Existing Annotations Review

References

GO_REF:0000002

Gene Ontology annotation through association of InterPro records with GO terms

GO_REF:0000008

Gene Ontology annotation by the MGI curatorial staff, curated orthology

GO_REF:0000024

Manual transfer of experimentally-verified manual GO annotation data to orthologs by curator judgment of sequence similarity

GO_REF:0000033

Annotation inferences using phylogenetic trees

GO_REF:0000043

Gene Ontology annotation based on UniProtKB/Swiss-Prot keyword mapping

GO_REF:0000096

Automated transfer of experimentally-verified manual GO annotation data to mouse-rat orthologs

GO_REF:0000107

Automatic transfer of experimentally verified manual GO annotation data to orthologs using Ensembl Compara

GO_REF:0000108

Automatic assignment of GO terms using logical inference, based on on inter-ontology links

GO_REF:0000117

Electronic Gene Ontology annotations created by ARBA machine learning models

GO_REF:0000119

Automated transfer of experimentally-verified manual GO annotation data to mouse-human orthologs

GO_REF:0000120

Combined Automated Annotation using Multiple IEA Methods

PMID:10193316

The bcl-2 knockout mouse exhibits marked changes in osteoblast phenotype and collagen deposition in bone as well as a mild growth plate phenotype.

PMID:10200548

Alterations in cell death and cell cycle progression in the UV-irradiated epidermis of bcl-2-deficient mice.

PMID:10321489

Retinal ganglion cell loss after the period of naturally occurring cell death in bcl-2-/- mice.

PMID:10488913

Targeted disruption of the bcl-2 gene in mice exacerbates focal ischemic brain injury.

PMID:10582606

Bax and Bcl-2 interaction in a transgenic mouse model of familial amyotrophic lateral sclerosis.

PMID:10597216

Bis, a Bcl-2-binding protein that synergizes with Bcl-2 in preventing cell death.

PMID:10602483

Damage-induced apoptosis in intestinal epithelia from bcl-2-null and bax-null mice: investigations of the mechanistic determinants of epithelial apoptosis in vivo.

PMID:10674380

Hair follicle apoptosis and Bcl-2.

PMID:10726970

Developmental changes in antioxidant enzymes and oxidative damage in kidneys, liver and brain of bcl-2 knockout mice.

PMID:10762311

Differences in bcl-2- and bax-independent function in regulating apoptosis in sensory neuron populations.

PMID:10815637

Effects of deficiency in p53 or bcl-2 on the sensitivity of clonogenic cells in the small intestine to low dose-rate irradiation.

PMID:11027399

Patterns of cell death in mouse anteroventral cochlear nucleus neurons after unilateral cochlea removal.

PMID:11146504

Pro- and anti-apoptotic members of the Bcl-2 family in skeletal muscle: a distinct role for Bcl-2 in later stages of myogenesis.

PMID:11226327

Bax ablation prevents dopaminergic neurodegeneration in the 1-methyl- 4-phenyl-1,2,3,6-tetrahydropyridine mouse model of Parkinson's disease.

PMID:11546872

Bmf: a proapoptotic BH3-only protein regulated by interaction with the myosin V actin motor complex, activated by anoikis.

PMID:11709185

Degenerative disorders caused by Bcl-2 deficiency prevented by loss of its BH3-only antagonist Bim.

PMID:11980919

Intrinsic and extrinsic pathway signaling during neuronal apoptosis: lessons from the analysis of mutant mice.

PMID:11983915

bcl-2 overexpression promotes myocyte proliferation.

PMID:12050152

A novel transactivating factor that regulates interferon-gamma-dependent gene expression.

PMID:12082633

Proapoptotic activity of ITM2B(s), a BH3-only protein induced upon IL-2-deprivation which interacts with Bcl-2.

PMID:12086670

Bcl2 regulation by the melanocyte master regulator Mitf modulates lineage survival and melanoma cell viability.

PMID:12420306

Sorting specificity of spermatogenic cell specific region of mouse hexokinase-s (mHk1-s).

PMID:12617961

Calcium-dependent interaction of calcineurin with Bcl-2 in neuronal tissue.

PMID:12855558

Bcl2 retards G1/S cell cycle transition by regulating intracellular ROS.

PMID:1373874

Bcl-2 confers growth and survival advantage to interleukin 7-dependent early pre-B cells which become factor independent by a multistep process in culture.

PMID:14551195

Targeted disruption of the PDZK1 gene in mice causes tissue-specific depletion of the high density lipoprotein receptor scavenger receptor class B type I and altered lipoprotein metabolism.

PMID:14651853

Integrated analysis of protein composition, tissue diversity, and gene regulation in mouse mitochondria.

PMID:14660795

Mono- and multisite phosphorylation enhances Bcl2's antiapoptotic function and inhibition of cell cycle entry functions.

PMID:14699151

Interaction of bcl-2 with Paxillin through its BH4 domain is important during ureteric bud branching.

PMID:14707049

TCR-independent and caspase-independent apoptosis of murine thymocytes by CD24 cross-linking.

PMID:15292044

Alterations in cell-adhesive and migratory properties of proximal tubule and collecting duct cells from bcl-2 -/- mice.

PMID:15613488

Proapoptotic BAX and BAK regulate the type 1 inositol trisphosphate receptor and calcium leak from the endoplasmic reticulum.

PMID:15776018

Proapoptotic BAX and BAK control multiple initiator caspases.

PMID:15818405

Polycystic kidney disease prevented by transgenic RNA interference.

PMID:15983387

Frag1, a homolog of alternative replication factor C subunits, links replication stress surveillance with apoptosis.

PMID:16095731

Increased anxiety-like behaviors and mitochondrial dysfunction in mice with targeted mutation of the Bcl-2 gene: further support for the involvement of mitochondrial function in anxiety disorders.

PMID:16282979

Loss of PKD1 and loss of Bcl-2 elicit polycystic kidney disease through distinct mechanisms.

PMID:16427619

Indispensable role of Bcl2 in the development of the melanocyte stem cell.

PMID:16509771

IAN family critically regulates survival and development of T lymphocytes.

PMID:16672320

Suppression of ureteric bud apoptosis rescues nephron endowment and adult renal function in Pax2 mutant mice.

PMID:16717086

PP2A regulates BCL-2 phosphorylation and proteasome-mediated degradation at the endoplasmic reticulum.

PMID:16839884

Mitochondrial rhomboid PARL regulates cytochrome c release during apoptosis via OPA1-dependent cristae remodeling.

PMID:16950491

Role of Bcl-2 expression for productive herpes simplex virus 2 replication.

PMID:17068116

Radiation-induced gastric epithelial apoptosis occurs in the proliferative zone and is regulated by p53, bak, bax, and bcl-2.

PMID:17267035

Regulation of the lifespan in dendritic cell subsets.

PMID:17382917

c-Myc is essential for urokinase plasminogen activator expression on hypoxia-induced vascular smooth muscle cells.

PMID:17475835

Involvement of heat shock protein (Hsp)90 beta but not Hsp90 alpha in antiapoptotic effect of CpG-B oligodeoxynucleotide.

PMID:17591857

Bim/Bcl-2 balance is critical for maintaining naive and memory T cell homeostasis.

PMID:18223655

Dual role of proapoptotic BAD in insulin secretion and beta cell survival.

PMID:18548006

Osteoclast size is controlled by Fra-2 through LIF/LIF-receptor signalling and hypoxia.

PMID:18614015

A mitochondrial protein compendium elucidates complex I disease biology.

PMID:20621101

Upregulation of Bcl2 inhibits apoptosis-driven BAX insertion but favors BAX relocalization in mitochondria.

PMID:20819940

Endogenous HMGB1 regulates autophagy.

PMID:21151042

Cyclic-AMP-dependent protein kinase A regulates apoptosis by stabilizing the BH3-only protein Bim.

PMID:22258505

Exercise-induced BCL2-regulated autophagy is required for muscle glucose homeostasis.

PMID:23629966

Deacetylation of p53 induces autophagy by suppressing Bmf expression.

PMID:26949185

BOK Is a Non-canonical BCL-2 Family Effector of Apoptosis Regulated by ER-Associated Degradation.

PMID:29020630

Degradation of Bcl-2 by XIAP and ARTS Promotes Apoptosis.

PMID:29849149

Disruption of the beclin 1-BCL2 autophagy regulatory complex promotes longevity in mice.

PMID:36812915

Exercise-activated hepatic autophagy via the FN1-α5β1 integrin pathway drives metabolic benefits of exercise.

PMID:7472523

Bcl-2 overexpression prevents motoneuron cell body loss but not axonal degeneration in a mouse model of a neurodegenerative disease.

PMID:7546744

Role of BCL-2 in the survival and function of developing and mature sympathetic neurons.

PMID:7563251

Differential regulation of bcl-2, bax, c-fos, junB, and krox-24 expression in the cerebellum of Purkinje cell degeneration mutant mice.

PMID:7595537

Bcl-2 protects neural cells from cyanide/aglycemia-induced lipid oxidation, mitochondrial injury, and loss of viability.

PMID:7628407

Ablation of bcl-2 gene expression decreases the numbers of oocytes and primordial follicles established in the post-natal female mouse gonad.

PMID:7650367

Expression of Bcl-2, Bcl-x, and Bax after T cell activation and IL-2 withdrawal.

PMID:7650488

Bcl-XL and Bcl-2 repress a common pathway of cell death.

PMID:7675327

Up-regulation of bax and down-regulation of bcl-2 is associated with kainate-induced apoptosis in mouse brain.

PMID:7751019

Apoptosis and Bcl-2 expression in cultured murine splenic T cells.

PMID:7772249

Evolutionary conservation of function among mammalian, avian, and viral homologs of the Bcl-2 oncoprotein.

PMID:7812968

bcl-2 deficiency in mice leads to pleiotropic abnormalities: accelerated lymphoid cell death in thymus and spleen, polycystic kidney, hair hypopigmentation, and distorted small intestine.

PMID:7834747

Cloning and functional analysis of BAG-1: a novel Bcl-2-binding protein with anti-cell death activity.

PMID:7834748

Bad, a heterodimeric partner for Bcl-XL and Bcl-2, displaces Bax and promotes cell death.

PMID:7840250

Fulminant metanephric apoptosis and abnormal kidney development in bcl-2-deficient mice.

PMID:7896880

The intracellular distribution and pattern of expression of Mcl-1 overlap with, but are not identical to, those of Bcl-2.

PMID:7945396

Bcl-2 overexpression abolishes early calcium waving preceding apoptosis in NIH-3T3 murine fibroblasts.

PMID:7953633

Expression of Bcl-2 protein in murine neural cells in culture.

PMID:8022822

Evidence that BCL-2 represses apoptosis by regulating endoplasmic reticulum-associated Ca2+ fluxes.

PMID:8030757

Bcl-2 protein expression during murine development.

PMID:8050499

bcl-2 gene prevents apoptosis of basic fibroblast growth factor-deprived murine aortic endothelial cells.

PMID:8080725

bcl-2 gene enables rescue from in vitro myelosuppression (bone marrow cell death) induced by chemotherapy.

PMID:8084613

Antisense oligonucleotides suppress B-cell lymphoma growth in a SCID-hu mouse model.

PMID:8170972

Targeted disruption of Bcl-2 alpha beta in mice: occurrence of gray hair, polycystic kidney disease, and lymphocytopenia.

PMID:8313913

Developmental regulation of the Bcl-2 protein and susceptibility to cell death in B lymphocytes.

PMID:8372353

Disappearance of the lymphoid system in Bcl-2 homozygous mutant chimeric mice.

PMID:8402909

Bcl-2-deficient mice demonstrate fulminant lymphoid apoptosis, polycystic kidneys, and hypopigmented hair.

PMID:8623928

Apoptosis during an early stage of nephrogenesis induces renal hypoplasia in bcl-2-deficient mice.

PMID:8625820

Bax promotes neuronal survival and antagonises the survival effects of neurotrophic factors.

PMID:8663032

Diminished cell proliferation associated with the death-protective activity of Bcl-2.

PMID:8755480

Inactivation of bcl-2 results in progressive degeneration of motoneurons, sympathetic and sensory neurons during early postnatal development.

PMID:8758925

Accelerated disappearance of melanocytes in bcl-2-deficient mice.

PMID:8760259

Abnormal postpartum renal development and cystogenesis in the bcl-2 (-/-) mouse.

PMID:8788039

Distinct patterns of Fas cell surface expression during development of T- or B-lymphocyte lineages in normal, scid, and mutant mice lacking or overexpressing p53, bcl-2, or rag-2 genes.

PMID:8918887

BID: a novel BH3 domain-only death agonist.

PMID:8949945

Bcl-2 prevents hippocampal cell death induced by the neuroleptic drug haloperidol.

PMID:9008714

Bcl-2 lies downstream of parathyroid hormone-related peptide in a signaling pathway that regulates chondrocyte maturation during skeletal development.

PMID:9009190

Bcl-2 promotes regeneration of severed axons in mammalian CNS.

PMID:9028316

Role of bcl-2 in the development of lymphoid cells from the hematopoietic stem cell.

PMID:9098922

Valproic acid-induced changes in gene expression during neurulation in a mouse model.

PMID:9153592

Susceptibility of cerebellar granule neurons derived from Bcl-2-deficient and transgenic mice to cell death.

PMID:9184696

The apoptosis and proliferation of SAC-activated B cells by IL-10 are associated with changes in Bcl-2, Bcl-xL, and Mcl-1 expression.

PMID:9202146

Differential involvement of caspases in apoptosis of myeloid leukemic cells induced by chemotherapy versus growth factor withdrawal.

PMID:9215624

Bcl-2 can rescue T lymphocyte development in interleukin-7 receptor-deficient mice but not in mutant rag-1-/- mice.

PMID:9241272

Bcl-2 and Bax function independently to regulate cell death.

PMID:9374413

Bcl-2 is required for cranial sensory neuron survival at defined stages of embryonic development.

PMID:9547242

Bcl-2 accelerates the maturation of early sensory neurons.

PMID:9560217

Bax directly induces release of cytochrome c from isolated mitochondria.

PMID:9681465

Enhanced oxidative stress and altered antioxidants in brains of Bcl-2-deficient mice.

PMID:9843949

Bax interacts with the permeability transition pore to induce permeability transition and cytochrome c release in isolated mitochondria.

PMID:9950951

Nuclear localization of beta-catenin and loss of apical brush border actin in cystic tubules of bcl-2 -/- mice.

📚 Additional Documentation

Deep Research Bioreason

(Bcl2-deep-research-bioreason.md)

BioReason Chat Export

Exported on March 22, 2026 at 03:12 AM

Organism: Mus musculus

Sequence:

MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Thinking Trace

I begin with the InterPro architecture. The sequence is saturated with Bcl-2 family signatures that define a canonical anti-apoptotic scaffold: IPR013278 (Apoptosis regulator, Bcl-2 family, residues 1–218) and IPR004725 (Apoptosis regulator, Bcl-2/Bcl-X family, residues 4–236) frame the entire polypeptide as a member of the eukaryotic apoptosis-regulatory module. This is reinforced by IPR026298 (Bcl-2 family, residues 5–202) and the broader IPR036834 (Bcl-2-like superfamily, residues 6–220), indicating a conserved helical bundle fold used for regulated protein–protein interactions. The N-terminal IPR003093 (BH4 domain, residues 7–33) together with its conserved site IPR020731 (BH4 motif, residues 10–30) establishes an amphipathic helix that stabilizes anti-apoptotic activity and modulates binding affinity. The central-to-C-terminal core displays the hallmark BH1–BH3 module: IPR046371 (Bcl-2 homology region 1–3, residues 94–192) and IPR002475 (Bcl2-like, residues 94–194) define the canonical hydrophobic groove that recognizes BH3 motifs from other Bcl-2 family members. This binding platform is specified by three conserved-site annotations: IPR020728 (BH3 motif conserved site, residues 90–104), IPR020717 (BH1 motif conserved site, residues 134–152), and IPR020726 (BH2 motif conserved site, residues 185–196). The ordered presence of BH4 followed by BH1–BH3 establishes the classic anti-apoptotic architecture that sequesters pro-apoptotic partners and prevents mitochondrial outer membrane permeabilization.

From this architecture, the molecular function resolves as protein binding mediated by a BH-groove that captures BH3-containing ligands. The BH1–BH3 core (IPR046371/IPR002475) generates a hydrophobic cleft that binds pro-apoptotic effectors; thus the primary function is high-specificity protein binding that inhibits assembly of apoptotic complexes—captured by GO:0005515 molecular function as the operative biochemical capability of this fold.

This binding-driven mechanism causes anti-apoptotic regulation at the level of mitochondrial outer membrane integrity. By sequestering BH3-only activators and multi-domain effectors, the protein prevents pore formation and cytochrome c release, thereby blocking downstream caspase activation. This situates the protein squarely in the biological process of apoptosis control, most parsimoniously formalized as GO:0006915 apoptotic process, with directionality toward suppression of execution pathways.

Cellular placement follows from both the domain logic and the annotated subcellular distribution. Anti-apoptotic Bcl-2 modules commonly associate peripherally with membranes via their helical bundle and C-terminal amphipathic elements; here, the annotation specifies cytoplasm and cytoplasmic vesicles, with peripheral membrane association. This soluble/peripheral distribution is consistent with a regulator that shuttles between cytosol and vesicular surfaces to intercept BH3-only ligands and restrain mitochondrial pathway priming. Thus the cellular component is best captured by cytoplasm and cytoplasmic vesicle, with a peripheral membrane mode of association.

Mechanistically, the BH4–BH1–BH3 ensemble forms a modular trap that binds BH3-containing partners, preventing assembly of pro-apoptotic complexes. I hypothesize interactions with pro-apoptotic Bcl-2 family members that present BH3 motifs (such as effectors and sensitizers), with mitochondrial pathway adaptors at vesicle–mitochondria interfaces, and with cytosolic caspase-activating assemblies. The vesicle-proximal pool likely buffers apoptotic triggers by transiently sequestering BH3-only ligands before they reach mitochondria, thereby tuning the threshold for apoptosis initiation.

