH3-BH1-BH2 domain order and the hydrophobic groove. However, it appears to have missed or ignored the C-terminal transmembrane anchor (not represented in InterPro annotations shown), leading to the peripheral membrane mischaracterization. The reasoning about "vesicle-proximal pool" buffering apoptotic triggers is speculative and not well-supported.

📄 View Raw YAML

id: P10417
gene_symbol: Bcl2
product_type: PROTEIN
status: COMPLETE
taxon:
  id: NCBITaxon:10090
  label: Mus musculus
description: 'Mouse Bcl2 encodes the anti-apoptotic BCL-2 family protein Bcl-2. Bcl2 localizes mainly to mitochondrial outer and endoplasmic reticulum membranes, binds BH-domain BCL-2 family partners such as Bax, Bad, Bak, Bcl2l1, and Beclin-family autophagy regulators, and suppresses apoptosis by controlling mitochondrial membrane permeability and preventing cytochrome c release. Its many immune, renal, neuronal, pigmentation, and developmental annotations are mostly downstream consequences of altered cell survival.'
existing_annotations:
- term:
    id: GO:0043065
    label: positive regulation of apoptotic process
  evidence_type: IBA
  original_reference_id: GO_REF:0000033
  review:
    summary: positive regulation of apoptotic process should not be retained as a direct Bcl2 annotation.
    action: REMOVE
    reason: The term is uninformative, conflicts with Bcl2 anti-apoptotic directionality, or describes an enzymatic/molecular activity not enabled by Bcl2.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 is an anti-apoptotic BCL-2 family regulator of mitochondrial membrane permeability; generic binding, enzymatic, or opposite-direction terms are not informative direct annotations.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports specific anti-apoptotic BCL-2 family activity rather than generic binding, enzymatic, or opposite-direction annotations.
- term:
    id: GO:0097192
    label: extrinsic apoptotic signaling pathway in absence of ligand
  evidence_type: IBA
  original_reference_id: GO_REF:0000033
  review:
    summary: extrinsic apoptotic signaling pathway in absence of ligand has the right biological area but is too generic or has the wrong direction for Bcl2 anti-apoptotic function.
    action: MODIFY
    proposed_replacement_terms:
    - id: GO:2001243
      label: negative regulation of intrinsic apoptotic signaling pathway
    reason: Bcl2 primarily inhibits mitochondrial/intrinsic apoptotic signaling and cytochrome c release. Bcl2 directly controls MOMP at the mitochondrial outer membrane, making it a direct regulator of the intrinsic pathway; the extrinsic pathway annotation does not reflect a direct Bcl2 mechanistic role.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 prevents mitochondrial cytochrome c release and intrinsic apoptosis; directional or generic terms should be replaced with negative regulation or BH3-domain binding terms where possible.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as an inhibitor of mitochondrial apoptotic signaling and cytochrome c release, so directional or generic terms should be replaced by negative-regulation/BH-domain terms.
- term:
    id: GO:0005741
    label: mitochondrial outer membrane
  evidence_type: IBA
  original_reference_id: GO_REF:0000033
  review:
    summary: mitochondrial outer membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0008630
    label: intrinsic apoptotic signaling pathway in response to DNA damage
  evidence_type: IBA
  original_reference_id: GO_REF:0000033
  review:
    summary: Bcl2 inhibits, rather than executes, intrinsic apoptotic signaling in response to DNA damage.
    action: MODIFY
    proposed_replacement_terms:
    - id: GO:2001243
      label: negative regulation of intrinsic apoptotic signaling pathway
    reason: Use a negative-regulation intrinsic apoptotic signaling term without adding unsupported p53-class-mediator specificity.
    supported_by: &id001
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: The primary molecular function of BCL-2 is suppression of intrinsic apoptosis by antagonizing pro-apoptotic BCL-2 family members.
- term:
    id: GO:0015267
    label: channel activity
  evidence_type: IBA
  original_reference_id: GO_REF:0000033
  review:
    summary: channel activity likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0001836
    label: release of cytochrome c from mitochondria
  evidence_type: IBA
  original_reference_id: GO_REF:0000033
  review:
    summary: release of cytochrome c from mitochondria has the right biological area but is too generic or has the wrong direction for Bcl2 anti-apoptotic function.
    action: MODIFY
    proposed_replacement_terms:
    - id: GO:0090201
      label: negative regulation of release of cytochrome c from mitochondria
    reason: Bcl2 primarily inhibits mitochondrial/intrinsic apoptotic signaling and cytochrome c release. Bcl2 directly controls MOMP at the mitochondrial outer membrane, making it a direct regulator of the intrinsic pathway; the extrinsic pathway annotation does not reflect a direct Bcl2 mechanistic role.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 prevents mitochondrial cytochrome c release and intrinsic apoptosis; directional or generic terms should be replaced with negative regulation or BH3-domain binding terms where possible.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as an inhibitor of mitochondrial apoptotic signaling and cytochrome c release, so directional or generic terms should be replaced by negative-regulation/BH-domain terms.
- term:
    id: GO:0055085
    label: transmembrane transport
  evidence_type: IEA
  original_reference_id: GO_REF:0000108
  review:
    summary: transmembrane transport likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0001541
    label: ovarian follicle development
  evidence_type: IEA
  original_reference_id: GO_REF:0000117
  review:
    summary: ovarian follicle development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0002931
    label: response to ischemia
  evidence_type: IEA
  original_reference_id: GO_REF:0000117
  review:
    summary: response to ischemia is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0005737
    label: cytoplasm
  evidence_type: IEA
  original_reference_id: GO_REF:0000120
  review:
    summary: cytoplasm is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0005741
    label: mitochondrial outer membrane
  evidence_type: IEA
  original_reference_id: GO_REF:0000120
  review:
    summary: mitochondrial outer membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0005789
    label: endoplasmic reticulum membrane
  evidence_type: IEA
  original_reference_id: GO_REF:0000120
  review:
    summary: endoplasmic reticulum membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0006914
    label: autophagy
  evidence_type: IEA
  original_reference_id: GO_REF:0000043
  review:
    summary: autophagy likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0006915
    label: apoptotic process
  evidence_type: IEA
  original_reference_id: GO_REF:0000043
  review:
    summary: Broad apoptotic process has the wrong direction for Bcl2, which suppresses apoptosis.
    action: MODIFY
    reason: Replace the positive/broad apoptosis process with negative regulation of apoptotic process, consistent with Bcl2 anti-apoptotic activity.
    supported_by: *id001
    proposed_replacement_terms:
    - id: GO:0043066
      label: negative regulation of apoptotic process
- term:
    id: GO:0008630
    label: intrinsic apoptotic signaling pathway in response to DNA damage
  evidence_type: IEA
  original_reference_id: GO_REF:0000117
  review:
    summary: Bcl2 inhibits, rather than executes, intrinsic apoptotic signaling in response to DNA damage.
    action: MODIFY
    proposed_replacement_terms:
    - id: GO:2001243
      label: negative regulation of intrinsic apoptotic signaling pathway
    reason: Use a negative-regulation intrinsic apoptotic signaling term without adding unsupported p53-class-mediator specificity.
    supported_by: *id001
- term:
    id: GO:0008637
    label: apoptotic mitochondrial changes
  evidence_type: IEA
  original_reference_id: GO_REF:0000117
  review:
    summary: Bcl2 does not execute apoptotic mitochondrial changes; it inhibits mitochondrial outer membrane permeabilization and cytochrome c release.
    action: MODIFY
    reason: Replace the positive apoptotic mitochondrial changes term with the supported negative-regulation term for Bcl2 anti-apoptotic mitochondrial function.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
    proposed_replacement_terms:
    - id: GO:1901029
      label: negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway
- term:
    id: GO:0016020
    label: membrane
  evidence_type: IEA
  original_reference_id: GO_REF:0000120
  review:
    summary: membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0031965
    label: nuclear membrane
  evidence_type: IEA
  original_reference_id: GO_REF:0000120
  review:
    summary: nuclear membrane is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0031966
    label: mitochondrial membrane
  evidence_type: IEA
  original_reference_id: GO_REF:0000117
  review:
    summary: mitochondrial membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0042981
    label: regulation of apoptotic process
  evidence_type: IEA
  original_reference_id: GO_REF:0000002
  review:
    summary: regulation of apoptotic process has the right biological area but is too generic or has the wrong direction for Bcl2 anti-apoptotic function.
    action: MODIFY
    proposed_replacement_terms:
    - id: GO:0043066
      label: negative regulation of apoptotic process
    reason: Bcl2 primarily inhibits mitochondrial/intrinsic apoptotic signaling and cytochrome c release. Bcl2 directly controls MOMP at the mitochondrial outer membrane, making it a direct regulator of the intrinsic pathway; the extrinsic pathway annotation does not reflect a direct Bcl2 mechanistic role.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 prevents mitochondrial cytochrome c release and intrinsic apoptosis; directional or generic terms should be replaced with negative regulation or BH3-domain binding terms where possible.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as an inhibitor of mitochondrial apoptotic signaling and cytochrome c release, so directional or generic terms should be replaced by negative-regulation/BH-domain terms.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: IEA
  original_reference_id: GO_REF:0000120
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0051384
    label: response to glucocorticoid
  evidence_type: IEA
  original_reference_id: GO_REF:0000117
  review:
    summary: response to glucocorticoid is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0071456
    label: cellular response to hypoxia
  evidence_type: IEA
  original_reference_id: GO_REF:0000117
  review:
    summary: cellular response to hypoxia is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0097192
    label: extrinsic apoptotic signaling pathway in absence of ligand
  evidence_type: IEA
  original_reference_id: GO_REF:0000117
  review:
    summary: extrinsic apoptotic signaling pathway in absence of ligand has the right biological area but is too generic or has the wrong direction for Bcl2 anti-apoptotic function.
    action: MODIFY
    proposed_replacement_terms:
    - id: GO:2001243
      label: negative regulation of intrinsic apoptotic signaling pathway
    reason: Bcl2 primarily inhibits mitochondrial/intrinsic apoptotic signaling and cytochrome c release. Bcl2 directly controls MOMP at the mitochondrial outer membrane, making it a direct regulator of the intrinsic pathway; the extrinsic pathway annotation does not reflect a direct Bcl2 mechanistic role.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 prevents mitochondrial cytochrome c release and intrinsic apoptosis; directional or generic terms should be replaced with negative regulation or BH3-domain binding terms where possible.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as an inhibitor of mitochondrial apoptotic signaling and cytochrome c release, so directional or generic terms should be replaced by negative-regulation/BH-domain terms.
- term:
    id: GO:0005515
    label: protein binding
  evidence_type: IPI
  original_reference_id: PMID:16509771
  review:
    summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding.
    action: KEEP_AS_NON_CORE
    reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
- term:
    id: GO:0005515
    label: protein binding
  evidence_type: IPI
  original_reference_id: PMID:16839884
  review:
    summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding.
    action: KEEP_AS_NON_CORE
    reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
- term:
    id: GO:0005515
    label: protein binding
  evidence_type: IPI
  original_reference_id: PMID:20621101
  review:
    summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding.
    action: KEEP_AS_NON_CORE
    reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
- term:
    id: GO:0005515
    label: protein binding
  evidence_type: IPI
  original_reference_id: PMID:20819940
  review:
    summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding.
    action: KEEP_AS_NON_CORE
    reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
- term:
    id: GO:0005515
    label: protein binding
  evidence_type: IPI
  original_reference_id: PMID:21151042
  review:
    summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding.
    action: KEEP_AS_NON_CORE
    reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
- term:
    id: GO:0005515
    label: protein binding
  evidence_type: IPI
  original_reference_id: PMID:22258505
  review:
    summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding.
    action: KEEP_AS_NON_CORE
    reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
- term:
    id: GO:0005515
    label: protein binding
  evidence_type: IPI
  original_reference_id: PMID:29849149
  review:
    summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding.
    action: KEEP_AS_NON_CORE
    reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
- term:
    id: GO:0002020
    label: protease binding
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: protease binding is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0005737
    label: cytoplasm
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: cytoplasm is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0005739
    label: mitochondrion
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: mitochondrion is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0005741
    label: mitochondrial outer membrane
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: mitochondrial outer membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0005783
    label: endoplasmic reticulum
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: endoplasmic reticulum is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0005789
    label: endoplasmic reticulum membrane
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: endoplasmic reticulum membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0006974
    label: DNA damage response
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: DNA damage response is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0008284
    label: positive regulation of cell population proliferation
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: positive regulation of cell population proliferation likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0009410
    label: response to xenobiotic stimulus
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: response to xenobiotic stimulus likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0009636
    label: response to toxic substance
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: response to toxic substance likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0010039
    label: response to iron ion
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: response to iron ion likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0010507
    label: negative regulation of autophagy
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: Bcl2 directly inhibits autophagy by binding the BECN1/beclin-1 autophagy regulatory complex, but this is a non-core function relative to its primary anti-apoptotic role.
    action: KEEP_AS_NON_CORE
    reason: Retain as direct non-core biology because Bcl2 regulates autophagy through BECN1/AMBRA1 interactions, while the core Bcl2 function remains inhibition of mitochondrial apoptosis.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: 'Also acts as an inhibitor of autophagy: interacts with BECN1 and AMBRA1 during non-starvation conditions and inhibits their autophagy function.'
    - reference_id: PMID:22258505
      supporting_text: prevent stimulus-induced disruption of the BCL2-beclin-1 complex and autophagy activation
- term:
    id: GO:0015267
    label: channel activity
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: channel activity likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0016248
    label: channel inhibitor activity
