{ "accession": "Q18287", "retrieved_at": "2026-09-10T14:34:40.329719+00:00", "prediction_url": "https://rest.uniprot.org/uniprotkb/protnlm/Q18287", "prediction_status": 200, "prediction": { "entryType": "UniProtKB unreviewed (TrEMBL)", "primaryAccession": "Q18287", "uniProtkbId": "Q18287_CAEEL", "entryAudit": { "firstPublicDate": "1111-11-10", "lastAnnotationUpdateDate": "1111-11-10", "lastSequenceUpdateDate": "1111-11-10", "entryVersion": 1, "sequenceVersion": 1 }, "annotationScore": 0.0, "proteinExistence": "5: Uncertain", "proteinDescription": { "submissionNames": [ { "fullName": { "evidences": [ { "evidenceCode": "ECO:0008006", "source": "Google", "id": "ProtNLM2", "properties": [ { "key": "model_score", "value": "0.06" }, { "key": "tmalign_accession", "value": "B2KI30" }, { "key": "tmalign_score_chain_1", "value": "0.77708" }, { "key": "tmalign_score_chain_2", "value": "0.53900" } ] } ], "value": "Serpin B10" } } ] }, "comments": [ { "texts": [ { "evidences": [ { "evidenceCode": "ECO:0008006", "source": "Google", "id": "ProtNLM2", "properties": [ { "key": "model_score", "value": "0.06" }, { "key": "tmalign_accession", "value": "P13731" }, { "key": "tmalign_score_chain_1", "value": "0.75181" }, { "key": "tmalign_score_chain_2", "value": "0.51459" } ] } ], "value": "Binds specifically to collagen. Could be involved as a chaperone in the biosynthetic pathway of collagen" } ], "commentType": "FUNCTION" }, { "commentType": "SUBCELLULAR LOCATION", "subcellularLocations": [ { "location": { "evidences": [ { "evidenceCode": "ECO:0008006", "source": "Google", "id": "ProtNLM2", "properties": [ { "key": "model_score", "value": "0.51" }, { "key": "tmalign_accession", "value": "P07092" }, { "key": "tmalign_score_chain_1", "value": "0.77690" }, { "key": "tmalign_score_chain_2", "value": "0.54065" } ] } ], "value": "Secreted", "id": "SL-0243" } } ] } ], "references": [ { "referenceNumber": 1, "citation": { "id": "CI-FC84BSHK1H4IL", "citationType": "unpublished observations" }, "referencePositions": [ "required field" ] } ], "uniProtKBCrossReferences": [ { "database": "GO", "id": "GO:0010466", "properties": [ { "key": "GoTerm", "value": "P:negative regulation of peptidase activity" }, { "key": "GoEvidenceType", "value": ":-" } ], "evidences": [ { "evidenceCode": "ECO:0008006", "source": "Google", "id": "ProtNLM2", "properties": [ { "key": "model_score", "value": "0.76" }, { "key": "tmalign_accession", "value": "B2KI30" }, { "key": "tmalign_score_chain_1", "value": "0.77708" }, { "key": "tmalign_score_chain_2", "value": "0.53900" } ] } ] }, { "database": "GO", "id": "GO:0004867", "properties": [ { "key": "GoTerm", "value": "F:serine-type endopeptidase inhibitor activity" }, { "key": "GoEvidenceType", "value": ":-" } ], "evidences": [ { "evidenceCode": "ECO:0008006", "source": "Google", "id": "ProtNLM2", "properties": [ { "key": "model_score", "value": "0.99" }, { "key": "tmalign_accession", "value": "B2KI30" }, { "key": "tmalign_score_chain_1", "value": "0.77708" }, { "key": "tmalign_score_chain_2", "value": "0.53900" } ] } ] } ], "extraAttributes": { "countByCommentType": { "FUNCTION": 1, "SUBCELLULAR LOCATION": 1 } } }, "uniprot_url": "https://rest.uniprot.org/uniprotkb/Q18287.json", "uniprot_status": 200, "uniprot": { "entryType": "UniProtKB unreviewed (TrEMBL)", "primaryAccession": "Q18287", "uniProtkbId": "Q18287_CAEEL", "entryAudit": { "firstPublicDate": "1996-11-01", "lastAnnotationUpdateDate": "2026-09-02", "lastSequenceUpdateDate": "2003-06-01", "entryVersion": 154, "sequenceVersion": 2 }, "annotationScore": 1.0, "organism": { "scientificName": "Caenorhabditis