Functional Summary

An anti-apoptotic regulator in mouse that uses a conserved helical bundle to bind and neutralize pro-apoptotic partners. By assembling a BH domain platform that captures BH3-containing ligands, it prevents mitochondrial pathway activation and caspase engagement. The protein operates predominantly in the cytoplasm and on cytoplasmic vesicles as a peripheral membrane factor, where it sequesters apoptotic triggers and tunes the threshold for apoptosis initiation.

UniProt Summary

May prevent apoptosis.

InterPro Domains

Apoptosis regulator, Bcl-2 (IPR013278, family) — residues 1-218
Apoptosis regulator, Bcl-2/ BclX (IPR004725, family) — residues 4-236
Bcl-2 family (IPR026298, family) — residues 5-202
Bcl-2-like superfamily (IPR036834, homologous_superfamily) — residues 6-220
Apoptosis regulator, Bcl-2 protein, BH4 (IPR003093, domain) — residues 7-33
Apoptosis regulator, Bcl-2, BH4 motif, conserved site (IPR020731, conserved_site) — residues 10-30
Apoptosis regulator, Bcl-2, BH3 motif, conserved site (IPR020728, conserved_site) — residues 90-104
Bcl2-like (IPR002475, family) — residues 94-194
Bcl-2, Bcl-2 homology region 1-3 (IPR046371, domain) — residues 94-192
Apoptosis regulator, Bcl-2, BH1 motif, conserved site (IPR020717, conserved_site) — residues 134-152
Apoptosis regulator, Bcl-2, BH2 motif, conserved site (IPR020726, conserved_site) — residues 185-196

GO Terms

Molecular Function: molecular_function (GO:0003674), binding (GO:0005488), protein binding (GO:0005515), enzyme binding (GO:0019899), phosphatase binding (GO:0019902), protein phosphatase binding (GO:0019903), protein phosphatase 2A binding (GO:0051721)

Biological Process: biological_process (GO:0008150), localization (GO:0051179), signaling (GO:0023052), biological regulation (GO:0065007), response to stimulus (GO:0050896), pigmentation (GO:0043473), reproductive process (GO:0022414), growth (GO:0040007), negative regulation of biological process (GO:0048519), positive regulation of biological process (GO:0048518), regulation of biological process (GO:0050789), reproduction (GO:0000003), multicellular organismal process (GO:0032501), developmental process (GO:0032502), cellular process (GO:0009987), metabolic process (GO:0008152), homeostatic process (GO:0042592), immune system process (GO:0002376), sexual reproduction (GO:0019953), cellular localization (GO:0051641), anatomical structure development (GO:0048856), negative regulation of signaling (GO:0023057), molting cycle (GO:0042303), cell cycle process (GO:0022402), positive regulation of multicellular organismal process (GO:0051240), cellular component organization or biogenesis (GO:0071840), regulation of multicellular organismal process (GO:0051239), secondary metabolic process (GO:0019748), developmental process involved in reproduction (GO:0003006), multicellular organismal-level homeostasis (GO:0048871), negative regulation of metabolic process (GO:0009892), regulation of biological quality (GO:0065008), cellular homeostasis (GO:0019725), cellular process involved in reproduction in multicellular organism (GO:0022412), multicellular organismal response to stress (GO:0033555), cellular pigmentation (GO:0033059), regulation of cellular process (GO:0050794), regulation of response to stimulus (GO:0048583), cellular response to stimulus (GO:0051716), developmental maturation (GO:0021700), leukocyte homeostasis (GO:0001776), negative regulation of cellular process (GO:0048523), regulation of locomotion (GO:0040012), cellular developmental process (GO:0048869), response to abiotic stimulus (GO:0009628), organ growth (GO:0035265), regulation of metabolic process (GO:0019222), establishment of localization (GO:0051234), molting cycle process (GO:0022404), ossification (GO:0001503), regulation of molecular function (GO:0065009), actin filament-based process (GO:0030029), cell communication (GO:0007154), positive regulation of cellular process (GO:0048522), response to external stimulus (GO:0009605), developmental growth (GO:0048589), anatomical structure morphogenesis (GO:0009653), response to chemical (GO:0042221), cell motility (GO:0048870), transmembrane transport (GO:0055085), leukocyte activation (GO:0045321), cell population proliferation (GO:0008283), pigment metabolic process (GO:0042440), nitrogen compound metabolic process (GO:0006807), negative regulation of multicellular organismal process (GO:0051241), multicellular organism reproduction (GO:0032504), positive regulation of growth (GO:0045927), post-embryonic development (GO:0009791), regulation of developmental process (GO:0050793), response to endogenous stimulus (GO:0009719), cell death (GO:0008219), positive regulation of locomotion (GO:0040017), negative regulation of locomotion (GO:0040013), positive regulation of developmental pigmentation (GO:0048087), regulation of signaling (GO:0023051), negative regulation of developmental process (GO:0051093), developmental pigmentation (GO:0048066), signal transduction (GO:0007165), cell activation (GO:0001775), multicellular organism development (GO:0007275), negative regulation of transport (GO:0051051), behavior (GO:0007610), cell adhesion (GO:0007155), regulation of localization (GO:0032879), cell cycle (GO:0007049), organic substance metabolic process (GO:0071704), T cell selection (GO:0045058), system process (GO:0003008), chemical homeostasis (GO:0048878), cellular metabolic process (GO:0044237), immune system development (GO:0002520), positive regulation of metabolic process (GO:0009893), regulation of pigmentation (GO:0120305), regulation of viral process (GO:0050792), response to stress (GO:0006950), negative regulation of growth (GO:0045926), morphogenesis of a branching structure (GO:0001763), positive regulation of developmental process (GO:0051094), multicellular organismal reproductive process (GO:0048609), negative regulation of response to stimulus (GO:0048585), regulation of growth (GO:0040008), primary metabolic process (GO:0044238), cellular component morphogenesis (GO:0032989), response to acid chemical (GO:0001101), hair cycle (GO:0042633), cellular component biogenesis (GO:0044085), regulation of cell motility (GO:2000145), reactive oxygen species metabolic process (GO:0072593), response to radiation (GO:0009314), animal organ development (GO:0048513), pons development (GO:0021548), regulation of signal transduction (GO:0009966), behavioral defense response (GO:0002209), regulation of macromolecule metabolic process (GO:0060255), regulation of response to external stimulus (GO:0032101), cellular aromatic compound metabolic process (GO:0006725), monoatomic ion transmembrane transport (GO:0034220), negative regulation of cell cycle process (GO:0010948), response to hormone (GO:0009725), intracellular chemical homeostasis (GO:0055082), response to inorganic substance (GO:0010035), intracellular transport (GO:0046907), positive T cell selection (GO:0043368), regulation of membrane potential (GO:0042391), negative regulation of cell cycle (GO:0045786), cellular response to extracellular stimulus (GO:0031668), nephron development (GO:0072006), regulation of cell cycle process (GO:0010564), melanin metabolic process (GO:0006582), positive regulation of nitrogen compound metabolic process (GO:0051173), regulation of membrane permeability (GO:0090559), positive regulation of cell differentiation (GO:0045597), regulation of catalytic activity (GO:0050790), germ cell development (GO:0007281), positive regulation of molecular function (GO:0044093), positive regulation of macromolecule metabolic process (GO:0010604), positive regulation of muscle tissue development (GO:1901863), regulation of cellular localization (GO:0060341), negative regulation of cell population proliferation (GO:0008285), protein metabolic process (GO:0019538), regulation of cell growth (GO:0001558), hindbrain development (GO:0030902), establishment of localization in cell (GO:0051649), response to oxygen-containing compound (GO:1901700), regulation of protein stability (GO:0031647), regulation of developmental pigmentation (GO:0048070), positive regulation of developmental growth (GO:0048639), macromolecule metabolic process (GO:0043170), positive regulation of cell motility (GO:2000147), homeostasis of number of cells (GO:0048872), muscle structure development (GO:0061061), regulation of cell population proliferation (GO:0042127), regulation of cell death (GO:0010941), response to starvation (GO:0042594), response to nitrogen compound (GO:1901698), regulation of multicellular organism growth (GO:0040014), positive regulation of cellular metabolic process (GO:0031325), cellular response to stress (GO:0033554), transport (GO:0006810), negative regulation of monoatomic ion transport (GO:0043271), regulation of cellular metabolic process (GO:0031323), negative regulation of catabolic process (GO:0009895), ovarian follicle development (GO:0001541), hair cycle process (GO:0022405), regulation of primary metabolic process (GO:0080090), male sex differentiation (GO:0046661), regulation of muscle tissue development (GO:1901861), positive regulation of multicellular organism growth (GO:0040018), lymphocyte homeostasis (GO:0002260), response to hypoxia (GO:0001666), negative regulation of signal transduction (GO:0009968), regulation of viral genome replication (GO:0045069), programmed cell death (GO:0012501), tissue morphogenesis (GO:0048729), negative regulation of cell death (GO:0060548), cell development (GO:0048468), response to xenobiotic stimulus (GO:0009410), cell differentiation (GO:0030154), inorganic ion transmembrane transport (GO:0098660), system development (GO:0048731), response to oxygen levels (GO:0070482), regulation of cell adhesion (GO:0030155), renal system process (GO:0003014), development of primary sexual characteristics (GO:0045137), negative regulation of ossification (GO:0030279), lymphocyte activation (GO:0046649), neuron death (GO:0070997), phosphorus metabolic process (GO:0006793), anatomical structure maturation (GO:0071695), negative regulation of transmembrane transport (GO:0034763), tube development (GO:0035295), regulation of cell cycle (GO:0051726), cell morphogenesis (GO:0000902), regulation of catabolic process (GO:0009894), regulation of retinal cell programmed cell death (GO:0046668), animal organ morphogenesis (GO:0009887), organic cyclic compound metabolic process (GO:1901360), positive regulation of cytosolic calcium ion concentration (GO:0007204), cell maturation (GO:0048469), apoptotic signaling pathway (GO:0097190), negative regulation of cell growth (GO:0030308), negative regulation of cytosolic calcium ion concentration (GO:0051481), nephron morphogenesis (GO:0072028), regulation of nitrogen compound metabolic process (GO:0051171), programmed cell death involved in cell development (GO:0010623), hair follicle development (GO:0001942), regulation of cell differentiation (GO:0045595), cellular component organization (GO:0016043), cell surface receptor signaling pathway (GO:0007166), oocyte differentiation (GO:0009994), sex differentiation (GO:0007548), pigment granule organization (GO:0048753), regulation of cellular component organization (GO:0051128), reproductive structure development (GO:0048608), cellular response to external stimulus (GO:0071496), regulation of ossification (GO:0030278), cell-substrate adhesion (GO:0031589), regulation of developmental growth (GO:0048638), positive regulation of cell population proliferation (GO:0008284), cell migration (GO:0016477), negative regulation of cell motility (GO:2000146), tube morphogenesis (GO:0035239), female sex differentiation (GO:0046660), monoatomic ion homeostasis (GO:0050801), gamete generation (GO:0007276), organic hydroxy compound metabolic process (GO:1901615), negative regulation of cell communication (GO:0010648), regulation of transport (GO:0051049), organonitrogen compound metabolic process (GO:1901564), mitotic cell cycle process (GO:1903047), intracellular signal transduction (GO:0035556), response to wounding (GO:0009611), cell-cell adhesion (GO:0098609), response to oxidative stress (GO:0006979), hair follicle morphogenesis (GO:0031069), response to toxic substance (GO:0009636), regulation of transmembrane transport (GO:0034762), defense response (GO:0006952), morphogenesis of a branching epithelium (GO:0061138), inorganic ion homeostasis (GO:0098771), fear response (GO:0042596), cell death in response to oxidative stress (GO:0036473), neural nucleus development (GO:0048857), negative regulation of cellular metabolic process (GO:0031324), metencephalon development (GO:0022037), actin cytoskeleton organization (GO:0030036), signal transduction in absence of ligand (GO:0038034), response to organic substance (GO:0010033), anatomical structure homeostasis (GO:0060249), response to extracellular stimulus (GO:0009991), cell fate commitment (GO:0045165), regulation of viral life cycle (GO:1903900), tissue development (GO:0009888), head development (GO:0060322), regulation of cell communication (GO:0010646), cellular response to chemical stimulus (GO:0070887), regulation of calcium ion transport into cytosol (GO:0010522), regulation of biosynthetic process (GO:0009889), cell cycle phase transition (GO:0044770), pigment cell differentiation (GO:0050931), glomerulus development (GO:0032835), tissue homeostasis (GO:0001894), hematopoietic or lymphoid organ development (GO:0048534), regeneration (GO:0031099), mitotic cell cycle (GO:0000278), response to ischemia (GO:0002931), epithelial tube morphogenesis (GO:0060562), nephron epithelium development (GO:0072009), cell projection organization (GO:0030030), T cell lineage commitment (GO:0002360), regulation of macromolecule biosynthetic process (GO:0010556), cellular response to oxygen levels (GO:0071453), regulation of protein metabolic process (GO:0051246), cell cycle G1/S phase transition (GO:0044843), sensory system development (GO:0048880), negative regulation of reactive oxygen species metabolic process (GO:2000378), response to steroid hormone (GO:0048545), gonad development (GO:0008406), melanocyte differentiation (GO:0030318), B cell homeostasis (GO:0001782), development of primary male sexual characteristics (GO:0046546), neuron projection regeneration (GO:0031102), regulation of mitochondrial membrane potential (GO:0051881), kidney morphogenesis (GO:0060993), thymus development (GO:0048538), regulation of gene expression (GO:0010468), phenol-containing compound metabolic process (GO:0018958), cell-matrix adhesion (GO:0007160), regulation of cell maturation (GO:1903429), macromolecule modification (GO:0043412), negative regulation of autophagy (GO:0010507), muscle cell differentiation (GO:0042692), oocyte development (GO:0048599), response to decreased oxygen levels (GO:0036293), negative regulation of mitotic cell cycle (GO:0045930), positive regulation of cell migration (GO:0030335), intrinsic apoptotic signaling pathway (GO:0097193), mesonephric tubule development (GO:0072164), hematopoietic progenitor cell differentiation (GO:0002244), positive regulation of catalytic activity (GO:0043085), cell projection morphogenesis (GO:0048858), B cell activation (GO:0042113), actin filament organization (GO:0007015), mitochondrial transport (GO:0006839), cellular response to hypoxia (GO:0071456), response to light stimulus (GO:0009416), extrinsic apoptotic signaling pathway in absence of ligand (GO:0097192), leukocyte differentiation (GO:0002521), regulation of reactive oxygen species metabolic process (GO:2000377), cellular response to DNA damage stimulus (GO:0006974), cellular response to organic substance (GO:0071310), muscle cell development (GO:0055001), cellular response to chemical stress (GO:0062197), regulation of monoatomic ion transmembrane transport (GO:0034765), regulation of cell development (GO:0060284), sensory organ development (GO:0007423), oogenesis (GO:0048477), regulation of autophagy (GO:0010506), regulation of neuron death (GO:1901214), negative regulation of apoptotic signaling pathway (GO:2001234), regulation of protein localization (GO:0032880), intracellular monoatomic ion homeostasis (GO:0006873), regulation of muscle cell differentiation (GO:0051147), CD4-positive or CD8-positive, alpha-beta T cell lineage commitment (GO:0043369), protein modification process (GO:0036211), neurogenesis (GO:0022008), inorganic cation transmembrane transport (GO:0098662), neuron apoptotic process (GO:0051402), behavioral fear response (GO:0001662), response to lipid (GO:0033993), organic substance transport (GO:0071702), muscle tissue development (GO:0060537), apoptotic process (GO:0006915), regulation of cellular biosynthetic process (GO:0031326), T cell homeostasis (GO:0043029), regulation of osteoblast proliferation (GO:0033688), extrinsic apoptotic signaling pathway (GO:0097191), response to hydrogen peroxide (GO:0042542), muscle organ development (GO:0007517), epithelium development (GO:0060429), cell junction organization (GO:0034330), gland morphogenesis (GO:0022612), cellular response to nutrient levels (GO:0031669), supramolecular fiber organization (GO:0097435), response to reactive oxygen species (GO:0000302), negative regulation of cell cycle phase transition (GO:1901988), cellular response to oxidative stress (GO:0034599), monoatomic cation transmembrane transport (GO:0098655), regulation of neuron differentiation (GO:0045664), stem cell development (GO:0048864), regulation of mitotic cell cycle (GO:0007346), digestive system development (GO:0055123), negative regulation of programmed cell death (GO:0043069), regulation of programmed cell death (GO:0043067), regulation of cell-substrate adhesion (GO:0010810), negative regulation of cellular catabolic process (GO:0031330), cell part morphogenesis (GO:0032990), nephron epithelium morphogenesis (GO:0072088), gland development (GO:0048732), sensory organ morphogenesis (GO:0090596), morphogenesis of an epithelium (GO:0002009), skin development (GO:0043588), regulation of cell migration (GO:0030334), spleen development (GO:0048536), lymphocyte differentiation (GO:0030098), neuron development (GO:0048666), branching morphogenesis of an epithelial tube (GO:0048754), cellular component assembly (GO:0022607), brain development (GO:0007420), positive regulation of skeletal muscle tissue development (GO:0048643), cell morphogenesis involved in differentiation (GO:0000904), renal tubule development (GO:0061326), regulation of skeletal muscle tissue development (GO:0048641), nervous system development (GO:0007399), negative regulation of monoatomic ion transmembrane transport (GO:0034766), female gamete generation (GO:0007292), epidermis development (GO:0008544), response to nutrient levels (GO:0031667), central nervous system development (GO:0007417), positive regulation of cell maturation (GO:1903431), mesenchymal cell differentiation (GO:0048762), response to ionizing radiation (GO:0010212), release of cytochrome c from mitochondria (GO:0001836), muscle cell migration (GO:0014812), membrane organization (GO:0061024), renal system development (GO:0072001), hemopoiesis (GO:0030097), reproductive system development (GO:0061458), response to cytokine (GO:0034097), negative regulation of neuron death (GO:1901215), neuron maturation (GO:0042551), response to amino acid (GO:0043200), positive regulation of phosphorus metabolic process (GO:0010562), cellular response to starvation (GO:0009267), positive regulation of cell development (GO:0010720), phosphate-containing compound metabolic process (GO:0006796), mesenchyme development (GO:0060485), regulation of glycoprotein metabolic process (GO:1903018), regulation of apoptotic signaling pathway (GO:2001233), digestive tract morphogenesis (GO:0048546), monoatomic ion transport (GO:0006811), regulation of response to extracellular stimulus (GO:0032104), calcium ion homeostasis (GO:0055074), negative regulation of cell migration (GO:0030336), response to axon injury (GO:0048678), positive regulation of muscle cell differentiation (GO:0051149), mitotic cell cycle phase transition (GO:0044772), regulation of mitochondrial membrane permeability (GO:0046902), stem cell differentiation (GO:0048863), intrinsic apoptotic signaling pathway in response to oxidative stress (GO:0008631), monoatomic cation homeostasis (GO:0055080), response to organonitrogen compound (GO:0010243), development of primary female sexual characteristics (GO:0046545), regulation of cell cycle phase transition (GO:1901987), calcium ion transport into cytosol (GO:0060402), positive regulation of protein metabolic process (GO:0051247), T cell activation (GO:0042110), negative regulation of calcium ion transport (GO:0051926), response to organic cyclic compound (GO:0014070), homeostasis of number of cells within a tissue (GO:0048873), regulation of monoatomic ion transport (GO:0043269), regulation of cellular catabolic process (GO:0031329), organelle organization (GO:0006996), kidney development (GO:0001822), digestive tract development (GO:0048565), neuron differentiation (GO:0030182), regulation of phosphorus metabolic process (GO:0051174), nephron tubule development (GO:0072080), mitochondrion organization (GO:0007005), regulation of apoptotic process (GO:0042981), female gonad development (GO:0008585), mesonephros development (GO:0001823), response to corticosteroid (GO:0031960), vesicle organization (GO:0016050), positive regulation of phosphate metabolic process (GO:0045937), ear development (GO:0043583), regulation of cell-matrix adhesion (GO:0001952), plasma membrane bounded cell projection morphogenesis (GO:0120039), skin epidermis development (GO:0098773), regulation of neuron apoptotic process (GO:0043523), peptidyl-amino acid modification (GO:0018193), cell junction assembly (GO:0034329), phosphorylation (GO:0016310), intracellular monoatomic cation homeostasis (GO:0030003), skeletal muscle tissue development (GO:0007519), renal tubule morphogenesis (GO:0061333), regulation of neuron maturation (GO:0014041), branching involved in ureteric bud morphogenesis (GO:0001658), intrinsic apoptotic signaling pathway in response to DNA damage (GO:0008630), negative regulation of neuron apoptotic process (GO:0043524), regulation of cellular macromolecule biosynthetic process (GO:2000112), negative regulation of calcium ion transmembrane transport (GO:1903170), regulation of monoatomic cation transmembrane transport (GO:1904062), cellular response to glucose starvation (GO:0042149), intracellular calcium ion homeostasis (GO:0006874), epithelial cell apoptotic process (GO:1904019), positive regulation of protein modification process (GO:0031401), positive regulation of smooth muscle cell migration (GO:0014911), dephosphorylation (GO:0016311), positive regulation of neuron maturation (GO:0014042), kidney epithelium development (GO:0072073), plasma membrane bounded cell projection organization (GO:0120036), negative regulation of cation transmembrane transport (GO:1904063), regulation of smooth muscle cell migration (GO:0014910), response to gamma radiation (GO:0010332), calcium ion transmembrane transport (GO:0070588), male gonad development (GO:0008584), regulation of response to nutrient levels (GO:0032107), neuron projection development (GO:0031175), alpha-beta T cell lineage commitment (GO:0002363), focal adhesion assembly (GO:0048041), negative regulation of cell cycle G1/S phase transition (GO:1902807), myeloid cell apoptotic process (GO:0033028), nephron tubule morphogenesis (GO:0072078), alpha-beta T cell activation (GO:0046631), eye morphogenesis (GO:0048592), monoatomic cation transport (GO:0006812), apoptotic mitochondrial changes (GO:0008637), metanephros development (GO:0001656), protein dephosphorylation (GO:0006470), regulation of metal ion transport (GO:0010959), visual system development (GO:0150063), regulation of glycoprotein biosynthetic process (GO:0010559), cytoskeleton organization (GO:0007010), epidermis morphogenesis (GO:0048730), G1/S transition of mitotic cell cycle (GO:0000082), mononuclear cell differentiation (GO:1903131), response to UV (GO:0009411), ureteric bud development (GO:0001657), generation of neurons (GO:0048699), mitochondrial membrane organization (GO:0007006), mesonephric tubule morphogenesis (GO:0072171), cell morphogenesis involved in neuron differentiation (GO:0048667), eye development (GO:0001654), regulation of protein modification process (GO:0031399), T cell differentiation (GO:0030217), smooth muscle cell migration (GO:0014909), negative regulation of mitotic cell cycle phase transition (GO:1901991), hematopoietic stem cell differentiation (GO:0060218), skeletal muscle organ development (GO:0060538)