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: channel inhibitor activity is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0030061
    label: mitochondrial crista
  evidence_type: ISO
  original_reference_id: GO_REF:0000096
  review:
    summary: Mitochondrial crista localization is not supported for Bcl2; mitochondrial outer membrane is the supported compartment.
    action: MODIFY
    reason: Bcl2 is annotated and described as a mitochondrial outer membrane/ER membrane anti-apoptotic protein, not a crista protein.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: 'SUBCELLULAR LOCATION: Mitochondrion outer membrane'
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL-2 is found on ER, mitochondria-associated membranes (MAM), and mitochondria/outer mitochondrial membrane.
    proposed_replacement_terms:
    - id: GO:0005741
      label: mitochondrial outer membrane
- term:
    id: GO:0030890
    label: positive regulation of B cell proliferation
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: positive regulation of B cell proliferation likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0031625
    label: ubiquitin protein ligase binding
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: ubiquitin protein ligase binding is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0031965
    label: nuclear membrane
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: nuclear membrane is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0032848
    label: negative regulation of cellular pH reduction
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: negative regulation of cellular pH reduction is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0032991
    label: protein-containing complex
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: protein-containing complex is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0035094
    label: response to nicotine
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: response to nicotine likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0042802
    label: identical protein binding
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: identical protein binding is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0046930
    label: pore complex
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: pore complex likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0046982
    label: protein heterodimerization activity
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: protein heterodimerization activity is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0050853
    label: B cell receptor signaling pathway
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: B cell receptor signaling pathway likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0051434
    label: BH3 domain binding
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: BH3 domain binding is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0051607
    label: defense response to virus
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: defense response to virus likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0060090
    label: molecular adaptor activity
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: molecular adaptor activity is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0140297
    label: DNA-binding transcription factor binding
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: DNA-binding transcription factor binding is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:2000811
    label: negative regulation of anoikis
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: negative regulation of anoikis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:2001234
    label: negative regulation of apoptotic signaling pathway
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: negative regulation of apoptotic signaling pathway is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:2001243
    label: negative regulation of intrinsic apoptotic signaling pathway
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: negative regulation of intrinsic apoptotic signaling pathway is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0002020
    label: protease binding
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: protease binding is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0005634
    label: nucleus
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: nucleus is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0005739
    label: mitochondrion
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: mitochondrion is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0005783
    label: endoplasmic reticulum
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: endoplasmic reticulum is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0006974
    label: DNA damage response
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: DNA damage response is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0008284
    label: positive regulation of cell population proliferation
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: positive regulation of cell population proliferation likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0009636
    label: response to toxic substance
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: response to toxic substance likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0010039
    label: response to iron ion
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: response to iron ion likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0010507
    label: negative regulation of autophagy
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: Bcl2 directly inhibits autophagy by binding the BECN1/beclin-1 autophagy regulatory complex, but this is a non-core function relative to its primary anti-apoptotic role.
    action: KEEP_AS_NON_CORE
    reason: Retain as direct non-core biology because Bcl2 regulates autophagy through BECN1/AMBRA1 interactions, while the core Bcl2 function remains inhibition of mitochondrial apoptosis.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: 'Also acts as an inhibitor of autophagy: interacts with BECN1 and AMBRA1 during non-starvation conditions and inhibits their autophagy function.'
    - reference_id: PMID:22258505
      supporting_text: prevent stimulus-induced disruption of the BCL2-beclin-1 complex and autophagy activation
- term:
    id: GO:0015267
    label: channel activity
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: channel activity likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0016248
    label: channel inhibitor activity
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: channel inhibitor activity is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0030890
    label: positive regulation of B cell proliferation
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: positive regulation of B cell proliferation likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0031625
    label: ubiquitin protein ligase binding
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: ubiquitin protein ligase binding is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0032848
    label: negative regulation of cellular pH reduction
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: negative regulation of cellular pH reduction is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0032991
    label: protein-containing complex
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: protein-containing complex is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0035094
    label: response to nicotine
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: response to nicotine likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0042802
    label: identical protein binding
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: identical protein binding is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0043565
    label: sequence-specific DNA binding
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: sequence-specific DNA binding should not be retained as a direct Bcl2 annotation.
    action: REMOVE
    reason: The term is uninformative, conflicts with Bcl2 anti-apoptotic directionality, or describes an enzymatic/molecular activity not enabled by Bcl2.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 is an anti-apoptotic BCL-2 family regulator of mitochondrial membrane permeability; generic binding, enzymatic, or opposite-direction terms are not informative direct annotations.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports specific anti-apoptotic BCL-2 family activity rather than generic binding, enzymatic, or opposite-direction annotations.
- term:
    id: GO:0046930
    label: pore complex
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: pore complex likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0046982
    label: protein heterodimerization activity
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: protein heterodimerization activity is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0050853
    label: B cell receptor signaling pathway
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: B cell receptor signaling pathway likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0051434
    label: BH3 domain binding
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: BH3 domain binding is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0051607
    label: defense response to virus
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: defense response to virus likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0140297
    label: DNA-binding transcription factor binding
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: DNA-binding transcription factor binding is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:2000811
    label: negative regulation of anoikis
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: negative regulation of anoikis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:2001234
    label: negative regulation of apoptotic signaling pathway
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: negative regulation of apoptotic signaling pathway is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:2001243
    label: negative regulation of intrinsic apoptotic signaling pathway
  evidence_type: IEA
  original_reference_id: GO_REF:0000107
  review:
    summary: negative regulation of intrinsic apoptotic signaling pathway is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0097138
    label: BAD-BCL-2 complex
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: BAD-BCL-2 complex is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0097148
    label: BCL-2 complex
  evidence_type: ISO
  original_reference_id: GO_REF:0000119
  review:
    summary: BCL-2 complex is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0005737
    label: cytoplasm
  evidence_type: ISO
  original_reference_id: GO_REF:0000096
  review:
    summary: cytoplasm is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0005739
    label: mitochondrion
  evidence_type: ISO
  original_reference_id: GO_REF:0000096
  review:
    summary: mitochondrion is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0010667
    label: negative regulation of cardiac muscle cell apoptotic process
  evidence_type: ISO
  original_reference_id: GO_REF:0000096
  review:
    summary: negative regulation of cardiac muscle cell apoptotic process is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: ISO
  original_reference_id: GO_REF:0000096
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0044877
    label: protein-containing complex binding
  evidence_type: ISO
  original_reference_id: GO_REF:0000096
  review:
    summary: protein-containing complex binding is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0045471
    label: response to ethanol
  evidence_type: ISO
  original_reference_id: GO_REF:0000096
  review:
    summary: response to ethanol is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0048471
    label: perinuclear region of cytoplasm
  evidence_type: ISO
  original_reference_id: GO_REF:0000096
  review:
    summary: perinuclear region of cytoplasm is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0051400
    label: BH domain binding
  evidence_type: ISO
  original_reference_id: GO_REF:0000096
  review:
    summary: BH domain binding is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0000902
    label: cell morphogenesis
  evidence_type: IDA
  original_reference_id: PMID:18548006
  review:
    summary: cell morphogenesis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0005737
    label: cytoplasm
  evidence_type: IDA
  original_reference_id: PMID:36812915
  review:
    summary: cytoplasm is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0010507
    label: negative regulation of autophagy
  evidence_type: IDA
  original_reference_id: PMID:36812915
  review:
    summary: Bcl2 directly inhibits autophagy by binding the BECN1/beclin-1 autophagy regulatory complex, but this is a non-core function relative to its primary anti-apoptotic role.
    action: KEEP_AS_NON_CORE
    reason: Retain as direct non-core biology because Bcl2 regulates autophagy through BECN1/AMBRA1 interactions, while the core Bcl2 function remains inhibition of mitochondrial apoptosis.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: 'Also acts as an inhibitor of autophagy: interacts with BECN1 and AMBRA1 during non-starvation conditions and inhibits their autophagy function.'
    - reference_id: PMID:22258505
      supporting_text: prevent stimulus-induced disruption of the BCL2-beclin-1 complex and autophagy activation
- term:
    id: GO:0060090
    label: molecular adaptor activity
  evidence_type: IDA
  original_reference_id: PMID:36812915
  review:
    summary: molecular adaptor activity is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0009791
    label: post-embryonic development
  evidence_type: TAS
  original_reference_id: PMID:10674380
  review:
    summary: post-embryonic development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0048087
    label: positive regulation of developmental pigmentation
  evidence_type: TAS
  original_reference_id: PMID:10674380
  review:
    summary: positive regulation of developmental pigmentation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0005737
    label: cytoplasm
  evidence_type: IDA
  original_reference_id: PMID:29020630
  review:
    summary: cytoplasm is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0005741
    label: mitochondrial outer membrane
  evidence_type: ISS
  original_reference_id: GO_REF:0000024
  review:
    summary: mitochondrial outer membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0005789
    label: endoplasmic reticulum membrane
  evidence_type: ISS
  original_reference_id: GO_REF:0000024
  review:
    summary: endoplasmic reticulum membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0010507
    label: negative regulation of autophagy
  evidence_type: ISS
  original_reference_id: GO_REF:0000024
  review:
    summary: Bcl2 directly inhibits autophagy by binding the BECN1/beclin-1 autophagy regulatory complex, but this is a non-core function relative to its primary anti-apoptotic role.
    action: KEEP_AS_NON_CORE
    reason: Retain as direct non-core biology because Bcl2 regulates autophagy through BECN1/AMBRA1 interactions, while the core Bcl2 function remains inhibition of mitochondrial apoptosis.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: 'Also acts as an inhibitor of autophagy: interacts with BECN1 and AMBRA1 during non-starvation conditions and inhibits their autophagy function.'
    - reference_id: PMID:22258505
      supporting_text: prevent stimulus-induced disruption of the BCL2-beclin-1 complex and autophagy activation
- term:
    id: GO:0048873
    label: homeostasis of number of cells within a tissue
  evidence_type: IMP
  original_reference_id: PMID:9241272
  review:
    summary: homeostasis of number of cells within a tissue is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0005515
    label: protein binding
  evidence_type: IPI
  original_reference_id: PMID:10582606
  review:
    summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding.
    action: KEEP_AS_NON_CORE
    reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
- term:
    id: GO:0005515
    label: protein binding
  evidence_type: IPI
  original_reference_id: PMID:11226327
  review:
    summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding.
    action: KEEP_AS_NON_CORE
    reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
- term:
    id: GO:0005515
    label: protein binding
  evidence_type: IPI
  original_reference_id: PMID:7834748
  review:
    summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding.
    action: KEEP_AS_NON_CORE
    reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
- term:
    id: GO:0005515
    label: protein binding
  evidence_type: IPI
  original_reference_id: PMID:8918887
  review:
    summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding.
    action: KEEP_AS_NON_CORE
    reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
- term:
    id: GO:0040008
    label: regulation of growth
  evidence_type: IMP
  original_reference_id: PMID:7812968
  review:
    summary: regulation of growth is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0040008
    label: regulation of growth
  evidence_type: IMP
  original_reference_id: PMID:8170972
  review:
    summary: regulation of growth is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0005515
    label: protein binding
  evidence_type: IPI
  original_reference_id: PMID:15983387
  review:
    summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding.
    action: KEEP_AS_NON_CORE
    reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
- term:
    id: GO:0008630
    label: intrinsic apoptotic signaling pathway in response to DNA damage
  evidence_type: IGI
  original_reference_id: PMID:15983387
  review:
    summary: Bcl2 inhibits, rather than executes, intrinsic apoptotic signaling in response to DNA damage.
    action: MODIFY
    proposed_replacement_terms:
    - id: GO:2001243
      label: negative regulation of intrinsic apoptotic signaling pathway
    reason: Use a negative-regulation intrinsic apoptotic signaling term without adding unsupported p53-class-mediator specificity.
    supported_by: *id001
- term:
    id: GO:0008284
    label: positive regulation of cell population proliferation
  evidence_type: IMP
  original_reference_id: PMID:8084613
  review:
    summary: positive regulation of cell population proliferation likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0030217
    label: T cell differentiation
  evidence_type: IGI
  original_reference_id: PMID:9215624
  review:
    summary: T cell differentiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0098609
    label: cell-cell adhesion
  evidence_type: IMP
  original_reference_id: PMID:15292044
  review:
    summary: cell-cell adhesion is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0005515
    label: protein binding
  evidence_type: IPI
  original_reference_id: PMID:23629966
  review:
    summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding.
    action: KEEP_AS_NON_CORE
    reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
- term:
    id: GO:0042981
    label: regulation of apoptotic process
  evidence_type: IGI
  original_reference_id: PMID:8918887
  review:
    summary: regulation of apoptotic process has the right biological area but is too generic or has the wrong direction for Bcl2 anti-apoptotic function.
    action: MODIFY
    proposed_replacement_terms:
    - id: GO:0043066
      label: negative regulation of apoptotic process
    reason: Bcl2 primarily inhibits mitochondrial/intrinsic apoptotic signaling and cytochrome c release. Bcl2 directly controls MOMP at the mitochondrial outer membrane, making it a direct regulator of the intrinsic pathway; the extrinsic pathway annotation does not reflect a direct Bcl2 mechanistic role.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 prevents mitochondrial cytochrome c release and intrinsic apoptosis; directional or generic terms should be replaced with negative regulation or BH3-domain binding terms where possible.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as an inhibitor of mitochondrial apoptotic signaling and cytochrome c release, so directional or generic terms should be replaced by negative-regulation/BH-domain terms.
- term:
    id: GO:0005515
    label: protein binding
  evidence_type: IPI
  original_reference_id: PMID:26949185
  review:
    summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding.
    action: KEEP_AS_NON_CORE
    reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
- term:
    id: GO:0005515
    label: protein binding
  evidence_type: IPI
  original_reference_id: PMID:17475835
  review:
    summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding.
    action: KEEP_AS_NON_CORE
    reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
- term:
    id: GO:0006915
    label: apoptotic process
  evidence_type: ISO
  original_reference_id: PMID:8022822
  review:
    summary: Broad apoptotic process has the wrong direction for Bcl2, which suppresses apoptosis.
    action: MODIFY
    reason: Replace the positive/broad apoptosis process with negative regulation of apoptotic process, consistent with Bcl2 anti-apoptotic activity.
    supported_by: *id001
    proposed_replacement_terms:
    - id: GO:0043066
      label: negative regulation of apoptotic process
- term:
    id: GO:0006915
    label: apoptotic process
  evidence_type: IMP
  original_reference_id: PMID:8170972
  review:
    summary: Broad apoptotic process has the wrong direction for Bcl2, which suppresses apoptosis.
    action: MODIFY
    reason: Replace the positive/broad apoptosis process with negative regulation of apoptotic process, consistent with Bcl2 anti-apoptotic activity.
    supported_by: *id001
    proposed_replacement_terms:
    - id: GO:0043066
      label: negative regulation of apoptotic process
- term:
    id: GO:0006915
    label: apoptotic process
  evidence_type: IMP
  original_reference_id: PMID:8372353
  review:
    summary: Broad apoptotic process has the wrong direction for Bcl2, which suppresses apoptosis.
    action: MODIFY
    reason: Replace the positive/broad apoptosis process with negative regulation of apoptotic process, consistent with Bcl2 anti-apoptotic activity.
    supported_by: *id001
    proposed_replacement_terms:
    - id: GO:0043066
      label: negative regulation of apoptotic process
- term:
    id: GO:0006915
    label: apoptotic process
  evidence_type: ISO
  original_reference_id: PMID:8949945
  review:
    summary: Broad apoptotic process has the wrong direction for Bcl2, which suppresses apoptosis.
    action: MODIFY
    reason: Replace the positive/broad apoptosis process with negative regulation of apoptotic process, consistent with Bcl2 anti-apoptotic activity.
    supported_by: *id001
    proposed_replacement_terms:
    - id: GO:0043066
      label: negative regulation of apoptotic process
- term:
    id: GO:0042149
    label: cellular response to glucose starvation
  evidence_type: IDA
  original_reference_id: PMID:7595537
  review:
    summary: cellular response to glucose starvation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0071456
    label: cellular response to hypoxia
  evidence_type: IDA
  original_reference_id: PMID:7595537
  review:
    summary: cellular response to hypoxia is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0005515
    label: protein binding
  evidence_type: IPI
  original_reference_id: PMID:11546872
  review:
    summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding.
    action: KEEP_AS_NON_CORE
    reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
- term:
    id: GO:2001234
    label: negative regulation of apoptotic signaling pathway
  evidence_type: IDA
  original_reference_id: PMID:11546872
  review:
    summary: negative regulation of apoptotic signaling pathway is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:2001240
    label: negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
  evidence_type: ISO
  original_reference_id: GO_REF:0000008
  review:
    summary: negative regulation of extrinsic apoptotic signaling pathway in absence of ligand is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0008637
    label: apoptotic mitochondrial changes
  evidence_type: IDA
  original_reference_id: PMID:14707049
  review:
    summary: Bcl2 does not execute apoptotic mitochondrial changes; it inhibits mitochondrial outer membrane permeabilization and cytochrome c release.
    action: MODIFY
    reason: Replace the positive apoptotic mitochondrial changes term with the supported negative-regulation term for Bcl2 anti-apoptotic mitochondrial function.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
    proposed_replacement_terms:
    - id: GO:1901029
      label: negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway
- term:
    id: GO:0008631
    label: intrinsic apoptotic signaling pathway in response to oxidative stress
  evidence_type: IMP
  original_reference_id: PMID:12855558
  review:
    summary: intrinsic apoptotic signaling pathway in response to oxidative stress is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0002931
    label: response to ischemia
  evidence_type: IMP
  original_reference_id: PMID:10488913
  review:
    summary: response to ischemia is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0005515
    label: protein binding
  evidence_type: IPI
  original_reference_id: PMID:12082633
  review:
    summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding.
    action: KEEP_AS_NON_CORE
    reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
- term:
    id: GO:0097192
    label: extrinsic apoptotic signaling pathway in absence of ligand
  evidence_type: IGI
  original_reference_id: PMID:12082633
  review:
    summary: extrinsic apoptotic signaling pathway in absence of ligand has the right biological area but is too generic or has the wrong direction for Bcl2 anti-apoptotic function.
    action: MODIFY
    proposed_replacement_terms:
    - id: GO:2001243
      label: negative regulation of intrinsic apoptotic signaling pathway
    reason: Bcl2 primarily inhibits mitochondrial/intrinsic apoptotic signaling and cytochrome c release. Bcl2 directly controls MOMP at the mitochondrial outer membrane, making it a direct regulator of the intrinsic pathway; the extrinsic pathway annotation does not reflect a direct Bcl2 mechanistic role.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 prevents mitochondrial cytochrome c release and intrinsic apoptosis; directional or generic terms should be replaced with negative regulation or BH3-domain binding terms where possible.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as an inhibitor of mitochondrial apoptotic signaling and cytochrome c release, so directional or generic terms should be replaced by negative-regulation/BH-domain terms.
- term:
    id: GO:0008625
    label: extrinsic apoptotic signaling pathway via death domain receptors
  evidence_type: ISO
  original_reference_id: PMID:10597216
  review:
    summary: extrinsic apoptotic signaling pathway via death domain receptors is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:2000134
    label: negative regulation of G1/S transition of mitotic cell cycle
  evidence_type: IMP
  original_reference_id: PMID:12855558
  review:
    summary: negative regulation of G1/S transition of mitotic cell cycle is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:2000134
    label: negative regulation of G1/S transition of mitotic cell cycle
  evidence_type: IDA
  original_reference_id: PMID:14660795
  review:
    summary: negative regulation of G1/S transition of mitotic cell cycle is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:2000134
    label: negative regulation of G1/S transition of mitotic cell cycle
  evidence_type: IMP
  original_reference_id: PMID:14660795
  review:
    summary: negative regulation of G1/S transition of mitotic cell cycle is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0010506
    label: regulation of autophagy
  evidence_type: IMP
  original_reference_id: PMID:22258505
  review:
    summary: PMID:22258505 supports Bcl2 as a negative regulator of stimulus-induced autophagy through the BCL2-beclin-1 complex.
    action: MODIFY
    reason: Use the more specific term negative regulation of autophagy, which captures the direction of Bcl2 action in the BCL2-beclin-1 complex.
    proposed_replacement_terms:
    - id: GO:0010507
      label: negative regulation of autophagy
    supported_by:
    - reference_id: PMID:22258505
      supporting_text: prevent stimulus-induced disruption of the BCL2-beclin-1 complex and autophagy activation
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: 'GO; GO:0010507; P:negative regulation of autophagy; IDA:UniProt.'
- term:
    id: GO:0016020
    label: membrane
  evidence_type: IDA
  original_reference_id: PMID:8030757
  review:
    summary: membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: IDA
  original_reference_id: PMID:9560217
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0005515
    label: protein binding
  evidence_type: IPI
  original_reference_id: PMID:18223655
  review:
    summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding.
    action: KEEP_AS_NON_CORE
    reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
- term:
    id: GO:0072593
    label: reactive oxygen species metabolic process
  evidence_type: IMP
  original_reference_id: PMID:10726970
  review:
    summary: reactive oxygen species metabolic process is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0072593
    label: reactive oxygen species metabolic process
  evidence_type: IMP
  original_reference_id: PMID:12855558
  review:
    summary: reactive oxygen species metabolic process is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0072593
    label: reactive oxygen species metabolic process
  evidence_type: IMP
  original_reference_id: PMID:9681465
  review:
    summary: reactive oxygen species metabolic process is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0001657
    label: ureteric bud development
  evidence_type: IMP
  original_reference_id: PMID:8623928
  review:
    summary: ureteric bud development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0019903
    label: protein phosphatase binding
  evidence_type: IDA
  original_reference_id: PMID:12617961
  review:
    summary: protein phosphatase binding is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0051721
    label: protein phosphatase 2A binding
  evidence_type: IDA
  original_reference_id: PMID:16717086
  review:
    summary: protein phosphatase 2A binding is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0005515
    label: protein binding
  evidence_type: IPI
  original_reference_id: PMID:15613488
  review:
    summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding.
    action: KEEP_AS_NON_CORE
    reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
- term:
    id: GO:0030307
    label: positive regulation of cell growth
  evidence_type: ISO
  original_reference_id: PMID:8022822
  review:
    summary: positive regulation of cell growth likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0000209
    label: protein polyubiquitination
  evidence_type: ISO
  original_reference_id: PMID:16717086
  review:
    summary: protein polyubiquitination likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0005737
    label: cytoplasm
  evidence_type: ISO
  original_reference_id: PMID:7546744
  review:
    summary: cytoplasm is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0016020
    label: membrane
  evidence_type: ISO
  original_reference_id: PMID:7896880
  review:
    summary: membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0005739
    label: mitochondrion
  evidence_type: HDA
  original_reference_id: PMID:18614015
  review:
    summary: mitochondrion is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0005634
    label: nucleus
  evidence_type: ISO
  original_reference_id: PMID:7546744
  review:
    summary: nucleus is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0005634
    label: nucleus
  evidence_type: ISO
  original_reference_id: PMID:7896880
  review:
    summary: nucleus is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0005739
    label: mitochondrion
  evidence_type: ISO
  original_reference_id: PMID:7896880
  review:
    summary: mitochondrion is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0009410
    label: response to xenobiotic stimulus
  evidence_type: ISO
  original_reference_id: PMID:8949945
  review:
    summary: response to xenobiotic stimulus likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0009636
    label: response to toxic substance
  evidence_type: ISO
  original_reference_id: PMID:16717086
  review:
    summary: response to toxic substance likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0034097
    label: response to cytokine
  evidence_type: ISO
  original_reference_id: PMID:9184696
  review:
    summary: response to cytokine is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0042100
    label: B cell proliferation
  evidence_type: ISO
  original_reference_id: PMID:1373874
  review:
    summary: B cell proliferation likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: ISO
  original_reference_id: PMID:1373874
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: ISO
  original_reference_id: PMID:7650367
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: ISO
  original_reference_id: PMID:7772249
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: ISO
  original_reference_id: PMID:8050499
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: ISO
  original_reference_id: PMID:8080725
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0043524
    label: negative regulation of neuron apoptotic process
  evidence_type: ISO
  original_reference_id: PMID:7546744
  review:
    summary: negative regulation of neuron apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0051924
    label: regulation of calcium ion transport
  evidence_type: ISO
  original_reference_id: PMID:8022822
  review:
    summary: regulation of calcium ion transport is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: ISS
  original_reference_id: PMID:15776018
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0070059
    label: intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
  evidence_type: ISS
  original_reference_id: PMID:15776018
  review:
    summary: Bcl2 is supported as an inhibitor, not an activator, of ER-stress intrinsic apoptotic signaling.
    action: MODIFY
    reason: Replace the positive pathway term with negative regulation of ER-stress-induced intrinsic apoptotic signaling, matching Bcl2 anti-apoptotic biology.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
    proposed_replacement_terms:
    - id: GO:1902236
      label: negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
- term:
    id: GO:0005789
    label: endoplasmic reticulum membrane
  evidence_type: IDA
  original_reference_id: PMID:15613488
  review:
    summary: endoplasmic reticulum membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0010523
    label: negative regulation of calcium ion transport into cytosol
  evidence_type: IGI
  original_reference_id: PMID:15613488
  review:
    summary: negative regulation of calcium ion transport into cytosol is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0032469
    label: endoplasmic reticulum calcium ion homeostasis
  evidence_type: IGI
  original_reference_id: PMID:15613488
  review:
    summary: endoplasmic reticulum calcium ion homeostasis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0033138
    label: positive regulation of peptidyl-serine phosphorylation
  evidence_type: IGI
  original_reference_id: PMID:15613488
  review:
    summary: positive regulation of peptidyl-serine phosphorylation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0005515
    label: protein binding
  evidence_type: IPI
  original_reference_id: PMID:16717086
  review:
    summary: Protein binding is supported for this Bcl2 interactor evidence but is too generic to treat as a core molecular function or blanket BH3-domain binding.
    action: KEEP_AS_NON_CORE
    reason: Retain the interaction evidence as non-core unless a specific supported interactor-binding term is available; not all cited interactors are BH3-domain proteins.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
- term:
    id: GO:0001658
    label: branching involved in ureteric bud morphogenesis
  evidence_type: IGI
  original_reference_id: PMID:16672320
  review:
    summary: branching involved in ureteric bud morphogenesis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0001822
    label: kidney development
  evidence_type: IMP
  original_reference_id: PMID:15818405
  review:
    summary: kidney development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0001822
    label: kidney development
  evidence_type: IGI
  original_reference_id: PMID:16672320
  review:
    summary: kidney development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0002260
    label: lymphocyte homeostasis
  evidence_type: IGI
  original_reference_id: PMID:15818405
  review:
    summary: lymphocyte homeostasis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0042981
    label: regulation of apoptotic process
  evidence_type: IGI
  original_reference_id: PMID:15818405
  review:
    summary: regulation of apoptotic process has the right biological area but is too generic or has the wrong direction for Bcl2 anti-apoptotic function.
    action: MODIFY
    proposed_replacement_terms:
    - id: GO:0043066
      label: negative regulation of apoptotic process
    reason: Bcl2 primarily inhibits mitochondrial/intrinsic apoptotic signaling and cytochrome c release. Bcl2 directly controls MOMP at the mitochondrial outer membrane, making it a direct regulator of the intrinsic pathway; the extrinsic pathway annotation does not reflect a direct Bcl2 mechanistic role.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 prevents mitochondrial cytochrome c release and intrinsic apoptosis; directional or generic terms should be replaced with negative regulation or BH3-domain binding terms where possible.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as an inhibitor of mitochondrial apoptotic signaling and cytochrome c release, so directional or generic terms should be replaced by negative-regulation/BH-domain terms.
- term:
    id: GO:0043067
    label: regulation of programmed cell death
  evidence_type: IGI
  original_reference_id: PMID:16672320
  review:
    summary: regulation of programmed cell death is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0048070
    label: regulation of developmental pigmentation
  evidence_type: IGI
  original_reference_id: PMID:15818405
  review:
    summary: regulation of developmental pigmentation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0048536
    label: spleen development
  evidence_type: IMP
  original_reference_id: PMID:15818405
  review:
    summary: spleen development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0048536
    label: spleen development
  evidence_type: IGI
  original_reference_id: PMID:15818405
  review:
    summary: spleen development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0048538
    label: thymus development
  evidence_type: IMP
  original_reference_id: PMID:15818405
  review:
    summary: thymus development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0048538
    label: thymus development
  evidence_type: IGI
  original_reference_id: PMID:15818405
  review:
    summary: thymus development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0048589
    label: developmental growth
  evidence_type: IMP
  original_reference_id: PMID:15818405
  review:
    summary: developmental growth is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0001662
    label: behavioral fear response
  evidence_type: IMP
  original_reference_id: PMID:16095731
  review:
    summary: behavioral fear response is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0001822
    label: kidney development
  evidence_type: IMP
  original_reference_id: PMID:16282979
  review:
    summary: kidney development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0006470
    label: protein dephosphorylation
  evidence_type: IDA
  original_reference_id: PMID:16717086
  review:
    summary: protein dephosphorylation should not be retained as a direct Bcl2 annotation.
    action: REMOVE
    reason: The term is uninformative, conflicts with Bcl2 anti-apoptotic directionality, or describes an enzymatic/molecular activity not enabled by Bcl2.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 is an anti-apoptotic BCL-2 family regulator of mitochondrial membrane permeability; generic binding, enzymatic, or opposite-direction terms are not informative direct annotations.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports specific anti-apoptotic BCL-2 family activity rather than generic binding, enzymatic, or opposite-direction annotations.
- term:
    id: GO:0010332
    label: response to gamma radiation
  evidence_type: IMP
  original_reference_id: PMID:10815637
  review:
    summary: response to gamma radiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0010332
    label: response to gamma radiation
  evidence_type: IMP
  original_reference_id: PMID:17068116
  review:
    summary: response to gamma radiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0010332
    label: response to gamma radiation
  evidence_type: IMP
  original_reference_id: PMID:8170972
  review:
    summary: response to gamma radiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0014911
    label: positive regulation of smooth muscle cell migration
  evidence_type: IMP
  original_reference_id: PMID:17382917
  review:
    summary: positive regulation of smooth muscle cell migration is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0043029
    label: T cell homeostasis
  evidence_type: IGI
  original_reference_id: PMID:17591857
  review:
    summary: T cell homeostasis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: IMP
  original_reference_id: PMID:17068116
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: IDA
  original_reference_id: PMID:17267035
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: IMP
  original_reference_id: PMID:9681465
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0043085
    label: positive regulation of catalytic activity
  evidence_type: IMP
  original_reference_id: PMID:17382917
  review:
    summary: positive regulation of catalytic activity should not be retained as a direct Bcl2 annotation.
    action: REMOVE
    reason: The term is uninformative, conflicts with Bcl2 anti-apoptotic directionality, or describes an enzymatic/molecular activity not enabled by Bcl2.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 is an anti-apoptotic BCL-2 family regulator of mitochondrial membrane permeability; generic binding, enzymatic, or opposite-direction terms are not informative direct annotations.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports specific anti-apoptotic BCL-2 family activity rather than generic binding, enzymatic, or opposite-direction annotations.
- term:
    id: GO:0043524
    label: negative regulation of neuron apoptotic process
  evidence_type: IMP
  original_reference_id: PMID:9681465
  review:
    summary: negative regulation of neuron apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0045636
    label: positive regulation of melanocyte differentiation
  evidence_type: IMP
  original_reference_id: PMID:16427619
  review:
    summary: positive regulation of melanocyte differentiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0048873
    label: homeostasis of number of cells within a tissue
  evidence_type: IMP
  original_reference_id: PMID:16427619
  review:
    summary: homeostasis of number of cells within a tissue is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0050790
    label: regulation of catalytic activity
  evidence_type: IMP
  original_reference_id: PMID:9681465
  review:
    summary: regulation of catalytic activity is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0051402
    label: neuron apoptotic process
  evidence_type: IMP
  original_reference_id: PMID:7546744
  review:
    summary: The neuron apoptosis evidence supports Bcl2-dependent neuronal survival, not execution of neuron apoptotic process.
    action: MODIFY
    reason: Replace with GO:0043524 negative regulation of neuron apoptotic process to reflect Bcl2 anti-apoptotic function in neurons.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
    proposed_replacement_terms:
    - id: GO:0043524
      label: negative regulation of neuron apoptotic process
- term:
    id: GO:0001952
    label: regulation of cell-matrix adhesion
  evidence_type: IMP
  original_reference_id: PMID:15292044
  review:
    summary: regulation of cell-matrix adhesion is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0010468
    label: regulation of gene expression
  evidence_type: IMP
  original_reference_id: PMID:15292044
  review:
    summary: regulation of gene expression is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0010559
    label: regulation of glycoprotein biosynthetic process
  evidence_type: IMP
  original_reference_id: PMID:15292044
  review:
    summary: regulation of glycoprotein biosynthetic process is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0030336
    label: negative regulation of cell migration
  evidence_type: IMP
  original_reference_id: PMID:15292044
  review:
    summary: negative regulation of cell migration is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0048041
    label: focal adhesion assembly
  evidence_type: IMP
  original_reference_id: PMID:15292044
  review:
    summary: focal adhesion assembly is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0018105
    label: peptidyl-serine phosphorylation
  evidence_type: IDA
  original_reference_id: PMID:14660795
  review:
    summary: peptidyl-serine phosphorylation should not be retained as a direct Bcl2 annotation.
    action: REMOVE
    reason: The term is uninformative, conflicts with Bcl2 anti-apoptotic directionality, or describes an enzymatic/molecular activity not enabled by Bcl2.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 is an anti-apoptotic BCL-2 family regulator of mitochondrial membrane permeability; generic binding, enzymatic, or opposite-direction terms are not informative direct annotations.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports specific anti-apoptotic BCL-2 family activity rather than generic binding, enzymatic, or opposite-direction annotations.
- term:
    id: GO:0018107
    label: peptidyl-threonine phosphorylation
  evidence_type: IDA
  original_reference_id: PMID:14660795
  review:
    summary: peptidyl-threonine phosphorylation should not be retained as a direct Bcl2 annotation.
    action: REMOVE
    reason: The term is uninformative, conflicts with Bcl2 anti-apoptotic directionality, or describes an enzymatic/molecular activity not enabled by Bcl2.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 is an anti-apoptotic BCL-2 family regulator of mitochondrial membrane permeability; generic binding, enzymatic, or opposite-direction terms are not informative direct annotations.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports specific anti-apoptotic BCL-2 family activity rather than generic binding, enzymatic, or opposite-direction annotations.
- term:
    id: GO:0031647
    label: regulation of protein stability
  evidence_type: IMP
  original_reference_id: PMID:14660795
  review:
    summary: regulation of protein stability is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: IDA
  original_reference_id: PMID:14660795
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: IMP
  original_reference_id: PMID:14660795
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0001658
    label: branching involved in ureteric bud morphogenesis
  evidence_type: IDA
  original_reference_id: PMID:14699151
  review:
    summary: branching involved in ureteric bud morphogenesis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0006979
    label: response to oxidative stress
  evidence_type: IMP
  original_reference_id: PMID:12855558
  review:
    summary: response to oxidative stress is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0010468
    label: regulation of gene expression
  evidence_type: IMP
  original_reference_id: PMID:12855558
  review:
    summary: regulation of gene expression is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0030308
    label: negative regulation of cell growth
  evidence_type: IMP
  original_reference_id: PMID:12855558
  review:
    summary: negative regulation of cell growth is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0034097
    label: response to cytokine
  evidence_type: IMP
  original_reference_id: PMID:12855558
  review:
    summary: response to cytokine is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0042542
    label: response to hydrogen peroxide
  evidence_type: IMP
  original_reference_id: PMID:12855558
  review:
    summary: response to hydrogen peroxide is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0001782
    label: B cell homeostasis
  evidence_type: IMP
  original_reference_id: PMID:7650488
  review:
    summary: B cell homeostasis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0001782
    label: B cell homeostasis
  evidence_type: IMP
  original_reference_id: PMID:8170972
  review:
    summary: B cell homeostasis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0002260
    label: lymphocyte homeostasis
  evidence_type: IMP
  original_reference_id: PMID:8170972
  review:
    summary: lymphocyte homeostasis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0009791
    label: post-embryonic development
  evidence_type: IMP
  original_reference_id: PMID:8170972
  review:
    summary: post-embryonic development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0009887
    label: animal organ morphogenesis
  evidence_type: IMP
  original_reference_id: PMID:8170972
  review:
    summary: animal organ morphogenesis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0030183
    label: B cell differentiation
  evidence_type: IMP
  original_reference_id: PMID:8170972
  review:
    summary: B cell differentiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0030217
    label: T cell differentiation
  evidence_type: IMP
  original_reference_id: PMID:8170972
  review:
    summary: T cell differentiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0030318
    label: melanocyte differentiation
  evidence_type: IMP
  original_reference_id: PMID:12086670
  review:
    summary: melanocyte differentiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0030318
    label: melanocyte differentiation
  evidence_type: IGI
  original_reference_id: PMID:12086670
  review:
    summary: melanocyte differentiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0033077
    label: T cell differentiation in thymus
  evidence_type: IMP
  original_reference_id: PMID:8170972
  review:
    summary: T cell differentiation in thymus is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0043029