elegans", "taxonId": 6239, "evidences": [ { "evidenceCode": "ECO:0000313", "source": "EMBL", "id": "CCD63329.1" }, { "evidenceCode": "ECO:0000313", "source": "Proteomes", "id": "UP000001940" } ], "lineage": [ "Eukaryota", "Metazoa", "Ecdysozoa", "Nematoda", "Chromadorea", "Rhabditida", "Rhabditina", "Rhabditomorpha", "Rhabditoidea", "Rhabditidae", "Peloderinae", "Caenorhabditis" ] }, "proteinExistence": "4: Predicted", "proteinDescription": { "submissionNames": [ { "fullName": { "evidences": [ { "evidenceCode": "ECO:0000313", "source": "EMBL", "id": "CCD63329.1" } ], "value": "Serpin domain-containing protein" } } ] }, "genes": [ { "orfNames": [ { "evidences": [ { "evidenceCode": "ECO:0000313", "source": "EMBL", "id": "CCD63329.1" }, { "evidenceCode": "ECO:0000313", "source": "WormBase", "id": "C28G1.2" } ], "value": "C28G1.2" }, { "evidences": [ { "evidenceCode": "ECO:0000313", "source": "EMBL", "id": "CCD63329.1" } ], "value": "CELE_C28G1.2" } ] } ], "features": [ { "type": "Domain", "location": { "start": { "value": 96, "modifier": "EXACT" }, "end": { "value": 199, "modifier": "EXACT" } }, "description": "Serpin", "evidences": [ { "evidenceCode": "ECO:0000259", "source": "Pfam", "id": "PF00079" } ] } ], "keywords": [ { "evidences": [ { "evidenceCode": "ECO:0000313", "source": "Proteomes", "id": "UP000001940" } ], "id": "KW-1185", "category": "Technical term", "name": "Reference proteome" } ], "references": [ { "referenceNumber": 1, "citation": { "id": "9851916", "citationType": "journal article", "authoringGroup": [ "The C. elegans sequencing consortium" ], "authors": [ "Sulson J.E.", "Waterston R." ], "citationCrossReferences": [ { "database": "PubMed", "id": "9851916" }, { "database": "DOI", "id": "10.1126/science.282.5396.2012" } ], "title": "Genome sequence of the nematode C. elegans: a platform for investigating biology.", "publicationDate": "1998", "journal": "Science", "firstPage": "2012", "lastPage": "2018", "volume": "282" }, "referencePositions": [ "NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]" ], "referenceComments": [ { "evidences": [ { "evidenceCode": "ECO:0000313", "source": "EMBL", "id": "CCD63329.1" }, { "evidenceCode": "ECO:0000313", "source": "Proteomes", "id": "UP000001940" } ], "value": "Bristol N2", "type": "STRAIN" } ], "evidences": [ { "evidenceCode": "ECO:0000313", "source": "EMBL", "id": "CCD63329.1" }, { "evidenceCode": "ECO:0000313", "source": "Proteomes", "id": "UP000001940" } ] } ], "uniProtKBCrossReferences": [ { "database": "EMBL", "id": "BX284606", "properties": [ { "key": "ProteinId", "value": "CCD63329.1" }, { "key": "Status", "value": "-" }, { "key": "MoleculeType", "value": "Genomic_DNA" } ] }, { "database": "PIR", "id": "T15690", "properties": [ { "key": "EntryName", "value": "T15690" } ] }, { "database": "RefSeq", "id": "NP_509497.2", "properties": [ { "key": "NucleotideSequenceId", "value": "NM_077096.4" } ] }, { "database": "AlphaFoldDB", "id": "Q18287", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "SMR", "id": "Q18287", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "FunCoup", "id": "Q18287", "properties": [ { "key": "Number of interactors", "value": "829" } ] }, { "database": "STRING", "id": "6239.C28G1.2.1", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "PaxDb", "id": "6239-C28G1.2.1", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "GeneID", "id": "182990", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "KEGG", "id": "cel:CELE_C28G1.2", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "UCSC", "id": "C28G1.2", "properties": [ { "key": "OrganismName", "value": "c. elegans" } ] }, { "database": "AGR", "id": "WB:WBGene00016187", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "CTD", "id": "182990", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "WormBase", "id": "C28G1.2", "properties": [ { "key": "ProteinId", "value": "CE33520" }, { "key": "GeneId", "value": "WBGene00016187" }, { "key": "GeneName", "value": "-" } ] }, { "database": "eggNOG", "id": "KOG2392", "properties": [ { "key": "ToxonomicScope", "value": "Eukaryota" } ] }, { "database": "HOGENOM", "id": "CLU_1054583_0_0_1", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "InParanoid", "id": "Q18287", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "OMA", "id": "EPYFFKA", "properties": [ { "key": "Fingerprint", "value": "-" } ] }, { "database": "OrthoDB", "id": "9518664at2759", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "PhylomeDB", "id": "Q18287", "properties": [ { "key": "Description", "value": "-" } ] }, { "database": "Reactome", "id": "R-CEL-114608", "properties": [ { "key": "PathwayName", "value": "Platelet degranulation" } ] }, { "database": "Reactome", "id": "R-CEL-1650814", "properties": [ { "key": "PathwayName", "value": "Collagen biosynthesis and modifying enzymes" } ] }, { "database": "Reactome", "id": "R-CEL-381426", "properties": [ { "key": "PathwayName", "value": "Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)" } ] }, { "database": "Reactome", "id": "R-CEL-6798695", "properties": [ { "key": "PathwayName", "value": "Neutrophil degranulation" } ] }, { "database": "Reactome", "id": "R-CEL-75205", "properties": [ { "key": "PathwayName", "value": "Dissolution of Fibrin Clot" } ] }, { "database": "Reactome", "id": "R-CEL-8957275", "properties": [ { "key": "PathwayName", "value": "Post-translational protein phosphorylation" } ] }, { "database": "Reactome", "id": "R-CEL-9855719", "properties": [ { "key": "PathwayName", "value": "Regulation of FXIIa and plasma kallikrein activity" } ] }, { "database": "Reactome", "id": "R-CEL-9948001", "properties": [ { "key": "PathwayName", "value": "CASP4 inflammasome assembly" } ] }, { "database": "Proteomes", "id": "UP000001940", "properties": [ { "key": "Component", "value": "Chromosome X" } ] }, { "database": "Bgee", "id": "WBGene00016187", "properties": [ { "key": "ExpressionPatterns", "value": "Expressed in adult organism" } ] }, { "database": "Gene3D", "id": "2.30.39.10", "properties": [ { "key": "EntryName", "value": "Alpha-1-antitrypsin, domain 1" }, { "key": "MatchStatus", "value": "1" } ] }, { "database": "InterPro", "id": "IPR023796", "properties": [ { "key": "EntryName", "value": "Serpin_dom" } ] }, { "database": "InterPro", "id": "IPR036186", "properties": [ { "key": "EntryName", "value": "Serpin_sf" } ] }, { "database": "InterPro", "id": "IPR042185", "properties": [ { "key": "EntryName", "value": "Serpin_sf_2" } ] }, { "database": "Pfam", "id": "PF00079", "properties": [ { "key": "EntryName", "value": "Serpin" }, { "key": "MatchStatus", "value": "1" } ] }, { "database": "SUPFAM", "id": "SSF56574", "properties": [ { "key": "EntryName", "value": "Serpins" }, { "key": "MatchStatus", "value": "1" } ] } ], "sequence": { "value": "MSAQSLSGIETTFGLNLLNSVGCQESYVFSPISWLFVFALLGNEKFNSTVFDKYSDLGFLDSEVRSYLKNDLTDISVRADSGINDVRRNSPNQTRILFNAGWEEKLHEKRSWLFYPSKYNSKVITYLIKEKHVLLNVDDAFQMISIMYENKSLQFVVLVPSKPCGLKKALKKLTKQRFEKLFQESTVQLVQIMIPKLDVLQLLINSKVLGLQPPIKTSLKYKESPRISKMLYRPENRLPYHFRADHPFVFAVLRNGHPVYFGVFS", "length": 265, "molWeight": 30603, "crc64": "0CF1D10711CF1E07", "md5": "E045DD8EEDF226816ABA39BE11EF178A" }, "extraAttributes": { "countByFeatureType": { "Domain": 1 }, "uniParcId": "UPI000000C9C8" } } }