Cellular Component: cellular_component (GO:0005575), cellular anatomical entity (GO:0110165), intracellular anatomical structure (GO:0005622), organelle (GO:0043226), membrane (GO:0016020), cytosol (GO:0005829), organelle subcompartment (GO:0031984), myelin sheath (GO:0043209), envelope (GO:0031975), cytoplasm (GO:0005737), endomembrane system (GO:0012505), organelle membrane (GO:0031090), organelle envelope (GO:0031967), intracellular organelle (GO:0043229), endoplasmic reticulum subcompartment (GO:0098827), nuclear outer membrane-endoplasmic reticulum membrane network (GO:0042175), mitochondrion (GO:0005739), endoplasmic reticulum (GO:0005783), nuclear envelope (GO:0005635), membrane-bounded organelle (GO:0043227), nuclear membrane (GO:0031965), mitochondrial envelope (GO:0005740), intracellular membrane-bounded organelle (GO:0043231), endoplasmic reticulum membrane (GO:0005789), mitochondrial membrane (GO:0031966), nucleus (GO:0005634)

Generated by BioReason

Deep Research Bioreason Rl

(Bcl2-deep-research-bioreason-rl.md)

BioReason Chat Export

Exported on March 22, 2026 at 03:12 AM

Organism: Mus musculus

Sequence:

MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Thinking Trace

Functional Summary

UniProt Summary

May prevent apoptosis.

InterPro Domains

Apoptosis regulator, Bcl-2 (IPR013278, family) — residues 1-218
Apoptosis regulator, Bcl-2/ BclX (IPR004725, family) — residues 4-236
Bcl-2 family (IPR026298, family) — residues 5-202
Bcl-2-like superfamily (IPR036834, homologous_superfamily) — residues 6-220
Apoptosis regulator, Bcl-2 protein, BH4 (IPR003093, domain) — residues 7-33
Apoptosis regulator, Bcl-2, BH4 motif, conserved site (IPR020731, conserved_site) — residues 10-30
Apoptosis regulator, Bcl-2, BH3 motif, conserved site (IPR020728, conserved_site) — residues 90-104
Bcl2-like (IPR002475, family) — residues 94-194
Bcl-2, Bcl-2 homology region 1-3 (IPR046371, domain) — residues 94-192
Apoptosis regulator, Bcl-2, BH1 motif, conserved site (IPR020717, conserved_site) — residues 134-152
Apoptosis regulator, Bcl-2, BH2 motif, conserved site (IPR020726, conserved_site) — residues 185-196

GO Terms

Generated by BioReason

Bioreason Rl Review

(Bcl2-bioreason-rl-review.md)

BioReason-Pro RL Review: Bcl2 (mouse)

Source: Bcl2-deep-research-bioreason-rl.md

Correctness: 4/5
Completeness: 3/5

Functional Summary Review

The BioReason functional summary captures the essential anti-apoptotic role:

An anti-apoptotic regulator in mouse that uses a conserved helical bundle to bind and neutralize pro-apoptotic partners. By assembling a BH domain platform that captures BH3-containing ligands, it prevents mitochondrial pathway activation and caspase engagement. The protein operates predominantly in the cytoplasm and on cytoplasmic vesicles as a peripheral membrane factor, where it sequesters apoptotic triggers and tunes the threshold for apoptosis initiation.

This is largely correct. The identification of the BH1-BH4 domain architecture and the mechanism of sequestering pro-apoptotic BH3-only proteins is accurate and aligns with GO:0006915 (apoptotic process) and GO:0043066 (negative regulation of apoptotic process). The description of Bcl2 as preventing mitochondrial outer membrane permeabilization (MOMP) is the established canonical mechanism.

However, there is a notable localization inaccuracy. BioReason describes Bcl2 as operating "predominantly in the cytoplasm and on cytoplasmic vesicles as a peripheral membrane factor." In reality, Bcl2 is primarily an integral membrane protein anchored to the mitochondrial outer membrane, ER membrane, and nuclear envelope via its C-terminal transmembrane domain. The curated review lists GO:0005741 (mitochondrial outer membrane) as a key IBA annotation. Describing it as a "peripheral membrane factor" on "cytoplasmic vesicles" is misleading -- Bcl2 has a bona fide transmembrane anchor, not merely a peripheral association.

The summary also omits Bcl2's roles beyond apoptosis, including regulation of autophagy, calcium homeostasis at the ER, and its emerging roles in cellular metabolism. These are secondary functions but contribute to completeness.

Comparison with interpro2go:

The curated review has one GO_REF:0000002 annotation: GO:0042981 (regulation of apoptotic process). BioReason's functional summary is consistent with this but goes further by specifying the anti-apoptotic direction and the BH3-sequestration mechanism. BioReason does not recapitulate the interpro2go error pattern -- instead it adds mechanistic depth. However, both BioReason and interpro2go miss the transmembrane anchoring, with BioReason actively getting it wrong by calling the protein a "peripheral membrane factor."

Notes on thinking trace

The trace correctly interprets the BH4-BH3-BH1-BH2 domain order and the hydrophobic groove. However, it appears to have missed or ignored the C-terminal transmembrane anchor (not represented in InterPro annotations shown), leading to the peripheral membrane mischaracterization. The reasoning about "vesicle-proximal pool" buffering apoptotic triggers is speculative and not well-supported.