    label: T cell homeostasis
  evidence_type: IMP
  original_reference_id: PMID:7650488
  review:
    summary: T cell homeostasis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0043029
    label: T cell homeostasis
  evidence_type: IMP
  original_reference_id: PMID:8170972
  review:
    summary: T cell homeostasis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: IMP
  original_reference_id: PMID:8170972
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0043375
    label: CD8-positive, alpha-beta T cell lineage commitment
  evidence_type: IMP
  original_reference_id: PMID:8170972
  review:
    summary: CD8-positive, alpha-beta T cell lineage commitment is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0043583
    label: ear development
  evidence_type: IMP
  original_reference_id: PMID:8170972
  review:
    summary: ear development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0048066
    label: developmental pigmentation
  evidence_type: IMP
  original_reference_id: PMID:8170972
  review:
    summary: developmental pigmentation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0048545
    label: response to steroid hormone
  evidence_type: IMP
  original_reference_id: PMID:8170972
  review:
    summary: response to steroid hormone is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0001822
    label: kidney development
  evidence_type: IMP
  original_reference_id: PMID:11709185
  review:
    summary: kidney development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0001822
    label: kidney development
  evidence_type: IGI
  original_reference_id: PMID:11709185
  review:
    summary: kidney development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0002260
    label: lymphocyte homeostasis
  evidence_type: IMP
  original_reference_id: PMID:11709185
  review:
    summary: lymphocyte homeostasis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0002260
    label: lymphocyte homeostasis
  evidence_type: IGI
  original_reference_id: PMID:11709185
  review:
    summary: lymphocyte homeostasis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0006582
    label: melanin metabolic process
  evidence_type: IMP
  original_reference_id: PMID:11709185
  review:
    summary: melanin metabolic process is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0009791
    label: post-embryonic development
  evidence_type: IMP
  original_reference_id: PMID:11709185
  review:
    summary: post-embryonic development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0009791
    label: post-embryonic development
  evidence_type: IGI
  original_reference_id: PMID:11709185
  review:
    summary: post-embryonic development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0030318
    label: melanocyte differentiation
  evidence_type: IMP
  original_reference_id: PMID:11709185
  review:
    summary: melanocyte differentiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0031966
    label: mitochondrial membrane
  evidence_type: IDA
  original_reference_id: PMID:11980919
  review:
    summary: mitochondrial membrane is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0040018
    label: positive regulation of multicellular organism growth
  evidence_type: IMP
  original_reference_id: PMID:11709185
  review:
    summary: positive regulation of multicellular organism growth is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0043583
    label: ear development
  evidence_type: IMP
  original_reference_id: PMID:11709185
  review:
    summary: ear development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0043583
    label: ear development
  evidence_type: IGI
  original_reference_id: PMID:11709185
  review:
    summary: ear development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0048066
    label: developmental pigmentation
  evidence_type: IMP
  original_reference_id: PMID:11709185
  review:
    summary: developmental pigmentation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0048066
    label: developmental pigmentation
  evidence_type: IGI
  original_reference_id: PMID:11709185
  review:
    summary: developmental pigmentation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0021747
    label: cochlear nucleus development
  evidence_type: IMP
  original_reference_id: PMID:11027399
  review:
    summary: cochlear nucleus development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0043524
    label: negative regulation of neuron apoptotic process
  evidence_type: IMP
  original_reference_id: PMID:11027399
  review:
    summary: negative regulation of neuron apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0048743
    label: positive regulation of skeletal muscle fiber development
  evidence_type: IMP
  original_reference_id: PMID:11146504
  review:
    summary: positive regulation of skeletal muscle fiber development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0008283
    label: cell population proliferation
  evidence_type: IGI
  original_reference_id: PMID:10762311
  review:
    summary: cell population proliferation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0051402
    label: neuron apoptotic process
  evidence_type: IGI
  original_reference_id: PMID:10762311
  review:
    summary: The neuron apoptosis evidence supports Bcl2-dependent neuronal survival, not execution of neuron apoptotic process.
    action: MODIFY
    reason: Replace with GO:0043524 negative regulation of neuron apoptotic process to reflect Bcl2 anti-apoptotic function in neurons.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: BCL2 blocks apoptosis by binding and restraining pro-apoptotic BCL-2 family proteins and by maintaining mitochondrial outer membrane integrity.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells.
    proposed_replacement_terms:
    - id: GO:0043524
      label: negative regulation of neuron apoptotic process
- term:
    id: GO:0043524
    label: negative regulation of neuron apoptotic process
  evidence_type: IMP
  original_reference_id: PMID:10762311
  review:
    summary: negative regulation of neuron apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0009636
    label: response to toxic substance
  evidence_type: IMP
  original_reference_id: PMID:10602483
  review:
    summary: response to toxic substance likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: IMP
  original_reference_id: PMID:10602483
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: IMP
  original_reference_id: PMID:10321489
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0046671
    label: negative regulation of retinal cell programmed cell death
  evidence_type: IMP
  original_reference_id: PMID:10321489
  review:
    summary: negative regulation of retinal cell programmed cell death is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0001822
    label: kidney development
  evidence_type: IMP
  original_reference_id: PMID:9950951
  review:
    summary: kidney development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0007015
    label: actin filament organization
  evidence_type: IMP
  original_reference_id: PMID:9950951
  review:
    summary: actin filament organization is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0032880
    label: regulation of protein localization
  evidence_type: IMP
  original_reference_id: PMID:9950951
  review:
    summary: regulation of protein localization is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0010224
    label: response to UV-B
  evidence_type: IMP
  original_reference_id: PMID:10200548
  review:
    summary: response to UV-B is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: IMP
  original_reference_id: PMID:10200548
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0051726
    label: regulation of cell cycle
  evidence_type: IMP
  original_reference_id: PMID:10200548
  review:
    summary: regulation of cell cycle is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0000902
    label: cell morphogenesis
  evidence_type: IMP
  original_reference_id: PMID:10193316
  review:
    summary: cell morphogenesis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0001503
    label: ossification
  evidence_type: IMP
  original_reference_id: PMID:10193316
  review:
    summary: ossification is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0033689
    label: negative regulation of osteoblast proliferation
  evidence_type: IMP
  original_reference_id: PMID:10193316
  review:
    summary: negative regulation of osteoblast proliferation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0014042
    label: positive regulation of neuron maturation
  evidence_type: IMP
  original_reference_id: PMID:9547242
  review:
    summary: positive regulation of neuron maturation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: IMP
  original_reference_id: PMID:9374413
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0001822
    label: kidney development
  evidence_type: IGI
  original_reference_id: PMID:9241272
  review:
    summary: kidney development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0006808
    label: regulation of nitrogen utilization
  evidence_type: IGI
  original_reference_id: PMID:9241272
  review:
    summary: regulation of nitrogen utilization is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0008584
    label: male gonad development
  evidence_type: IGI
  original_reference_id: PMID:9241272
  review:
    summary: male gonad development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0009791
    label: post-embryonic development
  evidence_type: IGI
  original_reference_id: PMID:9241272
  review:
    summary: post-embryonic development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0045930
    label: negative regulation of mitotic cell cycle
  evidence_type: IDA
  original_reference_id: PMID:9241272
  review:
    summary: negative regulation of mitotic cell cycle is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0048087
    label: positive regulation of developmental pigmentation
  evidence_type: IGI
  original_reference_id: PMID:9241272
  review:
    summary: positive regulation of developmental pigmentation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0048538
    label: thymus development
  evidence_type: IMP
  original_reference_id: PMID:9241272
  review:
    summary: thymus development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: IMP
  original_reference_id: PMID:9153592
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0033033
    label: negative regulation of myeloid cell apoptotic process
  evidence_type: IDA
  original_reference_id: PMID:9202146
  review:
    summary: negative regulation of myeloid cell apoptotic process is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0009410
    label: response to xenobiotic stimulus
  evidence_type: IDA
  original_reference_id: PMID:9098922
  review:
    summary: response to xenobiotic stimulus likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0007409
    label: axonogenesis
  evidence_type: IMP
  original_reference_id: PMID:9009190
  review:
    summary: axonogenesis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0031103
    label: axon regeneration
  evidence_type: IDA
  original_reference_id: PMID:9009190
  review:
    summary: axon regeneration is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0001776
    label: leukocyte homeostasis
  evidence_type: IMP
  original_reference_id: PMID:9028316
  review:
    summary: leukocyte homeostasis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0002320
    label: lymphoid progenitor cell differentiation
  evidence_type: IMP
  original_reference_id: PMID:9028316
  review:
    summary: lymphoid progenitor cell differentiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0030183
    label: B cell differentiation
  evidence_type: IMP
  original_reference_id: PMID:9028316
  review:
    summary: B cell differentiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0033077
    label: T cell differentiation in thymus
  evidence_type: IMP
  original_reference_id: PMID:9028316
  review:
    summary: T cell differentiation in thymus is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0030279
    label: negative regulation of ossification
  evidence_type: IMP
  original_reference_id: PMID:9008714
  review:
    summary: negative regulation of ossification is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: IDA
  original_reference_id: PMID:7834747
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: IGI
  original_reference_id: PMID:7834747
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0001822
    label: kidney development
  evidence_type: IMP
  original_reference_id: PMID:8760259
  review:
    summary: kidney development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0003014
    label: renal system process
  evidence_type: IMP
  original_reference_id: PMID:8760259
  review:
    summary: renal system process is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: IMP
  original_reference_id: PMID:8760259
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0030318
    label: melanocyte differentiation
  evidence_type: IMP
  original_reference_id: PMID:8758925
  review:
    summary: melanocyte differentiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0048753
    label: pigment granule organization
  evidence_type: IMP
  original_reference_id: PMID:8758925
  review:
    summary: pigment granule organization is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0001656
    label: metanephros development
  evidence_type: IMP
  original_reference_id: PMID:8623928
  review:
    summary: metanephros development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0009791
    label: post-embryonic development
  evidence_type: IMP
  original_reference_id: PMID:8755480
  review:
    summary: post-embryonic development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0014031
    label: mesenchymal cell development
  evidence_type: IMP
  original_reference_id: PMID:8623928
  review:
    summary: mesenchymal cell development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0032835
    label: glomerulus development
  evidence_type: IMP
  original_reference_id: PMID:8623928
  review:
    summary: glomerulus development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0035265
    label: organ growth
  evidence_type: IMP
  original_reference_id: PMID:8623928
  review:
    summary: organ growth is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: IMP
  original_reference_id: PMID:8623928
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0008285
    label: negative regulation of cell population proliferation
  evidence_type: IMP
  original_reference_id: PMID:8663032
  review:
    summary: negative regulation of cell population proliferation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: IMP
  original_reference_id: PMID:8663032
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0002326
    label: B cell lineage commitment
  evidence_type: IMP
  original_reference_id: PMID:8788039
  review:
    summary: B cell lineage commitment is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0002360
    label: T cell lineage commitment
  evidence_type: IMP
  original_reference_id: PMID:8788039
  review:
    summary: T cell lineage commitment is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0043524
    label: negative regulation of neuron apoptotic process
  evidence_type: IDA
  original_reference_id: PMID:7472523
  review:
    summary: negative regulation of neuron apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0005737
    label: cytoplasm
  evidence_type: IDA
  original_reference_id: PMID:7675327
  review:
    summary: cytoplasm is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0001541
    label: ovarian follicle development
  evidence_type: IMP
  original_reference_id: PMID:7628407
  review:
    summary: ovarian follicle development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0048599
    label: oocyte development
  evidence_type: IMP
  original_reference_id: PMID:7628407
  review:
    summary: oocyte development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0005737
    label: cytoplasm
  evidence_type: IDA
  original_reference_id: PMID:7563251
  review:
    summary: cytoplasm is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0001656
    label: metanephros development
  evidence_type: IMP
  original_reference_id: PMID:7840250
  review:
    summary: metanephros development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0001822
    label: kidney development
  evidence_type: IMP
  original_reference_id: PMID:7840250
  review:
    summary: kidney development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: IMP
  original_reference_id: PMID:7840250
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: IDA
  original_reference_id: PMID:7751019
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0001822
    label: kidney development
  evidence_type: IMP
  original_reference_id: PMID:7812968
  review:
    summary: kidney development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0002520
    label: immune system development
  evidence_type: IMP
  original_reference_id: PMID:7812968
  review:
    summary: immune system development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0009791
    label: post-embryonic development
  evidence_type: IMP
  original_reference_id: PMID:7812968
  review:
    summary: post-embryonic development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0022612
    label: gland morphogenesis
  evidence_type: IMP
  original_reference_id: PMID:7812968
  review:
    summary: gland morphogenesis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0030097
    label: hemopoiesis
  evidence_type: IMP
  original_reference_id: PMID:7812968
  review:
    summary: hemopoiesis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0035265
    label: organ growth
  evidence_type: IMP
  original_reference_id: PMID:7812968
  review:
    summary: organ growth is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0048546
    label: digestive tract morphogenesis
  evidence_type: IMP
  original_reference_id: PMID:7812968
  review:
    summary: digestive tract morphogenesis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0005634
    label: nucleus
  evidence_type: IDA
  original_reference_id: PMID:7945396
  review:
    summary: nucleus is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0005739
    label: mitochondrion
  evidence_type: IDA
  original_reference_id: PMID:7945396
  review:
    summary: mitochondrion is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0006874
    label: intracellular calcium ion homeostasis
  evidence_type: IDA
  original_reference_id: PMID:7945396
  review:
    summary: intracellular calcium ion homeostasis is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0005634
    label: nucleus
  evidence_type: IDA
  original_reference_id: PMID:7953633
  review:
    summary: nucleus is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0005739
    label: mitochondrion
  evidence_type: IDA
  original_reference_id: PMID:7953633
  review:
    summary: mitochondrion is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0043209
    label: myelin sheath
  evidence_type: IDA
  original_reference_id: PMID:7953633
  review:
    summary: myelin sheath likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0002520
    label: immune system development
  evidence_type: IMP
  original_reference_id: PMID:8372353
  review:
    summary: immune system development is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0005634
    label: nucleus
  evidence_type: IDA
  original_reference_id: PMID:8030757
  review:
    summary: nucleus is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0005737
    label: cytoplasm
  evidence_type: IDA
  original_reference_id: PMID:8030757
  review:
    summary: cytoplasm is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0005783
    label: endoplasmic reticulum
  evidence_type: IDA
  original_reference_id: PMID:8030757
  review:
    summary: endoplasmic reticulum is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0005829
    label: cytosol
  evidence_type: IDA
  original_reference_id: PMID:8030757
  review:
    summary: cytosol should not be retained as a direct Bcl2 annotation.
    action: REMOVE
    reason: The term is uninformative, conflicts with Bcl2 anti-apoptotic directionality, or describes an enzymatic/molecular activity not enabled by Bcl2.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 is an anti-apoptotic BCL-2 family regulator of mitochondrial membrane permeability; generic binding, enzymatic, or opposite-direction terms are not informative direct annotations.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports specific anti-apoptotic BCL-2 family activity rather than generic binding, enzymatic, or opposite-direction annotations.
- term:
    id: GO:0010332
    label: response to gamma radiation
  evidence_type: IMP
  original_reference_id: PMID:8372353
  review:
    summary: response to gamma radiation is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0031965
    label: nuclear membrane
  evidence_type: IDA
  original_reference_id: PMID:8030757
  review:
    summary: nuclear membrane is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: IDA
  original_reference_id: PMID:8313913
  review:
    summary: negative regulation of apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0051384
    label: response to glucocorticoid
  evidence_type: IDA
  original_reference_id: PMID:8313913
  review:
    summary: response to glucocorticoid is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0051384
    label: response to glucocorticoid
  evidence_type: IMP
  original_reference_id: PMID:8372353
  review:
    summary: response to glucocorticoid is retained as a context-specific Bcl2 phenotype, localization, pathway effect, or stress response rather than the core molecular function.
    action: KEEP_AS_NON_CORE
    reason: Bcl2-dependent survival has broad tissue and developmental consequences; these terms are biologically plausible but downstream or peripheral to its core anti-apoptotic mechanism.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis describes broad developmental and therapeutic contexts as consequences of Bcl2 apoptosis regulation, not the core molecular function.
- term:
    id: GO:0005739
    label: mitochondrion
  evidence_type: HDA
  original_reference_id: PMID:14651853
  review:
    summary: mitochondrion is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0008284
    label: positive regulation of cell population proliferation
  evidence_type: IDA
  original_reference_id: PMID:11983915
  review:
    summary: positive regulation of cell population proliferation likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0031069
    label: hair follicle morphogenesis
  evidence_type: IMP
  original_reference_id: PMID:8402909
  review:
    summary: hair follicle morphogenesis likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0043473
    label: pigmentation
  evidence_type: IMP
  original_reference_id: PMID:8402909
  review:
    summary: pigmentation likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0045069
    label: regulation of viral genome replication
  evidence_type: IDA
  original_reference_id: PMID:16950491
  review:
    summary: regulation of viral genome replication likely overstates a direct Bcl2 role relative to its curated anti-apoptotic function.
    action: MARK_AS_OVER_ANNOTATED
    reason: The evidence supports Bcl2 as a survival regulator at mitochondrial/ER membranes; this term is too indirect, broad, or mechanistically ambiguous.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 affects many developmental, immune, neuronal, pigmentation, kidney, and stress phenotypes through altered cell survival; these are context-specific consequences rather than core molecular functions.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as a mitochondrial/ER anti-apoptotic regulator; broader pathway and phenotypic terms can overstate direct function.
- term:
    id: GO:0001836
    label: release of cytochrome c from mitochondria
  evidence_type: IDA
  original_reference_id: PMID:9843949
  review:
    summary: release of cytochrome c from mitochondria has the right biological area but is too generic or has the wrong direction for Bcl2 anti-apoptotic function.
    action: MODIFY
    proposed_replacement_terms:
    - id: GO:0090201
      label: negative regulation of release of cytochrome c from mitochondria
    reason: Bcl2 primarily inhibits mitochondrial/intrinsic apoptotic signaling and cytochrome c release. Bcl2 directly controls MOMP at the mitochondrial outer membrane, making it a direct regulator of the intrinsic pathway; the extrinsic pathway annotation does not reflect a direct Bcl2 mechanistic role.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 prevents mitochondrial cytochrome c release and intrinsic apoptosis; directional or generic terms should be replaced with negative regulation or BH3-domain binding terms where possible.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports Bcl2 as an inhibitor of mitochondrial apoptotic signaling and cytochrome c release, so directional or generic terms should be replaced by negative-regulation/BH-domain terms.
- term:
    id: GO:0046902
    label: regulation of mitochondrial membrane permeability
  evidence_type: IDA
  original_reference_id: PMID:9843949
  review:
    summary: regulation of mitochondrial membrane permeability is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0051881
    label: regulation of mitochondrial membrane potential
  evidence_type: IDA
  original_reference_id: PMID:9843949
  review:
    summary: regulation of mitochondrial membrane potential is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0043524
    label: negative regulation of neuron apoptotic process
  evidence_type: IDA
  original_reference_id: PMID:8625820
  review:
    summary: negative regulation of neuron apoptotic process is consistent with Bcl2 as an anti-apoptotic BCL-2 family protein that controls mitochondrial membrane permeability and binds BH-domain partners.
    action: ACCEPT
    reason: The term captures the core anti-apoptotic mechanism, BCL-2 family binding/complex context, or supported mitochondrial/ER membrane localization.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability, preventing cytochrome c release, and binding BCL-2 family partners through BH domains.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
- term:
    id: GO:0005829
    label: cytosol
  evidence_type: IDA
  original_reference_id: PMID:14551195
  review:
    summary: PMID:14551195 does not provide Bcl2 cytosol-localization evidence.
    action: REMOVE
    reason: The cited PMID:14551195 is a PDZK1/SR-BI lipoprotein study with no Bcl2-specific localization evidence; removed on evidential grounds.
    supported_by:
    - reference_id: PMID:14551195
      supporting_text: Targeted disruption of the PDZK1 gene in mice causes tissue-specific depletion of the high density lipoprotein receptor scavenger receptor class B type I and altered lipoprotein metabolism.
- term:
    id: GO:0043066
    label: negative regulation of apoptotic process
  evidence_type: IDA
  original_reference_id: PMID:14551195
  review:
    summary: PMID:14551195 does not support a Bcl2 negative-regulation-of-apoptosis annotation.
    action: REMOVE
    reason: The cached publication is a PDZK1/SR-BI lipoprotein metabolism study and does not provide direct Bcl2 apoptosis evidence.
    supported_by:
    - reference_id: PMID:14551195
      supporting_text: Targeted disruption of the PDZK1 gene in mice causes tissue-specific depletion of the high density lipoprotein receptor scavenger receptor class B type I and altered lipoprotein metabolism.
- term:
    id: GO:0005739
    label: mitochondrion
  evidence_type: IDA
  original_reference_id: PMID:12420306
  review:
    summary: PMID:12420306 does not support a Bcl2 mitochondrion annotation.
    action: REMOVE
    reason: The cached publication concerns mouse hexokinase-s sorting and provides no accessible Bcl2-specific localization evidence.
    supported_by:
    - reference_id: PMID:12420306
      supporting_text: Sorting specificity of spermatogenic cell specific region of mouse hexokinase-s
- term:
    id: GO:0005829
    label: cytosol
  evidence_type: IDA
  original_reference_id: PMID:12050152
  review:
    summary: cytosol should not be retained as a direct Bcl2 annotation.
    action: REMOVE
    reason: The term is uninformative, conflicts with Bcl2 anti-apoptotic directionality, or describes an enzymatic/molecular activity not enabled by Bcl2.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 is an anti-apoptotic BCL-2 family regulator of mitochondrial membrane permeability; generic binding, enzymatic, or opposite-direction terms are not informative direct annotations.
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Suppresses apoptosis ... Regulates cell death by controlling the mitochondrial membrane permeability.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Falcon synthesis supports specific anti-apoptotic BCL-2 family activity rather than generic binding, enzymatic, or opposite-direction annotations.
- term:
    id: GO:1901029
    label: negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway
  evidence_type: IC
  original_reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
  review:
    summary: Bcl2 prevents mitochondrial outer membrane permeabilization, the central mechanism by which it blocks intrinsic apoptosis and cytochrome c release.
    action: NEW
    reason: This directly captures Bcl2 anti-apoptotic mechanism more specifically than broad negative regulation of apoptosis terms.
    supported_by:
    - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
      supporting_text: Regulates cell death by controlling the mitochondrial membrane permeability. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
      supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability and preventing cytochrome c release.
    - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
      supporting_text: Mouse Bcl2 prevents mitochondrial outer membrane permeabilization and cytochrome-c release, directly supporting this added GO annotation.
references:
- id: GO_REF:0000002
  title: Gene Ontology annotation through association of InterPro records with GO terms
  findings: []
- id: GO_REF:0000008
  title: Gene Ontology annotation by the MGI curatorial staff, curated orthology
  findings: []
- id: GO_REF:0000024
  title: Manual transfer of experimentally-verified manual GO annotation data to orthologs by curator judgment of sequence similarity
  findings: []
- id: GO_REF:0000033
  title: Annotation inferences using phylogenetic trees
  findings: []
- id: GO_REF:0000043
  title: Gene Ontology annotation based on UniProtKB/Swiss-Prot keyword mapping
  findings: []
- id: GO_REF:0000096
  title: Automated transfer of experimentally-verified manual GO annotation data to mouse-rat orthologs
  findings: []
- id: GO_REF:0000107
  title: Automatic transfer of experimentally verified manual GO annotation data to orthologs using Ensembl Compara
  findings: []
- id: GO_REF:0000108
  title: Automatic assignment of GO terms using logical inference, based on on inter-ontology links
  findings: []
- id: GO_REF:0000117
  title: Electronic Gene Ontology annotations created by ARBA machine learning models
  findings: []
- id: GO_REF:0000119
  title: Automated transfer of experimentally-verified manual GO annotation data to mouse-human orthologs
  findings: []
- id: GO_REF:0000120
  title: Combined Automated Annotation using Multiple IEA Methods
  findings: []
- id: PMID:10193316
  title: The bcl-2 knockout mouse exhibits marked changes in osteoblast phenotype and collagen deposition in bone as well as a mild growth plate phenotype.
  findings: []
- id: PMID:10200548
  title: Alterations in cell death and cell cycle progression in the UV-irradiated epidermis of bcl-2-deficient mice.
  findings: []
- id: PMID:10321489
  title: Retinal ganglion cell loss after the period of naturally occurring cell death in bcl-2-/- mice.
  findings: []
- id: PMID:10488913
  title: Targeted disruption of the bcl-2 gene in mice exacerbates focal ischemic brain injury.
  findings: []
- id: PMID:10582606
  title: Bax and Bcl-2 interaction in a transgenic mouse model of familial amyotrophic lateral sclerosis.
  findings: []
- id: PMID:10597216
  title: Bis, a Bcl-2-binding protein that synergizes with Bcl-2 in preventing cell death.
  findings: []
- id: PMID:10602483
  title: "Damage-induced apoptosis in intestinal epithelia from bcl-2-null and bax-null mice: investigations of the mechanistic determinants of epithelial apoptosis in vivo."
  findings: []
- id: PMID:10674380
  title: Hair follicle apoptosis and Bcl-2.
  findings: []
- id: PMID:10726970
  title: Developmental changes in antioxidant enzymes and oxidative damage in kidneys, liver and brain of bcl-2 knockout mice.
  findings: []
- id: PMID:10762311
  title: Differences in bcl-2- and bax-independent function in regulating apoptosis in sensory neuron populations.
  findings: []
- id: PMID:10815637
  title: Effects of deficiency in p53 or bcl-2 on the sensitivity of clonogenic cells in the small intestine to low dose-rate irradiation.
  findings: []
- id: PMID:11027399
  title: Patterns of cell death in mouse anteroventral cochlear nucleus neurons after unilateral cochlea removal.
  findings: []
- id: PMID:11146504
  title: 'Pro- and anti-apoptotic members of the Bcl-2 family in skeletal muscle: a distinct role for Bcl-2 in later stages of myogenesis.'
  findings: []
- id: PMID:11226327
  title: Bax ablation prevents dopaminergic neurodegeneration in the 1-methyl- 4-phenyl-1,2,3,6-tetrahydropyridine mouse model of Parkinson's disease.
  findings: []
- id: PMID:11546872
  title: 'Bmf: a proapoptotic BH3-only protein regulated by interaction with the myosin V actin motor complex, activated by anoikis.'
  findings: []
- id: PMID:11709185
  title: Degenerative disorders caused by Bcl-2 deficiency prevented by loss of its BH3-only antagonist Bim.
  findings: []
- id: PMID:11980919
  title: 'Intrinsic and extrinsic pathway signaling during neuronal apoptosis: lessons from the analysis of mutant mice.'
  findings: []
- id: PMID:11983915