📄 View Raw YAML

id: P10417
gene_symbol: Bcl2
product_type: PROTEIN
status: INITIALIZED
taxon:
  id: NCBITaxon:10090
  label: Mus musculus
description: 'TODO: Add description for Bcl2'
existing_annotations:
  - term:
      id: GO:0043065
      label: positive regulation of apoptotic process
    evidence_type: IBA
    original_reference_id: GO_REF:0000033
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0097192
      label: extrinsic apoptotic signaling pathway in absence of ligand
    evidence_type: IBA
    original_reference_id: GO_REF:0000033
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0005741
      label: mitochondrial outer membrane
    evidence_type: IBA
    original_reference_id: GO_REF:0000033
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0008630
      label: intrinsic apoptotic signaling pathway in response to DNA damage
    evidence_type: IBA
    original_reference_id: GO_REF:0000033
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0015267
      label: channel activity
    evidence_type: IBA
    original_reference_id: GO_REF:0000033
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0001836
      label: release of cytochrome c from mitochondria
    evidence_type: IBA
    original_reference_id: GO_REF:0000033
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0055085
      label: transmembrane transport
    evidence_type: IEA
    original_reference_id: GO_REF:0000108
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0001541
      label: ovarian follicle development
    evidence_type: IEA
    original_reference_id: GO_REF:0000117
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0002931
      label: response to ischemia
    evidence_type: IEA
    original_reference_id: GO_REF:0000117
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0005737
      label: cytoplasm
    evidence_type: IEA
    original_reference_id: GO_REF:0000120
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0005741
      label: mitochondrial outer membrane
    evidence_type: IEA
    original_reference_id: GO_REF:0000120
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0005789
      label: endoplasmic reticulum membrane
    evidence_type: IEA
    original_reference_id: GO_REF:0000120
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0006914
      label: autophagy
    evidence_type: IEA
    original_reference_id: GO_REF:0000043
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0006915
      label: apoptotic process
    evidence_type: IEA
    original_reference_id: GO_REF:0000043
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0008630
      label: intrinsic apoptotic signaling pathway in response to DNA damage
    evidence_type: IEA
    original_reference_id: GO_REF:0000117
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0008637
      label: apoptotic mitochondrial changes
    evidence_type: IEA
    original_reference_id: GO_REF:0000117
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0016020
      label: membrane
    evidence_type: IEA
    original_reference_id: GO_REF:0000120
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0031965
      label: nuclear membrane
    evidence_type: IEA
    original_reference_id: GO_REF:0000120
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0031966
      label: mitochondrial membrane
    evidence_type: IEA
    original_reference_id: GO_REF:0000117
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0042981
      label: regulation of apoptotic process
    evidence_type: IEA
    original_reference_id: GO_REF:0000002
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IEA
    original_reference_id: GO_REF:0000120
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0051384
      label: response to glucocorticoid
    evidence_type: IEA
    original_reference_id: GO_REF:0000117
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0071456
      label: cellular response to hypoxia
    evidence_type: IEA
    original_reference_id: GO_REF:0000117
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0097192
      label: extrinsic apoptotic signaling pathway in absence of ligand
    evidence_type: IEA
    original_reference_id: GO_REF:0000117
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:16509771
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:16509771
          supporting_text: Mar 7. IAN family critically regulates survival and 
            development of T lymphocytes.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:16839884
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:16839884
          supporting_text: Mitochondrial rhomboid PARL regulates cytochrome c 
            release during apoptosis via OPA1-dependent cristae remodeling.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:20621101
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:20621101
          supporting_text: Epub 2010 Jul 14. Upregulation of Bcl2 inhibits 
            apoptosis-driven BAX insertion but favors BAX relocalization in 
            mitochondria.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:20819940
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:20819940
          supporting_text: Endogenous HMGB1 regulates autophagy.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:21151042
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:21151042
          supporting_text: Cyclic-AMP-dependent protein kinase A regulates 
            apoptosis by stabilizing the BH3-only protein Bim.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:22258505
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:22258505
          supporting_text: Exercise-induced BCL2-regulated autophagy is required
            for muscle glucose homeostasis.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:29849149
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:29849149
          supporting_text: May 30. Disruption of the beclin 1-BCL2 autophagy 
            regulatory complex promotes longevity in mice.
  - term:
      id: GO:0002020
      label: protease binding
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0005737
      label: cytoplasm
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0005739
      label: mitochondrion
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0005741
      label: mitochondrial outer membrane
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0005783
      label: endoplasmic reticulum
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0005789
      label: endoplasmic reticulum membrane
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0006974
      label: DNA damage response
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0008284
      label: positive regulation of cell population proliferation
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0009410
      label: response to xenobiotic stimulus
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0009636
      label: response to toxic substance
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0010039
      label: response to iron ion
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0010507
      label: negative regulation of autophagy
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0015267
      label: channel activity
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0016248
      label: channel inhibitor activity
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0030061
      label: mitochondrial crista
    evidence_type: ISO
    original_reference_id: GO_REF:0000096
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0030890
      label: positive regulation of B cell proliferation
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0031625
      label: ubiquitin protein ligase binding
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0031965
      label: nuclear membrane
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0032848
      label: negative regulation of cellular pH reduction
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0032991
      label: protein-containing complex
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0035094
      label: response to nicotine
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0042802
      label: identical protein binding
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0046930
      label: pore complex
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0046982
      label: protein heterodimerization activity
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0050853
      label: B cell receptor signaling pathway
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0051434
      label: BH3 domain binding
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0051607
      label: defense response to virus
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0060090
      label: molecular adaptor activity
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0140297
      label: DNA-binding transcription factor binding
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:2000811
      label: negative regulation of anoikis
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:2001234
      label: negative regulation of apoptotic signaling pathway
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:2001243
      label: negative regulation of intrinsic apoptotic signaling pathway
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0002020
      label: protease binding
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0005634
      label: nucleus
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0005739
      label: mitochondrion
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0005783
      label: endoplasmic reticulum
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0006974
      label: DNA damage response
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0008284
      label: positive regulation of cell population proliferation
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0009636
      label: response to toxic substance
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0010039
      label: response to iron ion
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0010507
      label: negative regulation of autophagy
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0015267
      label: channel activity
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0016248
      label: channel inhibitor activity
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0030890
      label: positive regulation of B cell proliferation
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0031625
      label: ubiquitin protein ligase binding
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0032848
      label: negative regulation of cellular pH reduction
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0032991
      label: protein-containing complex
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0035094
      label: response to nicotine
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0042802
      label: identical protein binding
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0043565
      label: sequence-specific DNA binding
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0046930
      label: pore complex
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0046982
      label: protein heterodimerization activity
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0050853
      label: B cell receptor signaling pathway
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0051434
      label: BH3 domain binding
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0051607
      label: defense response to virus
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0140297
      label: DNA-binding transcription factor binding
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:2000811
      label: negative regulation of anoikis
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:2001234
      label: negative regulation of apoptotic signaling pathway
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:2001243
      label: negative regulation of intrinsic apoptotic signaling pathway
    evidence_type: IEA
    original_reference_id: GO_REF:0000107
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0097138
      label: BAD-BCL-2 complex
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0097148
      label: BCL-2 complex
    evidence_type: ISO
    original_reference_id: GO_REF:0000119
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0005737
      label: cytoplasm
    evidence_type: ISO
    original_reference_id: GO_REF:0000096
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0005739
      label: mitochondrion
    evidence_type: ISO
    original_reference_id: GO_REF:0000096
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0010667
      label: negative regulation of cardiac muscle cell apoptotic process
    evidence_type: ISO
    original_reference_id: GO_REF:0000096
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: ISO
    original_reference_id: GO_REF:0000096
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0044877
      label: protein-containing complex binding
    evidence_type: ISO
    original_reference_id: GO_REF:0000096
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0045471
      label: response to ethanol
    evidence_type: ISO
    original_reference_id: GO_REF:0000096
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0048471
      label: perinuclear region of cytoplasm
    evidence_type: ISO
    original_reference_id: GO_REF:0000096
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0051400
      label: BH domain binding
    evidence_type: ISO
    original_reference_id: GO_REF:0000096
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0000902
      label: cell morphogenesis
    evidence_type: IDA
    original_reference_id: PMID:18548006
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:18548006
          supporting_text: Osteoclast size is controlled by Fra-2 through 
            LIF/LIF-receptor signalling and hypoxia.
  - term:
      id: GO:0005737
      label: cytoplasm
    evidence_type: IDA
    original_reference_id: PMID:36812915
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:36812915
          supporting_text: 2023 Feb 21. Exercise-activated hepatic autophagy via
            the FN1-α5β1 integrin pathway drives metabolic benefits of exercise.
  - term:
      id: GO:0010507
      label: negative regulation of autophagy
    evidence_type: IDA
    original_reference_id: PMID:36812915
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:36812915
          supporting_text: 2023 Feb 21. Exercise-activated hepatic autophagy via
            the FN1-α5β1 integrin pathway drives metabolic benefits of exercise.
  - term:
      id: GO:0060090
      label: molecular adaptor activity
    evidence_type: IDA
    original_reference_id: PMID:36812915
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:36812915
          supporting_text: 2023 Feb 21. Exercise-activated hepatic autophagy via
            the FN1-α5β1 integrin pathway drives metabolic benefits of exercise.
  - term:
      id: GO:0009791
      label: post-embryonic development
    evidence_type: TAS
    original_reference_id: PMID:10674380
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:10674380
          supporting_text: Hair follicle apoptosis and Bcl-2.
  - term:
      id: GO:0048087
      label: positive regulation of developmental pigmentation
    evidence_type: TAS
    original_reference_id: PMID:10674380
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:10674380
          supporting_text: Hair follicle apoptosis and Bcl-2.
  - term:
      id: GO:0005737
      label: cytoplasm
    evidence_type: IDA
    original_reference_id: PMID:29020630
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:29020630
          supporting_text: Degradation of Bcl-2 by XIAP and ARTS Promotes 
            Apoptosis.
  - term:
      id: GO:0005741
      label: mitochondrial outer membrane
    evidence_type: ISS
    original_reference_id: GO_REF:0000024
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0005789
      label: endoplasmic reticulum membrane
    evidence_type: ISS
    original_reference_id: GO_REF:0000024
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0010507
      label: negative regulation of autophagy
    evidence_type: ISS
    original_reference_id: GO_REF:0000024
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0048873
      label: homeostasis of number of cells within a tissue
    evidence_type: IMP
    original_reference_id: PMID:9241272
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9241272
          supporting_text: Bcl-2 and Bax function independently to regulate cell
            death.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:10582606
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:10582606
          supporting_text: Bax and Bcl-2 interaction in a transgenic mouse model
            of familial amyotrophic lateral sclerosis.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:11226327
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:11226327
          supporting_text: Bax ablation prevents dopaminergic neurodegeneration 
            in the 1-methyl- 4-phenyl-1,2,3,6-tetrahydropyridine mouse model of 
            Parkinson's disease.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:7834748
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7834748
          supporting_text: Bad, a heterodimeric partner for Bcl-XL and Bcl-2, 
            displaces Bax and promotes cell death.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:8918887
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8918887
          supporting_text: 'BID: a novel BH3 domain-only death agonist.'
  - term:
      id: GO:0040008
      label: regulation of growth
    evidence_type: IMP
    original_reference_id: PMID:7812968
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7812968
          supporting_text: 'bcl-2 deficiency in mice leads to pleiotropic abnormalities:
            accelerated lymphoid cell death in thymus and spleen, polycystic kidney,
            hair hypopigmentation, and distorted small intestine.'
  - term:
      id: GO:0040008
      label: regulation of growth
    evidence_type: IMP
    original_reference_id: PMID:8170972
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8170972
          supporting_text: 'Targeted disruption of Bcl-2 alpha beta in mice: occurrence
            of gray hair, polycystic kidney disease, and lymphocytopenia.'
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:15983387
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:15983387
          supporting_text: Frag1, a homolog of alternative replication factor C 
            subunits, links replication stress surveillance with apoptosis.
  - term:
      id: GO:0008630
      label: intrinsic apoptotic signaling pathway in response to DNA damage
    evidence_type: IGI
    original_reference_id: PMID:15983387
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:15983387
          supporting_text: Frag1, a homolog of alternative replication factor C 
            subunits, links replication stress surveillance with apoptosis.
  - term:
      id: GO:0008284
      label: positive regulation of cell population proliferation
    evidence_type: IMP
    original_reference_id: PMID:8084613
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8084613
          supporting_text: Antisense oligonucleotides suppress B-cell lymphoma 
            growth in a SCID-hu mouse model.
  - term:
      id: GO:0030217
      label: T cell differentiation
    evidence_type: IGI
    original_reference_id: PMID:9215624
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9215624
          supporting_text: Bcl-2 can rescue T lymphocyte development in 
            interleukin-7 receptor-deficient mice but not in mutant rag-1-/- 
            mice.
  - term:
      id: GO:0098609
      label: cell-cell adhesion
    evidence_type: IMP
    original_reference_id: PMID:15292044
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:15292044
          supporting_text: Alterations in cell-adhesive and migratory properties
            of proximal tubule and collecting duct cells from bcl-2 -/- mice.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:23629966
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:23629966
          supporting_text: Deacetylation of p53 induces autophagy by suppressing
            Bmf expression.
  - term:
      id: GO:0042981
      label: regulation of apoptotic process
    evidence_type: IGI
    original_reference_id: PMID:8918887
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8918887
          supporting_text: 'BID: a novel BH3 domain-only death agonist.'
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:26949185
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:26949185
          supporting_text: BOK Is a Non-canonical BCL-2 Family Effector of 
            Apoptosis Regulated by ER-Associated Degradation.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:17475835
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:17475835
          supporting_text: Involvement of heat shock protein (Hsp)90 beta but 
            not Hsp90 alpha in antiapoptotic effect of CpG-B 
            oligodeoxynucleotide.
  - term:
      id: GO:0006915
      label: apoptotic process
    evidence_type: ISO
    original_reference_id: PMID:8022822
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8022822
          supporting_text: Evidence that BCL-2 represses apoptosis by regulating
            endoplasmic reticulum-associated Ca2+ fluxes.
  - term:
      id: GO:0006915
      label: apoptotic process
    evidence_type: IMP
    original_reference_id: PMID:8170972
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8170972
          supporting_text: 'Targeted disruption of Bcl-2 alpha beta in mice: occurrence
            of gray hair, polycystic kidney disease, and lymphocytopenia.'
  - term:
      id: GO:0006915
      label: apoptotic process
    evidence_type: IMP
    original_reference_id: PMID:8372353
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8372353
          supporting_text: Disappearance of the lymphoid system in Bcl-2 
            homozygous mutant chimeric mice.
  - term:
      id: GO:0006915
      label: apoptotic process
    evidence_type: ISO
    original_reference_id: PMID:8949945
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8949945
          supporting_text: Bcl-2 prevents hippocampal cell death induced by the 
            neuroleptic drug haloperidol.
  - term:
      id: GO:0042149
      label: cellular response to glucose starvation
    evidence_type: IDA
    original_reference_id: PMID:7595537
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7595537
          supporting_text: Bcl-2 protects neural cells from 
            cyanide/aglycemia-induced lipid oxidation, mitochondrial injury, and
            loss of viability.
  - term:
      id: GO:0071456
      label: cellular response to hypoxia
    evidence_type: IDA
    original_reference_id: PMID:7595537
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7595537
          supporting_text: Bcl-2 protects neural cells from 
            cyanide/aglycemia-induced lipid oxidation, mitochondrial injury, and
            loss of viability.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:11546872
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:11546872
          supporting_text: 'Bmf: a proapoptotic BH3-only protein regulated by interaction
            with the myosin V actin motor complex, activated by anoikis.'
  - term:
      id: GO:2001234
      label: negative regulation of apoptotic signaling pathway
    evidence_type: IDA
    original_reference_id: PMID:11546872
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:11546872
          supporting_text: 'Bmf: a proapoptotic BH3-only protein regulated by interaction
            with the myosin V actin motor complex, activated by anoikis.'
  - term:
      id: GO:2001240