  title: bcl-2 overexpression promotes myocyte proliferation.
  findings: []
- id: PMID:12050152
  title: A novel transactivating factor that regulates interferon-gamma-dependent gene expression.
  findings: []
- id: PMID:12082633
  title: Proapoptotic activity of ITM2B(s), a BH3-only protein induced upon IL-2-deprivation which interacts with Bcl-2.
  findings: []
- id: PMID:12086670
  title: Bcl2 regulation by the melanocyte master regulator Mitf modulates lineage survival and melanoma cell viability.
  findings: []
- id: PMID:12420306
  title: Sorting specificity of spermatogenic cell specific region of mouse hexokinase-s (mHk1-s).
  findings: []
- id: PMID:12617961
  title: Calcium-dependent interaction of calcineurin with Bcl-2 in neuronal tissue.
  findings: []
- id: PMID:12855558
  title: Bcl2 retards G1/S cell cycle transition by regulating intracellular ROS.
  findings: []
- id: PMID:1373874
  title: Bcl-2 confers growth and survival advantage to interleukin 7-dependent early pre-B cells which become factor independent by a multistep process in culture.
  findings: []
- id: PMID:14551195
  title: Targeted disruption of the PDZK1 gene in mice causes tissue-specific depletion of the high density lipoprotein receptor scavenger receptor class B type I and altered lipoprotein metabolism.
  findings: []
- id: PMID:14651853
  title: Integrated analysis of protein composition, tissue diversity, and gene regulation in mouse mitochondria.
  findings: []
- id: PMID:14660795
  title: Mono- and multisite phosphorylation enhances Bcl2's antiapoptotic function and inhibition of cell cycle entry functions.
  findings: []
- id: PMID:14699151
  title: Interaction of bcl-2 with Paxillin through its BH4 domain is important during ureteric bud branching.
  findings: []
- id: PMID:14707049
  title: TCR-independent and caspase-independent apoptosis of murine thymocytes by CD24 cross-linking.
  findings: []
- id: PMID:15292044
  title: Alterations in cell-adhesive and migratory properties of proximal tubule and collecting duct cells from bcl-2 -/- mice.
  findings: []
- id: PMID:15613488
  title: Proapoptotic BAX and BAK regulate the type 1 inositol trisphosphate receptor and calcium leak from the endoplasmic reticulum.
  findings: []
- id: PMID:15776018
  title: Proapoptotic BAX and BAK control multiple initiator caspases.
  findings: []
- id: PMID:15818405
  title: Polycystic kidney disease prevented by transgenic RNA interference.
  findings: []
- id: PMID:15983387
  title: Frag1, a homolog of alternative replication factor C subunits, links replication stress surveillance with apoptosis.
  findings: []
- id: PMID:16095731
  title: 'Increased anxiety-like behaviors and mitochondrial dysfunction in mice with targeted mutation of the Bcl-2 gene: further support for the involvement of mitochondrial function in anxiety disorders.'
  findings: []
- id: PMID:16282979
  title: Loss of PKD1 and loss of Bcl-2 elicit polycystic kidney disease through distinct mechanisms.
  findings: []
- id: PMID:16427619
  title: Indispensable role of Bcl2 in the development of the melanocyte stem cell.
  findings: []
- id: PMID:16509771
  title: IAN family critically regulates survival and development of T lymphocytes.
  findings: []
- id: PMID:16672320
  title: Suppression of ureteric bud apoptosis rescues nephron endowment and adult renal function in Pax2 mutant mice.
  findings: []
- id: PMID:16717086
  title: PP2A regulates BCL-2 phosphorylation and proteasome-mediated degradation at the endoplasmic reticulum.
  findings: []
- id: PMID:16839884
  title: Mitochondrial rhomboid PARL regulates cytochrome c release during apoptosis via OPA1-dependent cristae remodeling.
  findings: []
- id: PMID:16950491
  title: Role of Bcl-2 expression for productive herpes simplex virus 2 replication.
  findings: []
- id: PMID:17068116
  title: Radiation-induced gastric epithelial apoptosis occurs in the proliferative zone and is regulated by p53, bak, bax, and bcl-2.
  findings: []
- id: PMID:17267035
  title: Regulation of the lifespan in dendritic cell subsets.
  findings: []
- id: PMID:17382917
  title: c-Myc is essential for urokinase plasminogen activator expression on hypoxia-induced vascular smooth muscle cells.
  findings: []
- id: PMID:17475835
  title: Involvement of heat shock protein (Hsp)90 beta but not Hsp90 alpha in antiapoptotic effect of CpG-B oligodeoxynucleotide.
  findings: []
- id: PMID:17591857
  title: Bim/Bcl-2 balance is critical for maintaining naive and memory T cell homeostasis.
  findings: []
- id: PMID:18223655
  title: Dual role of proapoptotic BAD in insulin secretion and beta cell survival.
  findings: []
- id: PMID:18548006
  title: Osteoclast size is controlled by Fra-2 through LIF/LIF-receptor signalling and hypoxia.
  findings: []
- id: PMID:18614015
  title: A mitochondrial protein compendium elucidates complex I disease biology.
  findings: []
- id: PMID:20621101
  title: Upregulation of Bcl2 inhibits apoptosis-driven BAX insertion but favors BAX relocalization in mitochondria.
  findings: []
- id: PMID:20819940
  title: Endogenous HMGB1 regulates autophagy.
  findings: []
- id: PMID:21151042
  title: Cyclic-AMP-dependent protein kinase A regulates apoptosis by stabilizing the BH3-only protein Bim.
  findings: []
- id: PMID:22258505
  title: Exercise-induced BCL2-regulated autophagy is required for muscle glucose homeostasis.
  findings: []
- id: PMID:23629966
  title: Deacetylation of p53 induces autophagy by suppressing Bmf expression.
  findings: []
- id: PMID:26949185
  title: BOK Is a Non-canonical BCL-2 Family Effector of Apoptosis Regulated by ER-Associated Degradation.
  findings: []
- id: PMID:29020630
  title: Degradation of Bcl-2 by XIAP and ARTS Promotes Apoptosis.
  findings: []
- id: PMID:29849149
  title: Disruption of the beclin 1-BCL2 autophagy regulatory complex promotes longevity in mice.
  findings: []
- id: PMID:36812915
  title: Exercise-activated hepatic autophagy via the FN1-α5β1 integrin pathway drives metabolic benefits of exercise.
  findings: []
- id: PMID:7472523
  title: Bcl-2 overexpression prevents motoneuron cell body loss but not axonal degeneration in a mouse model of a neurodegenerative disease.
  findings: []
- id: PMID:7546744
  title: Role of BCL-2 in the survival and function of developing and mature sympathetic neurons.
  findings: []
- id: PMID:7563251
  title: Differential regulation of bcl-2, bax, c-fos, junB, and krox-24 expression in the cerebellum of Purkinje cell degeneration mutant mice.
  findings: []
- id: PMID:7595537
  title: Bcl-2 protects neural cells from cyanide/aglycemia-induced lipid oxidation, mitochondrial injury, and loss of viability.
  findings: []
- id: PMID:7628407
  title: Ablation of bcl-2 gene expression decreases the numbers of oocytes and primordial follicles established in the post-natal female mouse gonad.
  findings: []
- id: PMID:7650367
  title: Expression of Bcl-2, Bcl-x, and Bax after T cell activation and IL-2 withdrawal.
  findings: []
- id: PMID:7650488
  title: Bcl-XL and Bcl-2 repress a common pathway of cell death.
  findings: []
- id: PMID:7675327
  title: Up-regulation of bax and down-regulation of bcl-2 is associated with kainate-induced apoptosis in mouse brain.
  findings: []
- id: PMID:7751019
  title: Apoptosis and Bcl-2 expression in cultured murine splenic T cells.
  findings: []
- id: PMID:7772249
  title: Evolutionary conservation of function among mammalian, avian, and viral homologs of the Bcl-2 oncoprotein.
  findings: []
- id: PMID:7812968
  title: "bcl-2 deficiency in mice leads to pleiotropic abnormalities: accelerated lymphoid cell death in thymus and spleen, polycystic kidney, hair hypopigmentation, and distorted small intestine."
  findings: []
- id: PMID:7834747
  title: 'Cloning and functional analysis of BAG-1: a novel Bcl-2-binding protein with anti-cell death activity.'
  findings: []
- id: PMID:7834748
  title: Bad, a heterodimeric partner for Bcl-XL and Bcl-2, displaces Bax and promotes cell death.
  findings: []
- id: PMID:7840250
  title: Fulminant metanephric apoptosis and abnormal kidney development in bcl-2-deficient mice.
  findings: []
- id: PMID:7896880
  title: The intracellular distribution and pattern of expression of Mcl-1 overlap with, but are not identical to, those of Bcl-2.
  findings: []
- id: PMID:7945396
  title: Bcl-2 overexpression abolishes early calcium waving preceding apoptosis in NIH-3T3 murine fibroblasts.
  findings: []
- id: PMID:7953633
  title: Expression of Bcl-2 protein in murine neural cells in culture.
  findings: []
- id: PMID:8022822
  title: Evidence that BCL-2 represses apoptosis by regulating endoplasmic reticulum-associated Ca2+ fluxes.
  findings: []
- id: PMID:8030757
  title: Bcl-2 protein expression during murine development.
  findings: []
- id: PMID:8050499
  title: bcl-2 gene prevents apoptosis of basic fibroblast growth factor-deprived murine aortic endothelial cells.
  findings: []
- id: PMID:8080725
  title: bcl-2 gene enables rescue from in vitro myelosuppression (bone marrow cell death) induced by chemotherapy.
  findings: []
- id: PMID:8084613
  title: Antisense oligonucleotides suppress B-cell lymphoma growth in a SCID-hu mouse model.
  findings: []
- id: PMID:8170972
  title: "Targeted disruption of Bcl-2 alpha beta in mice: occurrence of gray hair, polycystic kidney disease, and lymphocytopenia."
  findings: []
- id: PMID:8313913
  title: Developmental regulation of the Bcl-2 protein and susceptibility to cell death in B lymphocytes.
  findings: []
- id: PMID:8372353
  title: Disappearance of the lymphoid system in Bcl-2 homozygous mutant chimeric mice.
  findings: []
- id: PMID:8402909
  title: Bcl-2-deficient mice demonstrate fulminant lymphoid apoptosis, polycystic kidneys, and hypopigmented hair.
  findings: []
- id: PMID:8623928
  title: Apoptosis during an early stage of nephrogenesis induces renal hypoplasia in bcl-2-deficient mice.
  findings: []
- id: PMID:8625820
  title: Bax promotes neuronal survival and antagonises the survival effects of neurotrophic factors.
  findings: []
- id: PMID:8663032
  title: Diminished cell proliferation associated with the death-protective activity of Bcl-2.
  findings: []
- id: PMID:8755480
  title: Inactivation of bcl-2 results in progressive degeneration of motoneurons, sympathetic and sensory neurons during early postnatal development.
  findings: []
- id: PMID:8758925
  title: Accelerated disappearance of melanocytes in bcl-2-deficient mice.
  findings: []
- id: PMID:8760259
  title: Abnormal postpartum renal development and cystogenesis in the bcl-2 (-/-) mouse.
  findings: []
- id: PMID:8788039
  title: Distinct patterns of Fas cell surface expression during development of T- or B-lymphocyte lineages in normal, scid, and mutant mice lacking or overexpressing p53, bcl-2, or rag-2 genes.
  findings: []
- id: PMID:8918887
  title: 'BID: a novel BH3 domain-only death agonist.'
  findings: []
- id: PMID:8949945
  title: Bcl-2 prevents hippocampal cell death induced by the neuroleptic drug haloperidol.
  findings: []
- id: PMID:9008714
  title: Bcl-2 lies downstream of parathyroid hormone-related peptide in a signaling pathway that regulates chondrocyte maturation during skeletal development.
  findings: []
- id: PMID:9009190
  title: Bcl-2 promotes regeneration of severed axons in mammalian CNS.
  findings: []
- id: PMID:9028316
  title: Role of bcl-2 in the development of lymphoid cells from the hematopoietic stem cell.
  findings: []
- id: PMID:9098922
  title: Valproic acid-induced changes in gene expression during neurulation in a mouse model.
  findings: []
- id: PMID:9153592
  title: Susceptibility of cerebellar granule neurons derived from Bcl-2-deficient and transgenic mice to cell death.
  findings: []
- id: PMID:9184696
  title: The apoptosis and proliferation of SAC-activated B cells by IL-10 are associated with changes in Bcl-2, Bcl-xL, and Mcl-1 expression.
  findings: []
- id: PMID:9202146
  title: Differential involvement of caspases in apoptosis of myeloid leukemic cells induced by chemotherapy versus growth factor withdrawal.
  findings: []
- id: PMID:9215624
  title: Bcl-2 can rescue T lymphocyte development in interleukin-7 receptor-deficient mice but not in mutant rag-1-/- mice.
  findings: []
- id: PMID:9241272
  title: Bcl-2 and Bax function independently to regulate cell death.
  findings: []
- id: PMID:9374413
  title: Bcl-2 is required for cranial sensory neuron survival at defined stages of embryonic development.
  findings: []
- id: PMID:9547242
  title: Bcl-2 accelerates the maturation of early sensory neurons.
  findings: []
- id: PMID:9560217
  title: Bax directly induces release of cytochrome c from isolated mitochondria.
  findings: []
- id: PMID:9681465
  title: Enhanced oxidative stress and altered antioxidants in brains of Bcl-2-deficient mice.
  findings: []
- id: PMID:9843949
  title: Bax interacts with the permeability transition pore to induce permeability transition and cytochrome c release in isolated mitochondria.
  findings: []
- id: PMID:9950951
  title: Nuclear localization of beta-catenin and loss of apical brush border actin in cystic tubules of bcl-2 -/- mice.
  findings: []
- id: file:mouse/Bcl2/Bcl2-uniprot.txt
  title: UniProt record for mouse Bcl2
  findings:
  - statement: Bcl2 suppresses apoptosis by controlling mitochondrial permeability and preventing cytochrome c release.
    supporting_text: Regulates cell death by controlling the mitochondrial membrane permeability.
- id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
  title: Bioreason deep research report on mouse Bcl2
  findings:
  - statement: Bcl2 is an anti-apoptotic BCL-2 family regulator whose core function is suppression of intrinsic apoptosis at mitochondrial membranes.
- id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
  title: Falcon deep research report on mouse Bcl2
  findings:
  - statement: Falcon synthesis identifies mouse Bcl2/P10417 as an anti-apoptotic BCL-2 family protein that prevents MOMP and cytochrome-c release through BH-domain partner interactions.
    supporting_text: Mouse Bcl2 (P10417) encodes an anti-apoptotic BCL-2 family protein whose primary function is to prevent MOMP by binding/sequestering BH3-containing pro-apoptotic partners.
core_functions:
- description: Bcl2 suppresses intrinsic apoptosis by controlling mitochondrial outer membrane permeability and preventing cytochrome c release, thereby blocking downstream caspase activation.
  molecular_function:
    id: GO:0051434
    label: BH3 domain binding
  directly_involved_in:
  - id: GO:0043066
    label: negative regulation of apoptotic process
  - id: GO:2001243
    label: negative regulation of intrinsic apoptotic signaling pathway
  - id: GO:1901029
    label: negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway
  locations:
  - id: GO:0005741
    label: mitochondrial outer membrane
  - id: GO:0005789
    label: endoplasmic reticulum membrane
  supported_by:
  - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
    supporting_text: Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria.
  - reference_id: file:mouse/Bcl2/Bcl2-deep-research-bioreason.md
    supporting_text: Bcl2 suppresses apoptosis by controlling mitochondrial membrane permeability and preventing cytochrome c release.
  - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
    supporting_text: BCL-2 binds BH3-containing pro-apoptotic proteins and prevents mitochondrial outer membrane permeabilization and cytochrome-c release.
- description: Bcl2 forms homo- and heterodimeric BCL-2 family complexes with pro-apoptotic partners such as Bax, Bad, and Bak; these interactions are required for anti-apoptotic activity and family-specific regulation.
  molecular_function:
    id: GO:0051400
    label: BH domain binding
  directly_involved_in:
  - id: GO:2001234
    label: negative regulation of apoptotic signaling pathway
  locations:
  - id: GO:0005741
    label: mitochondrial outer membrane
  in_complex:
    id: GO:0097148
    label: BCL-2 complex
  supported_by:
  - reference_id: file:mouse/Bcl2/Bcl2-uniprot.txt
    supporting_text: Forms homodimers, and heterodimers with BAX, BAD, BAK and Bcl-X(L). Heterodimerization with BAX requires intact BH1 and BH2 motifs, and is necessary for anti-apoptotic activity.
  - reference_id: file:mouse/Bcl2/Bcl2-deep-research-falcon.md
    supporting_text: BCL-2 binds BH3-containing pro-apoptotic proteins and prevents mitochondrial outer membrane permeabilization and cytochrome-c release.
proposed_new_terms: []
suggested_questions:
- question: Which mouse Bcl2 tissue-development annotations should remain on the gene versus being treated as downstream phenotypes of altered apoptosis?
- question: Which non-apoptotic Bcl2 autophagy and inflammasome functions are direct enough to retain as non-core GO annotations?
suggested_experiments:
- description: Use Bcl2 BH-domain mutant rescue in mouse primary cells to test which survival and autophagy annotations require canonical BCL-2 family partner binding.
- description: Measure mitochondrial outer membrane permeabilization, cytochrome c release, and caspase activation in Bcl2 knockout and add-back mouse cells across apoptotic stimuli.