      label: negative regulation of extrinsic apoptotic signaling pathway in 
        absence of ligand
    evidence_type: ISO
    original_reference_id: GO_REF:0000008
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
  - term:
      id: GO:0008637
      label: apoptotic mitochondrial changes
    evidence_type: IDA
    original_reference_id: PMID:14707049
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:14707049
          supporting_text: TCR-independent and caspase-independent apoptosis of 
            murine thymocytes by CD24 cross-linking.
  - term:
      id: GO:0008631
      label: intrinsic apoptotic signaling pathway in response to oxidative 
        stress
    evidence_type: IMP
    original_reference_id: PMID:12855558
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:12855558
          supporting_text: Jul 10. Bcl2 retards G1/S cell cycle transition by 
            regulating intracellular ROS.
  - term:
      id: GO:0002931
      label: response to ischemia
    evidence_type: IMP
    original_reference_id: PMID:10488913
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:10488913
          supporting_text: Targeted disruption of the bcl-2 gene in mice 
            exacerbates focal ischemic brain injury.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:12082633
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:12082633
          supporting_text: Proapoptotic activity of ITM2B(s), a BH3-only protein
            induced upon IL-2-deprivation which interacts with Bcl-2.
  - term:
      id: GO:0097192
      label: extrinsic apoptotic signaling pathway in absence of ligand
    evidence_type: IGI
    original_reference_id: PMID:12082633
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:12082633
          supporting_text: Proapoptotic activity of ITM2B(s), a BH3-only protein
            induced upon IL-2-deprivation which interacts with Bcl-2.
  - term:
      id: GO:0008625
      label: extrinsic apoptotic signaling pathway via death domain receptors
    evidence_type: ISO
    original_reference_id: PMID:10597216
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:10597216
          supporting_text: Bis, a Bcl-2-binding protein that synergizes with 
            Bcl-2 in preventing cell death.
  - term:
      id: GO:2000134
      label: negative regulation of G1/S transition of mitotic cell cycle
    evidence_type: IMP
    original_reference_id: PMID:12855558
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:12855558
          supporting_text: Jul 10. Bcl2 retards G1/S cell cycle transition by 
            regulating intracellular ROS.
  - term:
      id: GO:2000134
      label: negative regulation of G1/S transition of mitotic cell cycle
    evidence_type: IDA
    original_reference_id: PMID:14660795
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:14660795
          supporting_text: Mono- and multisite phosphorylation enhances Bcl2's 
            antiapoptotic function and inhibition of cell cycle entry functions.
  - term:
      id: GO:2000134
      label: negative regulation of G1/S transition of mitotic cell cycle
    evidence_type: IMP
    original_reference_id: PMID:14660795
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:14660795
          supporting_text: Mono- and multisite phosphorylation enhances Bcl2's 
            antiapoptotic function and inhibition of cell cycle entry functions.
  - term:
      id: GO:0010506
      label: regulation of autophagy
    evidence_type: IMP
    original_reference_id: PMID:22258505
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:22258505
          supporting_text: Exercise-induced BCL2-regulated autophagy is required
            for muscle glucose homeostasis.
  - term:
      id: GO:0016020
      label: membrane
    evidence_type: IDA
    original_reference_id: PMID:8030757
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8030757
          supporting_text: Bcl-2 protein expression during murine development.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IDA
    original_reference_id: PMID:9560217
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9560217
          supporting_text: Bax directly induces release of cytochrome c from 
            isolated mitochondria.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:18223655
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:18223655
          supporting_text: Dual role of proapoptotic BAD in insulin secretion 
            and beta cell survival.
  - term:
      id: GO:0072593
      label: reactive oxygen species metabolic process
    evidence_type: IMP
    original_reference_id: PMID:10726970
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:10726970
          supporting_text: Developmental changes in antioxidant enzymes and 
            oxidative damage in kidneys, liver and brain of bcl-2 knockout mice.
  - term:
      id: GO:0072593
      label: reactive oxygen species metabolic process
    evidence_type: IMP
    original_reference_id: PMID:12855558
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:12855558
          supporting_text: Jul 10. Bcl2 retards G1/S cell cycle transition by 
            regulating intracellular ROS.
  - term:
      id: GO:0072593
      label: reactive oxygen species metabolic process
    evidence_type: IMP
    original_reference_id: PMID:9681465
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9681465
          supporting_text: Enhanced oxidative stress and altered antioxidants in
            brains of Bcl-2-deficient mice.
  - term:
      id: GO:0001657
      label: ureteric bud development
    evidence_type: IMP
    original_reference_id: PMID:8623928
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8623928
          supporting_text: Apoptosis during an early stage of nephrogenesis 
            induces renal hypoplasia in bcl-2-deficient mice.
  - term:
      id: GO:0019903
      label: protein phosphatase binding
    evidence_type: IDA
    original_reference_id: PMID:12617961
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:12617961
          supporting_text: Calcium-dependent interaction of calcineurin with 
            Bcl-2 in neuronal tissue.
  - term:
      id: GO:0051721
      label: protein phosphatase 2A binding
    evidence_type: IDA
    original_reference_id: PMID:16717086
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:16717086
          supporting_text: 2006 May 22. PP2A regulates BCL-2 phosphorylation and
            proteasome-mediated degradation at the endoplasmic reticulum.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:15613488
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:15613488
          supporting_text: Proapoptotic BAX and BAK regulate the type 1 inositol
            trisphosphate receptor and calcium leak from the endoplasmic 
            reticulum.
  - term:
      id: GO:0030307
      label: positive regulation of cell growth
    evidence_type: ISO
    original_reference_id: PMID:8022822
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8022822
          supporting_text: Evidence that BCL-2 represses apoptosis by regulating
            endoplasmic reticulum-associated Ca2+ fluxes.
  - term:
      id: GO:0000209
      label: protein polyubiquitination
    evidence_type: ISO
    original_reference_id: PMID:16717086
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:16717086
          supporting_text: 2006 May 22. PP2A regulates BCL-2 phosphorylation and
            proteasome-mediated degradation at the endoplasmic reticulum.
  - term:
      id: GO:0005737
      label: cytoplasm
    evidence_type: ISO
    original_reference_id: PMID:7546744
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7546744
          supporting_text: Role of BCL-2 in the survival and function of 
            developing and mature sympathetic neurons.
  - term:
      id: GO:0016020
      label: membrane
    evidence_type: ISO
    original_reference_id: PMID:7896880
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7896880
          supporting_text: The intracellular distribution and pattern of 
            expression of Mcl-1 overlap with, but are not identical to, those of
            Bcl-2.
  - term:
      id: GO:0005739
      label: mitochondrion
    evidence_type: HDA
    original_reference_id: PMID:18614015
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:18614015
          supporting_text: A mitochondrial protein compendium elucidates complex
            I disease biology.
  - term:
      id: GO:0005634
      label: nucleus
    evidence_type: ISO
    original_reference_id: PMID:7546744
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7546744
          supporting_text: Role of BCL-2 in the survival and function of 
            developing and mature sympathetic neurons.
  - term:
      id: GO:0005634
      label: nucleus
    evidence_type: ISO
    original_reference_id: PMID:7896880
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7896880
          supporting_text: The intracellular distribution and pattern of 
            expression of Mcl-1 overlap with, but are not identical to, those of
            Bcl-2.
  - term:
      id: GO:0005739
      label: mitochondrion
    evidence_type: ISO
    original_reference_id: PMID:7896880
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7896880
          supporting_text: The intracellular distribution and pattern of 
            expression of Mcl-1 overlap with, but are not identical to, those of
            Bcl-2.
  - term:
      id: GO:0009410
      label: response to xenobiotic stimulus
    evidence_type: ISO
    original_reference_id: PMID:8949945
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8949945
          supporting_text: Bcl-2 prevents hippocampal cell death induced by the 
            neuroleptic drug haloperidol.
  - term:
      id: GO:0009636
      label: response to toxic substance
    evidence_type: ISO
    original_reference_id: PMID:16717086
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:16717086
          supporting_text: 2006 May 22. PP2A regulates BCL-2 phosphorylation and
            proteasome-mediated degradation at the endoplasmic reticulum.
  - term:
      id: GO:0034097
      label: response to cytokine
    evidence_type: ISO
    original_reference_id: PMID:9184696
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9184696
          supporting_text: The apoptosis and proliferation of SAC-activated B 
            cells by IL-10 are associated with changes in Bcl-2, Bcl-xL, and 
            Mcl-1 expression.
  - term:
      id: GO:0042100
      label: B cell proliferation
    evidence_type: ISO
    original_reference_id: PMID:1373874
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:1373874
          supporting_text: Bcl-2 confers growth and survival advantage to 
            interleukin 7-dependent early pre-B cells which become factor 
            independent by a multistep process in culture.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: ISO
    original_reference_id: PMID:1373874
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:1373874
          supporting_text: Bcl-2 confers growth and survival advantage to 
            interleukin 7-dependent early pre-B cells which become factor 
            independent by a multistep process in culture.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: ISO
    original_reference_id: PMID:7650367
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7650367
          supporting_text: Expression of Bcl-2, Bcl-x, and Bax after T cell 
            activation and IL-2 withdrawal.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: ISO
    original_reference_id: PMID:7772249
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7772249
          supporting_text: Evolutionary conservation of function among 
            mammalian, avian, and viral homologs of the Bcl-2 oncoprotein.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: ISO
    original_reference_id: PMID:8050499
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8050499
          supporting_text: bcl-2 gene prevents apoptosis of basic fibroblast 
            growth factor-deprived murine aortic endothelial cells.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: ISO
    original_reference_id: PMID:8080725
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8080725
          supporting_text: bcl-2 gene enables rescue from in vitro 
            myelosuppression (bone marrow cell death) induced by chemotherapy.
  - term:
      id: GO:0043524
      label: negative regulation of neuron apoptotic process
    evidence_type: ISO
    original_reference_id: PMID:7546744
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7546744
          supporting_text: Role of BCL-2 in the survival and function of 
            developing and mature sympathetic neurons.
  - term:
      id: GO:0051924
      label: regulation of calcium ion transport
    evidence_type: ISO
    original_reference_id: PMID:8022822
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8022822
          supporting_text: Evidence that BCL-2 represses apoptosis by regulating
            endoplasmic reticulum-associated Ca2+ fluxes.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: ISS
    original_reference_id: PMID:15776018
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:15776018
          supporting_text: Proapoptotic BAX and BAK control multiple initiator 
            caspases.
  - term:
      id: GO:0070059
      label: intrinsic apoptotic signaling pathway in response to endoplasmic 
        reticulum stress
    evidence_type: ISS
    original_reference_id: PMID:15776018
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:15776018
          supporting_text: Proapoptotic BAX and BAK control multiple initiator 
            caspases.
  - term:
      id: GO:0005789
      label: endoplasmic reticulum membrane
    evidence_type: IDA
    original_reference_id: PMID:15613488
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:15613488
          supporting_text: Proapoptotic BAX and BAK regulate the type 1 inositol
            trisphosphate receptor and calcium leak from the endoplasmic 
            reticulum.
  - term:
      id: GO:0010523
      label: negative regulation of calcium ion transport into cytosol
    evidence_type: IGI
    original_reference_id: PMID:15613488
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:15613488
          supporting_text: Proapoptotic BAX and BAK regulate the type 1 inositol
            trisphosphate receptor and calcium leak from the endoplasmic 
            reticulum.
  - term:
      id: GO:0032469
      label: endoplasmic reticulum calcium ion homeostasis
    evidence_type: IGI
    original_reference_id: PMID:15613488
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:15613488
          supporting_text: Proapoptotic BAX and BAK regulate the type 1 inositol
            trisphosphate receptor and calcium leak from the endoplasmic 
            reticulum.
  - term:
      id: GO:0033138
      label: positive regulation of peptidyl-serine phosphorylation
    evidence_type: IGI
    original_reference_id: PMID:15613488
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:15613488
          supporting_text: Proapoptotic BAX and BAK regulate the type 1 inositol
            trisphosphate receptor and calcium leak from the endoplasmic 
            reticulum.
  - term:
      id: GO:0005515
      label: protein binding
    evidence_type: IPI
    original_reference_id: PMID:16717086
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:16717086
          supporting_text: 2006 May 22. PP2A regulates BCL-2 phosphorylation and
            proteasome-mediated degradation at the endoplasmic reticulum.
  - term:
      id: GO:0001658
      label: branching involved in ureteric bud morphogenesis
    evidence_type: IGI
    original_reference_id: PMID:16672320
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:16672320
          supporting_text: 2006 May 3. Suppression of ureteric bud apoptosis 
            rescues nephron endowment and adult renal function in Pax2 mutant 
            mice.
  - term:
      id: GO:0001822
      label: kidney development
    evidence_type: IMP
    original_reference_id: PMID:15818405
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:15818405
          supporting_text: Polycystic kidney disease prevented by transgenic RNA
            interference.
  - term:
      id: GO:0001822
      label: kidney development
    evidence_type: IGI
    original_reference_id: PMID:16672320
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:16672320
          supporting_text: 2006 May 3. Suppression of ureteric bud apoptosis 
            rescues nephron endowment and adult renal function in Pax2 mutant 
            mice.
  - term:
      id: GO:0002260
      label: lymphocyte homeostasis
    evidence_type: IGI
    original_reference_id: PMID:15818405
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:15818405
          supporting_text: Polycystic kidney disease prevented by transgenic RNA
            interference.
  - term:
      id: GO:0042981
      label: regulation of apoptotic process
    evidence_type: IGI
    original_reference_id: PMID:15818405
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:15818405
          supporting_text: Polycystic kidney disease prevented by transgenic RNA
            interference.
  - term:
      id: GO:0043067
      label: regulation of programmed cell death
    evidence_type: IGI
    original_reference_id: PMID:16672320
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:16672320
          supporting_text: 2006 May 3. Suppression of ureteric bud apoptosis 
            rescues nephron endowment and adult renal function in Pax2 mutant 
            mice.
  - term:
      id: GO:0048070
      label: regulation of developmental pigmentation
    evidence_type: IGI
    original_reference_id: PMID:15818405
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:15818405
          supporting_text: Polycystic kidney disease prevented by transgenic RNA
            interference.
  - term:
      id: GO:0048536
      label: spleen development
    evidence_type: IMP
    original_reference_id: PMID:15818405
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:15818405
          supporting_text: Polycystic kidney disease prevented by transgenic RNA
            interference.
  - term:
      id: GO:0048536
      label: spleen development
    evidence_type: IGI
    original_reference_id: PMID:15818405
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:15818405
          supporting_text: Polycystic kidney disease prevented by transgenic RNA
            interference.
  - term:
      id: GO:0048538
      label: thymus development
    evidence_type: IMP
    original_reference_id: PMID:15818405
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:15818405
          supporting_text: Polycystic kidney disease prevented by transgenic RNA
            interference.
  - term:
      id: GO:0048538
      label: thymus development
    evidence_type: IGI
    original_reference_id: PMID:15818405
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:15818405
          supporting_text: Polycystic kidney disease prevented by transgenic RNA
            interference.
  - term:
      id: GO:0048589
      label: developmental growth
    evidence_type: IMP
    original_reference_id: PMID:15818405
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:15818405
          supporting_text: Polycystic kidney disease prevented by transgenic RNA
            interference.
  - term:
      id: GO:0001662
      label: behavioral fear response
    evidence_type: IMP
    original_reference_id: PMID:16095731
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:16095731
          supporting_text: 'Epub 2005 Aug 10. Increased anxiety-like behaviors and
            mitochondrial dysfunction in mice with targeted mutation of the Bcl-2
            gene: further support for the involvement of mitochondrial function in
            anxiety disorders.'
  - term:
      id: GO:0001822
      label: kidney development
    evidence_type: IMP
    original_reference_id: PMID:16282979
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:16282979
          supporting_text: 2005 Nov 11. Loss of PKD1 and loss of Bcl-2 elicit 
            polycystic kidney disease through distinct mechanisms.
  - term:
      id: GO:0006470
      label: protein dephosphorylation
    evidence_type: IDA
    original_reference_id: PMID:16717086
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:16717086
          supporting_text: 2006 May 22. PP2A regulates BCL-2 phosphorylation and
            proteasome-mediated degradation at the endoplasmic reticulum.
  - term:
      id: GO:0010332
      label: response to gamma radiation
    evidence_type: IMP
    original_reference_id: PMID:10815637
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:10815637
          supporting_text: Effects of deficiency in p53 or bcl-2 on the 
            sensitivity of clonogenic cells in the small intestine to low 
            dose-rate irradiation.
  - term:
      id: GO:0010332
      label: response to gamma radiation
    evidence_type: IMP
    original_reference_id: PMID:17068116
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:17068116
          supporting_text: Radiation-induced gastric epithelial apoptosis occurs
            in the proliferative zone and is regulated by p53, bak, bax, and 
            bcl-2.
  - term:
      id: GO:0010332
      label: response to gamma radiation
    evidence_type: IMP
    original_reference_id: PMID:8170972
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8170972
          supporting_text: 'Targeted disruption of Bcl-2 alpha beta in mice: occurrence
            of gray hair, polycystic kidney disease, and lymphocytopenia.'
  - term:
      id: GO:0014911
      label: positive regulation of smooth muscle cell migration
    evidence_type: IMP
    original_reference_id: PMID:17382917
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:17382917
          supporting_text: Epub 2007 Mar 3. c-Myc is essential for urokinase 
            plasminogen activator expression on hypoxia-induced vascular smooth 
            muscle cells.
  - term:
      id: GO:0043029
      label: T cell homeostasis
    evidence_type: IGI
    original_reference_id: PMID:17591857
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:17591857
          supporting_text: Bim/Bcl-2 balance is critical for maintaining naive 
            and memory T cell homeostasis.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IMP
    original_reference_id: PMID:17068116
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:17068116
          supporting_text: Radiation-induced gastric epithelial apoptosis occurs
            in the proliferative zone and is regulated by p53, bak, bax, and 
            bcl-2.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IDA
    original_reference_id: PMID:17267035
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:17267035
          supporting_text: 2007 Jan 30. Regulation of the lifespan in dendritic 
            cell subsets.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IMP
    original_reference_id: PMID:9681465
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9681465
          supporting_text: Enhanced oxidative stress and altered antioxidants in
            brains of Bcl-2-deficient mice.
  - term:
      id: GO:0043085
      label: positive regulation of catalytic activity
    evidence_type: IMP
    original_reference_id: PMID:17382917
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:17382917
          supporting_text: Epub 2007 Mar 3. c-Myc is essential for urokinase 
            plasminogen activator expression on hypoxia-induced vascular smooth 
            muscle cells.
  - term:
      id: GO:0043524
      label: negative regulation of neuron apoptotic process
    evidence_type: IMP
    original_reference_id: PMID:9681465
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9681465