Bcl2

Gene Description

Existing Annotations Review

Core Functions

Bcl2 suppresses intrinsic apoptosis by controlling mitochondrial outer membrane permeability and preventing cytochrome c release, thereby blocking downstream caspase activation.

Bcl2 forms homo- and heterodimeric BCL-2 family complexes with pro-apoptotic partners such as Bax, Bad, and Bak; these interactions are required for anti-apoptotic activity and family-specific regulation.

References

Suggested Questions for Experts

Suggested Experiments

📚 Additional Documentation

Deep Research Bioreason

BioReason Chat Export

Thinking Trace

Functional Summary

UniProt Summary

InterPro Domains

GO Terms

Deep Research Bioreason Rl

BioReason Chat Export

Thinking Trace

Functional Summary

UniProt Summary

InterPro Domains

GO Terms

Deep Research Falcon

Question

Gene Research for Functional Annotation

⚠️ CRITICAL: Gene/Protein Identification Context

Target Gene/Protein Identity (from UniProt):

MANDATORY VERIFICATION STEPS:

If Gene Symbol is Ambiguous or You Cannot Find Relevant Literature:

Research Target:

Output

Gene Research for Functional Annotation

⚠️ CRITICAL: Gene/Protein Identification Context

Target Gene/Protein Identity (from UniProt):

MANDATORY VERIFICATION STEPS:

If Gene Symbol is Ambiguous or You Cannot Find Relevant Literature:

Research Target:

Research Report: Mouse Bcl2 (UniProt P10417) — Functional Annotation and Translational Context

0) Target verification (mandatory)

1) Key concepts and definitions (current understanding)

1.1 Intrinsic (mitochondrial) apoptosis and MOMP

1.2 BCL-2 family logic: anti-apoptotic, effectors, and BH3-only proteins

1.3 Structural determinants: BH domains, hydrophobic groove, and TM helix

2) Bcl2 (P10417) molecular function in mouse (what it does)

2.1 Primary function: anti-apoptotic sequestration to prevent MOMP

2.2 Network context: BH3-only activators/sensitizers and effector activation

3) Subcellular localization: where BCL-2 acts

3.1 ER, MAM, and mitochondria localization (dynamic model)

3.2 TOM20-mediated transfer between ER/MAM and mitochondria

3.3 ER-localized regulation of calcium signaling via IP3R

4) Recent developments (prioritizing 2023–2024)

4.1 2024: Transmembrane-domain (TMD) interactions add BH3-independent regulation

4.2 2023: Expanding mechanistic views of pore-forming effectors and TM regulation

4.3 2023–2024: Clinical resistance mechanisms map back to BCL-2’s binding groove and network redundancy

5) Current applications and real-world implementations

5.1 BH3 mimetics (venetoclax) as a pathway-directed implementation of BCL-2 biology

5.2 Solid tumor drug-delivery implementation using a mouse model (2023)

6) Expert opinions and analysis (authoritative perspectives)

7) Recent statistics and data (2023–2024 prioritized)

7.1 AML outcomes and limitations (2024)

7.2 VIALE-A-type regimen outcome statistics (summarized in 2025 review but directly about the venetoclax+azacitidine standard)

7.3 CLL venetoclax response and resistance genetics (2024)

7.4 Quantitative in vivo delivery and pharmacodynamic effects (2023, mouse)

Summary for functional annotation (mouse Bcl2 / P10417)

Citations

Bioreason Rl Review

BioReason-Pro RL Review: Bcl2 (mouse)

Functional Summary Review

Notes on thinking trace

📄 View Raw YAML