          supporting_text: Enhanced oxidative stress and altered antioxidants in
            brains of Bcl-2-deficient mice.
  - term:
      id: GO:0045636
      label: positive regulation of melanocyte differentiation
    evidence_type: IMP
    original_reference_id: PMID:16427619
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:16427619
          supporting_text: 2006 Jan 19. Indispensable role of Bcl2 in the 
            development of the melanocyte stem cell.
  - term:
      id: GO:0048873
      label: homeostasis of number of cells within a tissue
    evidence_type: IMP
    original_reference_id: PMID:16427619
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:16427619
          supporting_text: 2006 Jan 19. Indispensable role of Bcl2 in the 
            development of the melanocyte stem cell.
  - term:
      id: GO:0050790
      label: regulation of catalytic activity
    evidence_type: IMP
    original_reference_id: PMID:9681465
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9681465
          supporting_text: Enhanced oxidative stress and altered antioxidants in
            brains of Bcl-2-deficient mice.
  - term:
      id: GO:0051402
      label: neuron apoptotic process
    evidence_type: IMP
    original_reference_id: PMID:7546744
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7546744
          supporting_text: Role of BCL-2 in the survival and function of 
            developing and mature sympathetic neurons.
  - term:
      id: GO:0001952
      label: regulation of cell-matrix adhesion
    evidence_type: IMP
    original_reference_id: PMID:15292044
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:15292044
          supporting_text: Alterations in cell-adhesive and migratory properties
            of proximal tubule and collecting duct cells from bcl-2 -/- mice.
  - term:
      id: GO:0010468
      label: regulation of gene expression
    evidence_type: IMP
    original_reference_id: PMID:15292044
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:15292044
          supporting_text: Alterations in cell-adhesive and migratory properties
            of proximal tubule and collecting duct cells from bcl-2 -/- mice.
  - term:
      id: GO:0010559
      label: regulation of glycoprotein biosynthetic process
    evidence_type: IMP
    original_reference_id: PMID:15292044
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:15292044
          supporting_text: Alterations in cell-adhesive and migratory properties
            of proximal tubule and collecting duct cells from bcl-2 -/- mice.
  - term:
      id: GO:0030336
      label: negative regulation of cell migration
    evidence_type: IMP
    original_reference_id: PMID:15292044
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:15292044
          supporting_text: Alterations in cell-adhesive and migratory properties
            of proximal tubule and collecting duct cells from bcl-2 -/- mice.
  - term:
      id: GO:0048041
      label: focal adhesion assembly
    evidence_type: IMP
    original_reference_id: PMID:15292044
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:15292044
          supporting_text: Alterations in cell-adhesive and migratory properties
            of proximal tubule and collecting duct cells from bcl-2 -/- mice.
  - term:
      id: GO:0018105
      label: peptidyl-serine phosphorylation
    evidence_type: IDA
    original_reference_id: PMID:14660795
    review:
      summary: >-
        MISANNOTATION: Bcl2 (Apoptosis regulator) does NOT catalyze phosphorylation.
        PMID:14660795
        titled "Mono- and multisite phosphorylation enhances Bcl2's antiapoptotic
        function"
        describes Bcl2 being PHOSPHORYLATED (as substrate) - "Single-site phosphorylation
        at
        serine 70 (S70) is required for Bcl2's antiapoptotic function". UniProt confirms
        Bcl2
        is phosphorylated BY PKC, ERKs, stress-activated kinases, and MAPK8/JNK1 at
        Thr-69,
        Ser-70, and Ser-84. Bcl2 is a membrane protein with BH domains that regulates
        apoptosis - it has NO kinase activity. This annotation incorrectly implies
        Bcl2
        catalyzes phosphorylation when it is actually the TARGET of phosphorylation.
      action: REMOVE
      supported_by:
        - reference_id: PMID:14660795
          supporting_text: Mono- and multisite phosphorylation enhances Bcl2's 
            antiapoptotic function and inhibition of cell cycle entry functions.
  - term:
      id: GO:0018107
      label: peptidyl-threonine phosphorylation
    evidence_type: IDA
    original_reference_id: PMID:14660795
    review:
      summary: >-
        MISANNOTATION: Same issue as GO:0018105 above. Bcl2 does NOT catalyze phosphorylation.
        PMID:14660795 describes Bcl2 being phosphorylated at threonine 69 (T69) -
        Bcl2 is the
        SUBSTRATE, not the enzyme. UniProt: "Phosphorylated by MAPK8/JNK1 at Thr-69".
        This
        annotation incorrectly implies Bcl2 catalyzes threonine phosphorylation when
        it is
        actually the target.
      action: REMOVE
      supported_by:
        - reference_id: PMID:14660795
          supporting_text: Mono- and multisite phosphorylation enhances Bcl2's 
            antiapoptotic function and inhibition of cell cycle entry functions.
  - term:
      id: GO:0031647
      label: regulation of protein stability
    evidence_type: IMP
    original_reference_id: PMID:14660795
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:14660795
          supporting_text: Mono- and multisite phosphorylation enhances Bcl2's 
            antiapoptotic function and inhibition of cell cycle entry functions.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IDA
    original_reference_id: PMID:14660795
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:14660795
          supporting_text: Mono- and multisite phosphorylation enhances Bcl2's 
            antiapoptotic function and inhibition of cell cycle entry functions.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IMP
    original_reference_id: PMID:14660795
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:14660795
          supporting_text: Mono- and multisite phosphorylation enhances Bcl2's 
            antiapoptotic function and inhibition of cell cycle entry functions.
  - term:
      id: GO:0001658
      label: branching involved in ureteric bud morphogenesis
    evidence_type: IDA
    original_reference_id: PMID:14699151
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:14699151
          supporting_text: 2003 Dec 29. Interaction of bcl-2 with Paxillin 
            through its BH4 domain is important during ureteric bud branching.
  - term:
      id: GO:0006979
      label: response to oxidative stress
    evidence_type: IMP
    original_reference_id: PMID:12855558
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:12855558
          supporting_text: Jul 10. Bcl2 retards G1/S cell cycle transition by 
            regulating intracellular ROS.
  - term:
      id: GO:0010468
      label: regulation of gene expression
    evidence_type: IMP
    original_reference_id: PMID:12855558
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:12855558
          supporting_text: Jul 10. Bcl2 retards G1/S cell cycle transition by 
            regulating intracellular ROS.
  - term:
      id: GO:0030308
      label: negative regulation of cell growth
    evidence_type: IMP
    original_reference_id: PMID:12855558
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:12855558
          supporting_text: Jul 10. Bcl2 retards G1/S cell cycle transition by 
            regulating intracellular ROS.
  - term:
      id: GO:0034097
      label: response to cytokine
    evidence_type: IMP
    original_reference_id: PMID:12855558
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:12855558
          supporting_text: Jul 10. Bcl2 retards G1/S cell cycle transition by 
            regulating intracellular ROS.
  - term:
      id: GO:0042542
      label: response to hydrogen peroxide
    evidence_type: IMP
    original_reference_id: PMID:12855558
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:12855558
          supporting_text: Jul 10. Bcl2 retards G1/S cell cycle transition by 
            regulating intracellular ROS.
  - term:
      id: GO:0001782
      label: B cell homeostasis
    evidence_type: IMP
    original_reference_id: PMID:7650488
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7650488
          supporting_text: Bcl-XL and Bcl-2 repress a common pathway of cell 
            death.
  - term:
      id: GO:0001782
      label: B cell homeostasis
    evidence_type: IMP
    original_reference_id: PMID:8170972
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8170972
          supporting_text: 'Targeted disruption of Bcl-2 alpha beta in mice: occurrence
            of gray hair, polycystic kidney disease, and lymphocytopenia.'
  - term:
      id: GO:0002260
      label: lymphocyte homeostasis
    evidence_type: IMP
    original_reference_id: PMID:8170972
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8170972
          supporting_text: 'Targeted disruption of Bcl-2 alpha beta in mice: occurrence
            of gray hair, polycystic kidney disease, and lymphocytopenia.'
  - term:
      id: GO:0009791
      label: post-embryonic development
    evidence_type: IMP
    original_reference_id: PMID:8170972
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8170972
          supporting_text: 'Targeted disruption of Bcl-2 alpha beta in mice: occurrence
            of gray hair, polycystic kidney disease, and lymphocytopenia.'
  - term:
      id: GO:0009887
      label: animal organ morphogenesis
    evidence_type: IMP
    original_reference_id: PMID:8170972
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8170972
          supporting_text: 'Targeted disruption of Bcl-2 alpha beta in mice: occurrence
            of gray hair, polycystic kidney disease, and lymphocytopenia.'
  - term:
      id: GO:0030183
      label: B cell differentiation
    evidence_type: IMP
    original_reference_id: PMID:8170972
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8170972
          supporting_text: 'Targeted disruption of Bcl-2 alpha beta in mice: occurrence
            of gray hair, polycystic kidney disease, and lymphocytopenia.'
  - term:
      id: GO:0030217
      label: T cell differentiation
    evidence_type: IMP
    original_reference_id: PMID:8170972
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8170972
          supporting_text: 'Targeted disruption of Bcl-2 alpha beta in mice: occurrence
            of gray hair, polycystic kidney disease, and lymphocytopenia.'
  - term:
      id: GO:0030318
      label: melanocyte differentiation
    evidence_type: IMP
    original_reference_id: PMID:12086670
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:12086670
          supporting_text: Bcl2 regulation by the melanocyte master regulator 
            Mitf modulates lineage survival and melanoma cell viability.
  - term:
      id: GO:0030318
      label: melanocyte differentiation
    evidence_type: IGI
    original_reference_id: PMID:12086670
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:12086670
          supporting_text: Bcl2 regulation by the melanocyte master regulator 
            Mitf modulates lineage survival and melanoma cell viability.
  - term:
      id: GO:0033077
      label: T cell differentiation in thymus
    evidence_type: IMP
    original_reference_id: PMID:8170972
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8170972
          supporting_text: 'Targeted disruption of Bcl-2 alpha beta in mice: occurrence
            of gray hair, polycystic kidney disease, and lymphocytopenia.'
  - term:
      id: GO:0043029
      label: T cell homeostasis
    evidence_type: IMP
    original_reference_id: PMID:7650488
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7650488
          supporting_text: Bcl-XL and Bcl-2 repress a common pathway of cell 
            death.
  - term:
      id: GO:0043029
      label: T cell homeostasis
    evidence_type: IMP
    original_reference_id: PMID:8170972
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8170972
          supporting_text: 'Targeted disruption of Bcl-2 alpha beta in mice: occurrence
            of gray hair, polycystic kidney disease, and lymphocytopenia.'
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IMP
    original_reference_id: PMID:8170972
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8170972
          supporting_text: 'Targeted disruption of Bcl-2 alpha beta in mice: occurrence
            of gray hair, polycystic kidney disease, and lymphocytopenia.'
  - term:
      id: GO:0043375
      label: CD8-positive, alpha-beta T cell lineage commitment
    evidence_type: IMP
    original_reference_id: PMID:8170972
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8170972
          supporting_text: 'Targeted disruption of Bcl-2 alpha beta in mice: occurrence
            of gray hair, polycystic kidney disease, and lymphocytopenia.'
  - term:
      id: GO:0043583
      label: ear development
    evidence_type: IMP
    original_reference_id: PMID:8170972
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8170972
          supporting_text: 'Targeted disruption of Bcl-2 alpha beta in mice: occurrence
            of gray hair, polycystic kidney disease, and lymphocytopenia.'
  - term:
      id: GO:0048066
      label: developmental pigmentation
    evidence_type: IMP
    original_reference_id: PMID:8170972
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8170972
          supporting_text: 'Targeted disruption of Bcl-2 alpha beta in mice: occurrence
            of gray hair, polycystic kidney disease, and lymphocytopenia.'
  - term:
      id: GO:0048545
      label: response to steroid hormone
    evidence_type: IMP
    original_reference_id: PMID:8170972
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8170972
          supporting_text: 'Targeted disruption of Bcl-2 alpha beta in mice: occurrence
            of gray hair, polycystic kidney disease, and lymphocytopenia.'
  - term:
      id: GO:0001822
      label: kidney development
    evidence_type: IMP
    original_reference_id: PMID:11709185
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:11709185
          supporting_text: Degenerative disorders caused by Bcl-2 deficiency 
            prevented by loss of its BH3-only antagonist Bim.
  - term:
      id: GO:0001822
      label: kidney development
    evidence_type: IGI
    original_reference_id: PMID:11709185
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:11709185
          supporting_text: Degenerative disorders caused by Bcl-2 deficiency 
            prevented by loss of its BH3-only antagonist Bim.
  - term:
      id: GO:0002260
      label: lymphocyte homeostasis
    evidence_type: IMP
    original_reference_id: PMID:11709185
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:11709185
          supporting_text: Degenerative disorders caused by Bcl-2 deficiency 
            prevented by loss of its BH3-only antagonist Bim.
  - term:
      id: GO:0002260
      label: lymphocyte homeostasis
    evidence_type: IGI
    original_reference_id: PMID:11709185
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:11709185
          supporting_text: Degenerative disorders caused by Bcl-2 deficiency 
            prevented by loss of its BH3-only antagonist Bim.
  - term:
      id: GO:0006582
      label: melanin metabolic process
    evidence_type: IMP
    original_reference_id: PMID:11709185
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:11709185
          supporting_text: Degenerative disorders caused by Bcl-2 deficiency 
            prevented by loss of its BH3-only antagonist Bim.
  - term:
      id: GO:0009791
      label: post-embryonic development
    evidence_type: IMP
    original_reference_id: PMID:11709185
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:11709185
          supporting_text: Degenerative disorders caused by Bcl-2 deficiency 
            prevented by loss of its BH3-only antagonist Bim.
  - term:
      id: GO:0009791
      label: post-embryonic development
    evidence_type: IGI
    original_reference_id: PMID:11709185
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:11709185
          supporting_text: Degenerative disorders caused by Bcl-2 deficiency 
            prevented by loss of its BH3-only antagonist Bim.
  - term:
      id: GO:0030318
      label: melanocyte differentiation
    evidence_type: IMP
    original_reference_id: PMID:11709185
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:11709185
          supporting_text: Degenerative disorders caused by Bcl-2 deficiency 
            prevented by loss of its BH3-only antagonist Bim.
  - term:
      id: GO:0031966
      label: mitochondrial membrane
    evidence_type: IDA
    original_reference_id: PMID:11980919
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:11980919
          supporting_text: 'Apr 29. Intrinsic and extrinsic pathway signaling during
            neuronal apoptosis: lessons from the analysis of mutant mice.'
  - term:
      id: GO:0040018
      label: positive regulation of multicellular organism growth
    evidence_type: IMP
    original_reference_id: PMID:11709185
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:11709185
          supporting_text: Degenerative disorders caused by Bcl-2 deficiency 
            prevented by loss of its BH3-only antagonist Bim.
  - term:
      id: GO:0043583
      label: ear development
    evidence_type: IMP
    original_reference_id: PMID:11709185
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:11709185
          supporting_text: Degenerative disorders caused by Bcl-2 deficiency 
            prevented by loss of its BH3-only antagonist Bim.
  - term:
      id: GO:0043583
      label: ear development
    evidence_type: IGI
    original_reference_id: PMID:11709185
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:11709185
          supporting_text: Degenerative disorders caused by Bcl-2 deficiency 
            prevented by loss of its BH3-only antagonist Bim.
  - term:
      id: GO:0048066
      label: developmental pigmentation
    evidence_type: IMP
    original_reference_id: PMID:11709185
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:11709185
          supporting_text: Degenerative disorders caused by Bcl-2 deficiency 
            prevented by loss of its BH3-only antagonist Bim.
  - term:
      id: GO:0048066
      label: developmental pigmentation
    evidence_type: IGI
    original_reference_id: PMID:11709185
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:11709185
          supporting_text: Degenerative disorders caused by Bcl-2 deficiency 
            prevented by loss of its BH3-only antagonist Bim.
  - term:
      id: GO:0021747
      label: cochlear nucleus development
    evidence_type: IMP
    original_reference_id: PMID:11027399
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:11027399
          supporting_text: Patterns of cell death in mouse anteroventral 
            cochlear nucleus neurons after unilateral cochlea removal.
  - term:
      id: GO:0043524
      label: negative regulation of neuron apoptotic process
    evidence_type: IMP
    original_reference_id: PMID:11027399
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:11027399
          supporting_text: Patterns of cell death in mouse anteroventral 
            cochlear nucleus neurons after unilateral cochlea removal.
  - term:
      id: GO:0048743
      label: positive regulation of skeletal muscle fiber development
    evidence_type: IMP
    original_reference_id: PMID:11146504
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:11146504
          supporting_text: 'Pro- and anti-apoptotic members of the Bcl-2 family in
            skeletal muscle: a distinct role for Bcl-2 in later stages of myogenesis.'
  - term:
      id: GO:0008283
      label: cell population proliferation
    evidence_type: IGI
    original_reference_id: PMID:10762311
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:10762311
          supporting_text: Differences in bcl-2- and bax-independent function in
            regulating apoptosis in sensory neuron populations.
  - term:
      id: GO:0051402
      label: neuron apoptotic process
    evidence_type: IGI
    original_reference_id: PMID:10762311
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:10762311
          supporting_text: Differences in bcl-2- and bax-independent function in
            regulating apoptosis in sensory neuron populations.
  - term:
      id: GO:0043524
      label: negative regulation of neuron apoptotic process
    evidence_type: IMP
    original_reference_id: PMID:10762311
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:10762311
          supporting_text: Differences in bcl-2- and bax-independent function in
            regulating apoptosis in sensory neuron populations.
  - term:
      id: GO:0009636
      label: response to toxic substance
    evidence_type: IMP
    original_reference_id: PMID:10602483
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:10602483
          supporting_text: 'Damage-induced apoptosis in intestinal epithelia from
            bcl-2-null and bax-null mice: investigations of the mechanistic determinants
            of epithelial apoptosis in vivo.'
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IMP
    original_reference_id: PMID:10602483
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:10602483
          supporting_text: 'Damage-induced apoptosis in intestinal epithelia from
            bcl-2-null and bax-null mice: investigations of the mechanistic determinants
            of epithelial apoptosis in vivo.'
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IMP
    original_reference_id: PMID:10321489
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:10321489
          supporting_text: Retinal ganglion cell loss after the period of 
            naturally occurring cell death in bcl-2-/- mice.
  - term:
      id: GO:0046671
      label: negative regulation of retinal cell programmed cell death
    evidence_type: IMP
    original_reference_id: PMID:10321489
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:10321489
          supporting_text: Retinal ganglion cell loss after the period of 
            naturally occurring cell death in bcl-2-/- mice.
  - term:
      id: GO:0001822
      label: kidney development
    evidence_type: IMP
    original_reference_id: PMID:9950951
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9950951
          supporting_text: Nuclear localization of beta-catenin and loss of 
            apical brush border actin in cystic tubules of bcl-2 -/- mice.
  - term:
      id: GO:0007015
      label: actin filament organization
    evidence_type: IMP
    original_reference_id: PMID:9950951
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9950951
          supporting_text: Nuclear localization of beta-catenin and loss of 
            apical brush border actin in cystic tubules of bcl-2 -/- mice.
  - term:
      id: GO:0032880
      label: regulation of protein localization
    evidence_type: IMP
    original_reference_id: PMID:9950951
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9950951
          supporting_text: Nuclear localization of beta-catenin and loss of 
            apical brush border actin in cystic tubules of bcl-2 -/- mice.
  - term:
      id: GO:0010224
      label: response to UV-B
    evidence_type: IMP
    original_reference_id: PMID:10200548
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:10200548
          supporting_text: Alterations in cell death and cell cycle progression 
            in the UV-irradiated epidermis of bcl-2-deficient mice.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IMP
    original_reference_id: PMID:10200548
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:10200548
          supporting_text: Alterations in cell death and cell cycle progression 
            in the UV-irradiated epidermis of bcl-2-deficient mice.
  - term:
      id: GO:0051726
      label: regulation of cell cycle
    evidence_type: IMP
    original_reference_id: PMID:10200548
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:10200548
          supporting_text: Alterations in cell death and cell cycle progression 
            in the UV-irradiated epidermis of bcl-2-deficient mice.
  - term:
      id: GO:0000902
      label: cell morphogenesis
    evidence_type: IMP
    original_reference_id: PMID:10193316
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:10193316
          supporting_text: The bcl-2 knockout mouse exhibits marked changes in 
            osteoblast phenotype and collagen deposition in bone as well as a 
            mild growth plate phenotype.
  - term:
      id: GO:0001503
      label: ossification
    evidence_type: IMP
    original_reference_id: PMID:10193316
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:10193316
          supporting_text: The bcl-2 knockout mouse exhibits marked changes in 
            osteoblast phenotype and collagen deposition in bone as well as a 
            mild growth plate phenotype.
  - term:
      id: GO:0033689
      label: negative regulation of osteoblast proliferation
    evidence_type: IMP
    original_reference_id: PMID:10193316
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:10193316
          supporting_text: The bcl-2 knockout mouse exhibits marked changes in 
            osteoblast phenotype and collagen deposition in bone as well as a 
            mild growth plate phenotype.
  - term:
      id: GO:0014042
      label: positive regulation of neuron maturation
    evidence_type: IMP
    original_reference_id: PMID:9547242
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9547242
          supporting_text: Bcl-2 accelerates the maturation of early sensory 
            neurons.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IMP
    original_reference_id: PMID:9374413
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9374413
          supporting_text: Bcl-2 is required for cranial sensory neuron survival
            at defined stages of embryonic development.
  - term:
      id: GO:0001822
      label: kidney development
    evidence_type: IGI
    original_reference_id: PMID:9241272
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9241272
          supporting_text: Bcl-2 and Bax function independently to regulate cell
            death.
  - term:
      id: GO:0006808
      label: regulation of nitrogen utilization
    evidence_type: IGI
    original_reference_id: PMID:9241272
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9241272
          supporting_text: Bcl-2 and Bax function independently to regulate cell
            death.
  - term:
      id: GO:0008584
      label: male gonad development
    evidence_type: IGI
    original_reference_id: PMID:9241272
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9241272
          supporting_text: Bcl-2 and Bax function independently to regulate cell
            death.
  - term:
      id: GO:0009791
      label: post-embryonic development
    evidence_type: IGI
    original_reference_id: PMID:9241272
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9241272
          supporting_text: Bcl-2 and Bax function independently to regulate cell
            death.
  - term:
      id: GO:0045930
      label: negative regulation of mitotic cell cycle
    evidence_type: IDA
    original_reference_id: PMID:9241272
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9241272
          supporting_text: Bcl-2 and Bax function independently to regulate cell
            death.
  - term:
      id: GO:0048087
      label: positive regulation of developmental pigmentation
    evidence_type: IGI
    original_reference_id: PMID:9241272
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9241272
          supporting_text: Bcl-2 and Bax function independently to regulate cell
            death.
  - term:
      id: GO:0048538
      label: thymus development
    evidence_type: IMP
    original_reference_id: PMID:9241272
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9241272
          supporting_text: Bcl-2 and Bax function independently to regulate cell
            death.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IMP
    original_reference_id: PMID:9153592
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9153592
          supporting_text: Susceptibility of cerebellar granule neurons derived 
            from Bcl-2-deficient and transgenic mice to cell death.
  - term:
      id: GO:0033033
      label: negative regulation of myeloid cell apoptotic process
    evidence_type: IDA
    original_reference_id: PMID:9202146
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9202146
          supporting_text: Differential involvement of caspases in apoptosis of 
            myeloid leukemic cells induced by chemotherapy versus growth factor 
            withdrawal.
  - term:
      id: GO:0009410
      label: response to xenobiotic stimulus
    evidence_type: IDA
    original_reference_id: PMID:9098922
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9098922
          supporting_text: Valproic acid-induced changes in gene expression 
            during neurulation in a mouse model.
  - term:
      id: GO:0007409
      label: axonogenesis
    evidence_type: IMP
    original_reference_id: PMID:9009190
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9009190
          supporting_text: Bcl-2 promotes regeneration of severed axons in 
            mammalian CNS.
  - term:
      id: GO:0031103
      label: axon regeneration
    evidence_type: IDA
    original_reference_id: PMID:9009190
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9009190
          supporting_text: Bcl-2 promotes regeneration of severed axons in 
            mammalian CNS.
  - term:
      id: GO:0001776
      label: leukocyte homeostasis
    evidence_type: IMP
    original_reference_id: PMID:9028316
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9028316
          supporting_text: Role of bcl-2 in the development of lymphoid cells 
            from the hematopoietic stem cell.
  - term:
      id: GO:0002320
      label: lymphoid progenitor cell differentiation
    evidence_type: IMP
    original_reference_id: PMID:9028316
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9028316
          supporting_text: Role of bcl-2 in the development of lymphoid cells 
            from the hematopoietic stem cell.
  - term:
      id: GO:0030183
      label: B cell differentiation
    evidence_type: IMP
    original_reference_id: PMID:9028316
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9028316
          supporting_text: Role of bcl-2 in the development of lymphoid cells 
            from the hematopoietic stem cell.
  - term:
      id: GO:0033077
      label: T cell differentiation in thymus
    evidence_type: IMP
    original_reference_id: PMID:9028316
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9028316
          supporting_text: Role of bcl-2 in the development of lymphoid cells 
            from the hematopoietic stem cell.
  - term:
      id: GO:0030279
      label: negative regulation of ossification
    evidence_type: IMP
    original_reference_id: PMID:9008714
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9008714
          supporting_text: Bcl-2 lies downstream of parathyroid hormone-related 
            peptide in a signaling pathway that regulates chondrocyte maturation
            during skeletal development.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IDA
    original_reference_id: PMID:7834747
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7834747
          supporting_text: 'Cloning and functional analysis of BAG-1: a novel Bcl-2-binding
            protein with anti-cell death activity.'
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IGI
    original_reference_id: PMID:7834747
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7834747
          supporting_text: 'Cloning and functional analysis of BAG-1: a novel Bcl-2-binding
            protein with anti-cell death activity.'
  - term:
      id: GO:0001822
      label: kidney development
    evidence_type: IMP
    original_reference_id: PMID:8760259
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8760259
          supporting_text: Abnormal postpartum renal development and 
            cystogenesis in the bcl-2 (-/-) mouse.
  - term:
      id: GO:0003014
      label: renal system process
    evidence_type: IMP
    original_reference_id: PMID:8760259
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8760259
          supporting_text: Abnormal postpartum renal development and 
            cystogenesis in the bcl-2 (-/-) mouse.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IMP
    original_reference_id: PMID:8760259
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8760259
          supporting_text: Abnormal postpartum renal development and 
            cystogenesis in the bcl-2 (-/-) mouse.
  - term:
      id: GO:0030318
      label: melanocyte differentiation
    evidence_type: IMP
    original_reference_id: PMID:8758925
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8758925
          supporting_text: Accelerated disappearance of melanocytes in 
            bcl-2-deficient mice.
  - term:
      id: GO:0048753
      label: pigment granule organization
    evidence_type: IMP
    original_reference_id: PMID:8758925
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8758925
          supporting_text: Accelerated disappearance of melanocytes in 
            bcl-2-deficient mice.
  - term:
      id: GO:0001656
      label: metanephros development
    evidence_type: IMP
    original_reference_id: PMID:8623928
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8623928
          supporting_text: Apoptosis during an early stage of nephrogenesis 
            induces renal hypoplasia in bcl-2-deficient mice.
  - term:
      id: GO:0009791
      label: post-embryonic development
    evidence_type: IMP
    original_reference_id: PMID:8755480
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8755480
          supporting_text: Inactivation of bcl-2 results in progressive 
            degeneration of motoneurons, sympathetic and sensory neurons during 
            early postnatal development.
  - term:
      id: GO:0014031
      label: mesenchymal cell development
    evidence_type: IMP
    original_reference_id: PMID:8623928
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8623928
          supporting_text: Apoptosis during an early stage of nephrogenesis 
            induces renal hypoplasia in bcl-2-deficient mice.
  - term:
      id: GO:0032835
      label: glomerulus development
    evidence_type: IMP
    original_reference_id: PMID:8623928
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8623928
          supporting_text: Apoptosis during an early stage of nephrogenesis 
            induces renal hypoplasia in bcl-2-deficient mice.
  - term:
      id: GO:0035265
      label: organ growth
    evidence_type: IMP
    original_reference_id: PMID:8623928
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8623928
          supporting_text: Apoptosis during an early stage of nephrogenesis 
            induces renal hypoplasia in bcl-2-deficient mice.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IMP
    original_reference_id: PMID:8623928
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8623928
          supporting_text: Apoptosis during an early stage of nephrogenesis 
            induces renal hypoplasia in bcl-2-deficient mice.
  - term:
      id: GO:0008285
      label: negative regulation of cell population proliferation
    evidence_type: IMP
    original_reference_id: PMID:8663032
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8663032
          supporting_text: Diminished cell proliferation associated with the 
            death-protective activity of Bcl-2.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IMP
    original_reference_id: PMID:8663032
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8663032
          supporting_text: Diminished cell proliferation associated with the 
            death-protective activity of Bcl-2.
  - term:
      id: GO:0002326
      label: B cell lineage commitment
    evidence_type: IMP
    original_reference_id: PMID:8788039
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8788039
          supporting_text: Distinct patterns of Fas cell surface expression 
            during development of T- or B-lymphocyte lineages in normal, scid, 
            and mutant mice lacking or overexpressing p53, bcl-2, or rag-2 
            genes.
  - term:
      id: GO:0002360
      label: T cell lineage commitment
    evidence_type: IMP
    original_reference_id: PMID:8788039
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8788039
          supporting_text: Distinct patterns of Fas cell surface expression 
            during development of T- or B-lymphocyte lineages in normal, scid, 
            and mutant mice lacking or overexpressing p53, bcl-2, or rag-2 
            genes.
  - term:
      id: GO:0043524
      label: negative regulation of neuron apoptotic process
    evidence_type: IDA
    original_reference_id: PMID:7472523
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7472523
          supporting_text: Bcl-2 overexpression prevents motoneuron cell body 
            loss but not axonal degeneration in a mouse model of a 
            neurodegenerative disease.
  - term:
      id: GO:0005737
      label: cytoplasm
    evidence_type: IDA
    original_reference_id: PMID:7675327
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7675327
          supporting_text: Up-regulation of bax and down-regulation of bcl-2 is 
            associated with kainate-induced apoptosis in mouse brain.
  - term:
      id: GO:0001541
      label: ovarian follicle development
    evidence_type: IMP
    original_reference_id: PMID:7628407
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7628407
          supporting_text: Ablation of bcl-2 gene expression decreases the 
            numbers of oocytes and primordial follicles established in the 
            post-natal female mouse gonad.
  - term:
      id: GO:0048599
      label: oocyte development
    evidence_type: IMP
    original_reference_id: PMID:7628407
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7628407
          supporting_text: Ablation of bcl-2 gene expression decreases the 
            numbers of oocytes and primordial follicles established in the 
            post-natal female mouse gonad.
  - term:
      id: GO:0005737
      label: cytoplasm
    evidence_type: IDA
    original_reference_id: PMID:7563251
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7563251
          supporting_text: Differential regulation of bcl-2, bax, c-fos, junB, 
            and krox-24 expression in the cerebellum of Purkinje cell 
            degeneration mutant mice.
  - term:
      id: GO:0001656
      label: metanephros development
    evidence_type: IMP
    original_reference_id: PMID:7840250
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7840250
          supporting_text: Fulminant metanephric apoptosis and abnormal kidney 
            development in bcl-2-deficient mice.
  - term:
      id: GO:0001822
      label: kidney development
    evidence_type: IMP
    original_reference_id: PMID:7840250
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7840250
          supporting_text: Fulminant metanephric apoptosis and abnormal kidney 
            development in bcl-2-deficient mice.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IMP
    original_reference_id: PMID:7840250
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7840250
          supporting_text: Fulminant metanephric apoptosis and abnormal kidney 
            development in bcl-2-deficient mice.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IDA
    original_reference_id: PMID:7751019
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7751019
          supporting_text: Apoptosis and Bcl-2 expression in cultured murine 
            splenic T cells.
  - term:
      id: GO:0001822
      label: kidney development
    evidence_type: IMP
    original_reference_id: PMID:7812968
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7812968
          supporting_text: 'bcl-2 deficiency in mice leads to pleiotropic abnormalities:
            accelerated lymphoid cell death in thymus and spleen, polycystic kidney,
            hair hypopigmentation, and distorted small intestine.'
  - term:
      id: GO:0002520
      label: immune system development
    evidence_type: IMP
    original_reference_id: PMID:7812968
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7812968
          supporting_text: 'bcl-2 deficiency in mice leads to pleiotropic abnormalities:
            accelerated lymphoid cell death in thymus and spleen, polycystic kidney,
            hair hypopigmentation, and distorted small intestine.'
  - term:
      id: GO:0009791
      label: post-embryonic development
    evidence_type: IMP
    original_reference_id: PMID:7812968
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7812968
          supporting_text: 'bcl-2 deficiency in mice leads to pleiotropic abnormalities:
            accelerated lymphoid cell death in thymus and spleen, polycystic kidney,
            hair hypopigmentation, and distorted small intestine.'
  - term:
      id: GO:0022612
      label: gland morphogenesis
    evidence_type: IMP
    original_reference_id: PMID:7812968
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7812968
          supporting_text: 'bcl-2 deficiency in mice leads to pleiotropic abnormalities:
            accelerated lymphoid cell death in thymus and spleen, polycystic kidney,
            hair hypopigmentation, and distorted small intestine.'
  - term:
      id: GO:0030097
      label: hemopoiesis
    evidence_type: IMP
    original_reference_id: PMID:7812968
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7812968
          supporting_text: 'bcl-2 deficiency in mice leads to pleiotropic abnormalities:
            accelerated lymphoid cell death in thymus and spleen, polycystic kidney,
            hair hypopigmentation, and distorted small intestine.'
  - term:
      id: GO:0035265
      label: organ growth
    evidence_type: IMP
    original_reference_id: PMID:7812968
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7812968
          supporting_text: 'bcl-2 deficiency in mice leads to pleiotropic abnormalities:
            accelerated lymphoid cell death in thymus and spleen, polycystic kidney,
            hair hypopigmentation, and distorted small intestine.'
  - term:
      id: GO:0048546
      label: digestive tract morphogenesis
    evidence_type: IMP
    original_reference_id: PMID:7812968
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7812968
          supporting_text: 'bcl-2 deficiency in mice leads to pleiotropic abnormalities:
            accelerated lymphoid cell death in thymus and spleen, polycystic kidney,
            hair hypopigmentation, and distorted small intestine.'
  - term:
      id: GO:0005634
      label: nucleus
    evidence_type: IDA
    original_reference_id: PMID:7945396
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7945396
          supporting_text: Bcl-2 overexpression abolishes early calcium waving 
            preceding apoptosis in NIH-3T3 murine fibroblasts.
  - term:
      id: GO:0005739
      label: mitochondrion
    evidence_type: IDA
    original_reference_id: PMID:7945396
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7945396
          supporting_text: Bcl-2 overexpression abolishes early calcium waving 
            preceding apoptosis in NIH-3T3 murine fibroblasts.
  - term:
      id: GO:0006874
      label: intracellular calcium ion homeostasis
    evidence_type: IDA
    original_reference_id: PMID:7945396
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7945396
          supporting_text: Bcl-2 overexpression abolishes early calcium waving 
            preceding apoptosis in NIH-3T3 murine fibroblasts.
  - term:
      id: GO:0005634
      label: nucleus
    evidence_type: IDA
    original_reference_id: PMID:7953633
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7953633
          supporting_text: Expression of Bcl-2 protein in murine neural cells in
            culture.
  - term:
      id: GO:0005739
      label: mitochondrion
    evidence_type: IDA
    original_reference_id: PMID:7953633
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7953633
          supporting_text: Expression of Bcl-2 protein in murine neural cells in
            culture.
  - term:
      id: GO:0043209
      label: myelin sheath
    evidence_type: IDA
    original_reference_id: PMID:7953633
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:7953633
          supporting_text: Expression of Bcl-2 protein in murine neural cells in
            culture.
  - term:
      id: GO:0002520
      label: immune system development
    evidence_type: IMP
    original_reference_id: PMID:8372353
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8372353
          supporting_text: Disappearance of the lymphoid system in Bcl-2 
            homozygous mutant chimeric mice.
  - term:
      id: GO:0005634
      label: nucleus
    evidence_type: IDA
    original_reference_id: PMID:8030757
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8030757
          supporting_text: Bcl-2 protein expression during murine development.
  - term:
      id: GO:0005737
      label: cytoplasm
    evidence_type: IDA
    original_reference_id: PMID:8030757
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8030757
          supporting_text: Bcl-2 protein expression during murine development.
  - term:
      id: GO:0005783
      label: endoplasmic reticulum
    evidence_type: IDA
    original_reference_id: PMID:8030757
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8030757
          supporting_text: Bcl-2 protein expression during murine development.
  - term:
      id: GO:0005829
      label: cytosol
    evidence_type: IDA
    original_reference_id: PMID:8030757
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8030757
          supporting_text: Bcl-2 protein expression during murine development.
  - term:
      id: GO:0010332
      label: response to gamma radiation
    evidence_type: IMP
    original_reference_id: PMID:8372353
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8372353
          supporting_text: Disappearance of the lymphoid system in Bcl-2 
            homozygous mutant chimeric mice.
  - term:
      id: GO:0031965
      label: nuclear membrane
    evidence_type: IDA
    original_reference_id: PMID:8030757
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8030757
          supporting_text: Bcl-2 protein expression during murine development.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IDA
    original_reference_id: PMID:8313913
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8313913
          supporting_text: Developmental regulation of the Bcl-2 protein and 
            susceptibility to cell death in B lymphocytes.
  - term:
      id: GO:0051384
      label: response to glucocorticoid
    evidence_type: IDA
    original_reference_id: PMID:8313913
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8313913
          supporting_text: Developmental regulation of the Bcl-2 protein and 
            susceptibility to cell death in B lymphocytes.
  - term:
      id: GO:0051384
      label: response to glucocorticoid
    evidence_type: IMP
    original_reference_id: PMID:8372353
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8372353
          supporting_text: Disappearance of the lymphoid system in Bcl-2 
            homozygous mutant chimeric mice.
  - term:
      id: GO:0005739
      label: mitochondrion
    evidence_type: HDA
    original_reference_id: PMID:14651853
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:14651853
          supporting_text: Integrated analysis of protein composition, tissue 
            diversity, and gene regulation in mouse mitochondria.
  - term:
      id: GO:0008284
      label: positive regulation of cell population proliferation
    evidence_type: IDA
    original_reference_id: PMID:11983915
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:11983915
          supporting_text: bcl-2 overexpression promotes myocyte proliferation.
  - term:
      id: GO:0031069
      label: hair follicle morphogenesis
    evidence_type: IMP
    original_reference_id: PMID:8402909
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8402909
          supporting_text: Bcl-2-deficient mice demonstrate fulminant lymphoid 
            apoptosis, polycystic kidneys, and hypopigmented hair.
  - term:
      id: GO:0043473
      label: pigmentation
    evidence_type: IMP
    original_reference_id: PMID:8402909
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8402909
          supporting_text: Bcl-2-deficient mice demonstrate fulminant lymphoid 
            apoptosis, polycystic kidneys, and hypopigmented hair.
  - term:
      id: GO:0045069
      label: regulation of viral genome replication
    evidence_type: IDA
    original_reference_id: PMID:16950491
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:16950491
          supporting_text: Epub 2006 Sep 6. Role of Bcl-2 expression for 
            productive herpes simplex virus 2 replication.
  - term:
      id: GO:0001836
      label: release of cytochrome c from mitochondria
    evidence_type: IDA
    original_reference_id: PMID:9843949
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9843949
          supporting_text: Bax interacts with the permeability transition pore 
            to induce permeability transition and cytochrome c release in 
            isolated mitochondria.
  - term:
      id: GO:0046902
      label: regulation of mitochondrial membrane permeability
    evidence_type: IDA
    original_reference_id: PMID:9843949
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9843949
          supporting_text: Bax interacts with the permeability transition pore 
            to induce permeability transition and cytochrome c release in 
            isolated mitochondria.
  - term:
      id: GO:0051881
      label: regulation of mitochondrial membrane potential
    evidence_type: IDA
    original_reference_id: PMID:9843949
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:9843949
          supporting_text: Bax interacts with the permeability transition pore 
            to induce permeability transition and cytochrome c release in 
            isolated mitochondria.
  - term:
      id: GO:0043524
      label: negative regulation of neuron apoptotic process
    evidence_type: IDA
    original_reference_id: PMID:8625820
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:8625820
          supporting_text: Bax promotes neuronal survival and antagonises the 
            survival effects of neurotrophic factors.
  - term:
      id: GO:0005829
      label: cytosol
    evidence_type: IDA
    original_reference_id: PMID:14551195
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:14551195
          supporting_text: 2003 Oct 8. Targeted disruption of the PDZK1 gene in 
            mice causes tissue-specific depletion of the high density 
            lipoprotein receptor scavenger receptor class B type I and altered 
            lipoprotein metabolism.
  - term:
      id: GO:0043066
      label: negative regulation of apoptotic process
    evidence_type: IDA
    original_reference_id: PMID:14551195
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:14551195
          supporting_text: 2003 Oct 8. Targeted disruption of the PDZK1 gene in 
            mice causes tissue-specific depletion of the high density 
            lipoprotein receptor scavenger receptor class B type I and altered 
            lipoprotein metabolism.
  - term:
      id: GO:0005739
      label: mitochondrion
    evidence_type: IDA
    original_reference_id: PMID:12420306
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:12420306
          supporting_text: Sorting specificity of spermatogenic cell specific 
            region of mouse hexokinase-s (mHk1-s).
  - term:
      id: GO:0005829
      label: cytosol
    evidence_type: IDA
    original_reference_id: PMID:12050152
    review:
      summary: 'TODO: Review this GOA annotation'
      action: PENDING
      supported_by:
        - reference_id: PMID:12050152
          supporting_text: 2002 Jun 5. A novel transactivating factor that 
            regulates interferon-gamma-dependent gene expression.
references:
  - id: GO_REF:0000002
    title: Gene Ontology annotation through association of InterPro records with
      GO terms
    findings: []
  - id: GO_REF:0000008
    title: Gene Ontology annotation by the MGI curatorial staff, curated 
      orthology
    findings: []
  - id: GO_REF:0000024
    title: Manual transfer of experimentally-verified manual GO annotation data 
      to orthologs by curator judgment of sequence similarity
    findings: []
  - id: GO_REF:0000033
    title: Annotation inferences using phylogenetic trees
    findings: []
  - id: GO_REF:0000043
    title: Gene Ontology annotation based on UniProtKB/Swiss-Prot keyword 
      mapping
    findings: []
  - id: GO_REF:0000096
    title: Automated transfer of experimentally-verified manual GO annotation 
      data to mouse-rat orthologs
    findings: []
  - id: GO_REF:0000107
    title: Automatic transfer of experimentally verified manual GO annotation 
      data to orthologs using Ensembl Compara
    findings: []
  - id: GO_REF:0000108
    title: Automatic assignment of GO terms using logical inference, based on on
      inter-ontology links
    findings: []
  - id: GO_REF:0000117
    title: Electronic Gene Ontology annotations created by ARBA machine learning
      models
    findings: []
  - id: GO_REF:0000119
    title: Automated transfer of experimentally-verified manual GO annotation 
      data to mouse-human orthologs
    findings: []
  - id: GO_REF:0000120
    title: Combined Automated Annotation using Multiple IEA Methods
    findings: []
  - id: PMID:10193316
    title: The bcl-2 knockout mouse exhibits marked changes in osteoblast 
      phenotype and collagen deposition in bone as well as a mild growth plate 
      phenotype.
    findings: []
  - id: PMID:10200548
    title: Alterations in cell death and cell cycle progression in the 
      UV-irradiated epidermis of bcl-2-deficient mice.
    findings: []
  - id: PMID:10321489
    title: Retinal ganglion cell loss after the period of naturally occurring 
      cell death in bcl-2-/- mice.
    findings: []
  - id: PMID:10488913
    title: Targeted disruption of the bcl-2 gene in mice exacerbates focal 
      ischemic brain injury.
    findings: []
  - id: PMID:10582606
    title: Bax and Bcl-2 interaction in a transgenic mouse model of familial 
      amyotrophic lateral sclerosis.
    findings: []
  - id: PMID:10597216
    title: Bis, a Bcl-2-binding protein that synergizes with Bcl-2 in preventing
      cell death.
    findings: []
  - id: PMID:10602483
    title: "Damage-induced apoptosis in intestinal epithelia from bcl-2-null and bax-null
      mice: investigations of the mechanistic determinants of epithelial apoptosis
      in vivo."
    findings: []
  - id: PMID:10674380
    title: Hair follicle apoptosis and Bcl-2.
    findings: []
  - id: PMID:10726970
    title: Developmental changes in antioxidant enzymes and oxidative damage in 
      kidneys, liver and brain of bcl-2 knockout mice.
    findings: []
  - id: PMID:10762311
    title: Differences in bcl-2- and bax-independent function in regulating 
      apoptosis in sensory neuron populations.
    findings: []
  - id: PMID:10815637
    title: Effects of deficiency in p53 or bcl-2 on the sensitivity of 
      clonogenic cells in the small intestine to low dose-rate irradiation.
    findings: []
  - id: PMID:11027399
    title: Patterns of cell death in mouse anteroventral cochlear nucleus 
      neurons after unilateral cochlea removal.
    findings: []
  - id: PMID:11146504
    title: 'Pro- and anti-apoptotic members of the Bcl-2 family in skeletal muscle:
      a distinct role for Bcl-2 in later stages of myogenesis.'
    findings: []
  - id: PMID:11226327
    title: Bax ablation prevents dopaminergic neurodegeneration in the 1-methyl-
      4-phenyl-1,2,3,6-tetrahydropyridine mouse model of Parkinson's disease.
    findings: []
  - id: PMID:11546872
    title: 'Bmf: a proapoptotic BH3-only protein regulated by interaction with the
      myosin V actin motor complex, activated by anoikis.'
    findings: []
  - id: PMID:11709185
    title: Degenerative disorders caused by Bcl-2 deficiency prevented by loss 
      of its BH3-only antagonist Bim.
    findings: []
  - id: PMID:11980919
    title: 'Intrinsic and extrinsic pathway signaling during neuronal apoptosis: lessons
      from the analysis of mutant mice.'
    findings: []
  - id: PMID:11983915
    title: bcl-2 overexpression promotes myocyte proliferation.
    findings: []
  - id: PMID:12050152
    title: A novel transactivating factor that regulates 
      interferon-gamma-dependent gene expression.
    findings: []
  - id: PMID:12082633
    title: Proapoptotic activity of ITM2B(s), a BH3-only protein induced upon 
      IL-2-deprivation which interacts with Bcl-2.
    findings: []
  - id: PMID:12086670
    title: Bcl2 regulation by the melanocyte master regulator Mitf modulates 
      lineage survival and melanoma cell viability.
    findings: []
  - id: PMID:12420306
    title: Sorting specificity of spermatogenic cell specific region of mouse 
      hexokinase-s (mHk1-s).
    findings: []
  - id: PMID:12617961
    title: Calcium-dependent interaction of calcineurin with Bcl-2 in neuronal 
      tissue.
    findings: []
  - id: PMID:12855558
    title: Bcl2 retards G1/S cell cycle transition by regulating intracellular 
      ROS.
    findings: []
  - id: PMID:1373874
    title: Bcl-2 confers growth and survival advantage to interleukin 
      7-dependent early pre-B cells which become factor independent by a 
      multistep process in culture.
    findings: []
  - id: PMID:14551195
    title: Targeted disruption of the PDZK1 gene in mice causes tissue-specific 
      depletion of the high density lipoprotein receptor scavenger receptor 
      class B type I and altered lipoprotein metabolism.
    findings: []
  - id: PMID:14651853
    title: Integrated analysis of protein composition, tissue diversity, and 
      gene regulation in mouse mitochondria.
    findings: []
  - id: PMID:14660795
    title: Mono- and multisite phosphorylation enhances Bcl2's antiapoptotic 
      function and inhibition of cell cycle entry functions.
    findings: []
  - id: PMID:14699151
    title: Interaction of bcl-2 with Paxillin through its BH4 domain is 
      important during ureteric bud branching.
    findings: []
  - id: PMID:14707049
    title: TCR-independent and caspase-independent apoptosis of murine 
      thymocytes by CD24 cross-linking.
    findings: []
  - id: PMID:15292044
    title: Alterations in cell-adhesive and migratory properties of proximal 
      tubule and collecting duct cells from bcl-2 -/- mice.
    findings: []
  - id: PMID:15613488
    title: Proapoptotic BAX and BAK regulate the type 1 inositol trisphosphate 
      receptor and calcium leak from the endoplasmic reticulum.
    findings: []
  - id: PMID:15776018
    title: Proapoptotic BAX and BAK control multiple initiator caspases.
    findings: []
  - id: PMID:15818405
    title: Polycystic kidney disease prevented by transgenic RNA interference.
    findings: []
  - id: PMID:15983387
    title: Frag1, a homolog of alternative replication factor C subunits, links 
      replication stress surveillance with apoptosis.
    findings: []
  - id: PMID:16095731
    title: 'Increased anxiety-like behaviors and mitochondrial dysfunction in mice
      with targeted mutation of the Bcl-2 gene: further support for the involvement
      of mitochondrial function in anxiety disorders.'
    findings: []
  - id: PMID:16282979
    title: Loss of PKD1 and loss of Bcl-2 elicit polycystic kidney disease 
      through distinct mechanisms.
    findings: []
  - id: PMID:16427619
    title: Indispensable role of Bcl2 in the development of the melanocyte stem 
      cell.
    findings: []
  - id: PMID:16509771
    title: IAN family critically regulates survival and development of T 
      lymphocytes.
    findings: []
  - id: PMID:16672320
    title: Suppression of ureteric bud apoptosis rescues nephron endowment and 
      adult renal function in Pax2 mutant mice.
    findings: []
  - id: PMID:16717086
    title: PP2A regulates BCL-2 phosphorylation and proteasome-mediated 
      degradation at the endoplasmic reticulum.
    findings: []
  - id: PMID:16839884
    title: Mitochondrial rhomboid PARL regulates cytochrome c release during 
      apoptosis via OPA1-dependent cristae remodeling.
    findings: []
  - id: PMID:16950491
    title: Role of Bcl-2 expression for productive herpes simplex virus 2 
      replication.
    findings: []
  - id: PMID:17068116
    title: Radiation-induced gastric epithelial apoptosis occurs in the 
      proliferative zone and is regulated by p53, bak, bax, and bcl-2.
    findings: []
  - id: PMID:17267035
    title: Regulation of the lifespan in dendritic cell subsets.
    findings: []
  - id: PMID:17382917
    title: c-Myc is essential for urokinase plasminogen activator expression on 
      hypoxia-induced vascular smooth muscle cells.
    findings: []
  - id: PMID:17475835
    title: Involvement of heat shock protein (Hsp)90 beta but not Hsp90 alpha in
      antiapoptotic effect of CpG-B oligodeoxynucleotide.
    findings: []
  - id: PMID:17591857
    title: Bim/Bcl-2 balance is critical for maintaining naive and memory T cell
      homeostasis.
    findings: []
  - id: PMID:18223655
    title: Dual role of proapoptotic BAD in insulin secretion and beta cell 
      survival.
    findings: []
  - id: PMID:18548006
    title: Osteoclast size is controlled by Fra-2 through LIF/LIF-receptor 
      signalling and hypoxia.
    findings: []
  - id: PMID:18614015
    title: A mitochondrial protein compendium elucidates complex I disease 
      biology.
    findings: []
  - id: PMID:20621101
    title: Upregulation of Bcl2 inhibits apoptosis-driven BAX insertion but 
      favors BAX relocalization in mitochondria.
    findings: []
  - id: PMID:20819940
    title: Endogenous HMGB1 regulates autophagy.
    findings: []
  - id: PMID:21151042
    title: Cyclic-AMP-dependent protein kinase A regulates apoptosis by 
      stabilizing the BH3-only protein Bim.
    findings: []
  - id: PMID:22258505
    title: Exercise-induced BCL2-regulated autophagy is required for muscle 
      glucose homeostasis.
    findings: []
  - id: PMID:23629966
    title: Deacetylation of p53 induces autophagy by suppressing Bmf expression.
    findings: []
  - id: PMID:26949185
    title: BOK Is a Non-canonical BCL-2 Family Effector of Apoptosis Regulated 
      by ER-Associated Degradation.
    findings: []
  - id: PMID:29020630
    title: Degradation of Bcl-2 by XIAP and ARTS Promotes Apoptosis.
    findings: []
  - id: PMID:29849149
    title: Disruption of the beclin 1-BCL2 autophagy regulatory complex promotes
      longevity in mice.
    findings: []
  - id: PMID:36812915
    title: Exercise-activated hepatic autophagy via the FN1-α5β1 integrin 
      pathway drives metabolic benefits of exercise.
    findings: []
  - id: PMID:7472523
    title: Bcl-2 overexpression prevents motoneuron cell body loss but not 
      axonal degeneration in a mouse model of a neurodegenerative disease.
    findings: []
  - id: PMID:7546744
    title: Role of BCL-2 in the survival and function of developing and mature 
      sympathetic neurons.
    findings: []
  - id: PMID:7563251
    title: Differential regulation of bcl-2, bax, c-fos, junB, and krox-24 
      expression in the cerebellum of Purkinje cell degeneration mutant mice.
    findings: []
  - id: PMID:7595537
    title: Bcl-2 protects neural cells from cyanide/aglycemia-induced lipid 
      oxidation, mitochondrial injury, and loss of viability.
    findings: []
  - id: PMID:7628407
    title: Ablation of bcl-2 gene expression decreases the numbers of oocytes 
      and primordial follicles established in the post-natal female mouse gonad.
    findings: []
  - id: PMID:7650367
    title: Expression of Bcl-2, Bcl-x, and Bax after T cell activation and IL-2 
      withdrawal.
    findings: []
  - id: PMID:7650488
    title: Bcl-XL and Bcl-2 repress a common pathway of cell death.
    findings: []
  - id: PMID:7675327
    title: Up-regulation of bax and down-regulation of bcl-2 is associated with 
      kainate-induced apoptosis in mouse brain.
    findings: []
  - id: PMID:7751019
    title: Apoptosis and Bcl-2 expression in cultured murine splenic T cells.
    findings: []
  - id: PMID:7772249
    title: Evolutionary conservation of function among mammalian, avian, and 
      viral homologs of the Bcl-2 oncoprotein.
    findings: []
  - id: PMID:7812968
    title: "bcl-2 deficiency in mice leads to pleiotropic abnormalities: accelerated
      lymphoid cell death in thymus and spleen, polycystic kidney, hair hypopigmentation,
      and distorted small intestine."
    findings: []
  - id: PMID:7834747
    title: 'Cloning and functional analysis of BAG-1: a novel Bcl-2-binding protein
      with anti-cell death activity.'
    findings: []
  - id: PMID:7834748
    title: Bad, a heterodimeric partner for Bcl-XL and Bcl-2, displaces Bax and 
      promotes cell death.
    findings: []
  - id: PMID:7840250
    title: Fulminant metanephric apoptosis and abnormal kidney development in 
      bcl-2-deficient mice.
    findings: []
  - id: PMID:7896880
    title: The intracellular distribution and pattern of expression of Mcl-1 
      overlap with, but are not identical to, those of Bcl-2.
    findings: []
  - id: PMID:7945396
    title: Bcl-2 overexpression abolishes early calcium waving preceding 
      apoptosis in NIH-3T3 murine fibroblasts.
    findings: []
  - id: PMID:7953633
    title: Expression of Bcl-2 protein in murine neural cells in culture.
    findings: []
  - id: PMID:8022822
    title: Evidence that BCL-2 represses apoptosis by regulating endoplasmic 
      reticulum-associated Ca2+ fluxes.
    findings: []
  - id: PMID:8030757
    title: Bcl-2 protein expression during murine development.
    findings: []
  - id: PMID:8050499
    title: bcl-2 gene prevents apoptosis of basic fibroblast growth 
      factor-deprived murine aortic endothelial cells.
    findings: []
  - id: PMID:8080725
    title: bcl-2 gene enables rescue from in vitro myelosuppression (bone marrow
      cell death) induced by chemotherapy.
    findings: []
  - id: PMID:8084613
    title: Antisense oligonucleotides suppress B-cell lymphoma growth in a 
      SCID-hu mouse model.
    findings: []
  - id: PMID:8170972
    title: "Targeted disruption of Bcl-2 alpha beta in mice: occurrence of gray hair,
      polycystic kidney disease, and lymphocytopenia."
    findings: []
  - id: PMID:8313913
    title: Developmental regulation of the Bcl-2 protein and susceptibility to 
      cell death in B lymphocytes.
    findings: []
  - id: PMID:8372353
    title: Disappearance of the lymphoid system in Bcl-2 homozygous mutant 
      chimeric mice.
    findings: []
  - id: PMID:8402909
    title: Bcl-2-deficient mice demonstrate fulminant lymphoid apoptosis, 
      polycystic kidneys, and hypopigmented hair.
    findings: []
  - id: PMID:8623928
    title: Apoptosis during an early stage of nephrogenesis induces renal 
      hypoplasia in bcl-2-deficient mice.
    findings: []
  - id: PMID:8625820
    title: Bax promotes neuronal survival and antagonises the survival effects 
      of neurotrophic factors.
    findings: []
  - id: PMID:8663032
    title: Diminished cell proliferation associated with the death-protective 
      activity of Bcl-2.
    findings: []
  - id: PMID:8755480
    title: Inactivation of bcl-2 results in progressive degeneration of 
      motoneurons, sympathetic and sensory neurons during early postnatal 
      development.
    findings: []
  - id: PMID:8758925
    title: Accelerated disappearance of melanocytes in bcl-2-deficient mice.
    findings: []
  - id: PMID:8760259
    title: Abnormal postpartum renal development and cystogenesis in the bcl-2 
      (-/-) mouse.
    findings: []
  - id: PMID:8788039
    title: Distinct patterns of Fas cell surface expression during development 
      of T- or B-lymphocyte lineages in normal, scid, and mutant mice lacking or
      overexpressing p53, bcl-2, or rag-2 genes.
    findings: []
  - id: PMID:8918887
    title: 'BID: a novel BH3 domain-only death agonist.'
    findings: []
  - id: PMID:8949945
    title: Bcl-2 prevents hippocampal cell death induced by the neuroleptic drug
      haloperidol.
    findings: []
  - id: PMID:9008714
    title: Bcl-2 lies downstream of parathyroid hormone-related peptide in a 
      signaling pathway that regulates chondrocyte maturation during skeletal 
      development.
    findings: []
  - id: PMID:9009190
    title: Bcl-2 promotes regeneration of severed axons in mammalian CNS.
    findings: []
  - id: PMID:9028316
    title: Role of bcl-2 in the development of lymphoid cells from the 
      hematopoietic stem cell.
    findings: []
  - id: PMID:9098922
    title: Valproic acid-induced changes in gene expression during neurulation 
      in a mouse model.
    findings: []
  - id: PMID:9153592
    title: Susceptibility of cerebellar granule neurons derived from 
      Bcl-2-deficient and transgenic mice to cell death.
    findings: []
  - id: PMID:9184696
    title: The apoptosis and proliferation of SAC-activated B cells by IL-10 are
      associated with changes in Bcl-2, Bcl-xL, and Mcl-1 expression.
    findings: []
  - id: PMID:9202146
    title: Differential involvement of caspases in apoptosis of myeloid leukemic
      cells induced by chemotherapy versus growth factor withdrawal.
    findings: []
  - id: PMID:9215624
    title: Bcl-2 can rescue T lymphocyte development in interleukin-7 
      receptor-deficient mice but not in mutant rag-1-/- mice.
    findings: []
  - id: PMID:9241272
    title: Bcl-2 and Bax function independently to regulate cell death.
    findings: []
  - id: PMID:9374413
    title: Bcl-2 is required for cranial sensory neuron survival at defined 
      stages of embryonic development.
    findings: []
  - id: PMID:9547242
    title: Bcl-2 accelerates the maturation of early sensory neurons.
    findings: []
  - id: PMID:9560217
    title: Bax directly induces release of cytochrome c from isolated 
      mitochondria.
    findings: []
  - id: PMID:9681465
    title: Enhanced oxidative stress and altered antioxidants in brains of 
      Bcl-2-deficient mice.
    findings: []
  - id: PMID:9843949
    title: Bax interacts with the permeability transition pore to induce 
      permeability transition and cytochrome c release in isolated mitochondria.
    findings: []
  - id: PMID:9950951
    title: Nuclear localization of beta-catenin and loss of apical brush border 
      actin in cystic tubules of bcl-2 -/- mice.
    findings: []

Bcl2

Gene Description

Existing Annotations Review

References

📚 Additional Documentation

Deep Research Bioreason

BioReason Chat Export

Thinking Trace

Functional Summary

UniProt Summary

InterPro Domains

GO Terms

Deep Research Bioreason Rl

BioReason Chat Export

Thinking Trace

Functional Summary

UniProt Summary

InterPro Domains

GO Terms

Bioreason Rl Review

BioReason-Pro RL Review: Bcl2 (mouse)

Functional Summary Review

Notes on thinking trace

📄 View Raw YAML