cmd-1

UniProt ID: O16305
Organism: Caenorhabditis elegans
Review Status: DRAFT
📝 Provide Detailed Feedback

Gene Description

cmd-1 encodes the single Caenorhabditis elegans calmodulin, a small EF-hand calcium sensor with four functional calcium-binding sites. The conserved core function is calcium-dependent binding and regulation of target proteins, including enzymes and spindle-associated factors. Experimental work in worms additionally places CMD-1 at spindle poles, centrosomes, the interphase nuclear membrane, and cell-cell boundaries in early embryos, and supports context-specific roles in meiotic spindle orientation, embryonic morphogenesis, apoptosis-related phenotypes, and neuronal chemotaxis. Falcon deep research further documents concrete downstream effector contexts: CMD-1 is the Ca2+/CaM activator component of the calcineurin phosphatase complex (with TAX-6 and CNB-1), it sets a transcriptionally controlled, limiting level of neuronal excitability, and it couples intestinal epithelial Ca2+ influx to NHX-6 activation in a gut-to-neuron host-defense pathway. Current GOA for cmd-1 contains no ISO annotations; the transfer-style annotations are IBA/IEA rather than ISO, so this ISO-focused pass mainly evaluates whether those orthology- derived calls are appropriately conservative.

Existing Annotations Review

GO Term Evidence Action Reason
GO:0005509 calcium ion binding
IBA
GO_REF:0000033
ACCEPT
Summary: This phylogenetically inferred annotation matches the defining biochemical property of calmodulin family proteins. cmd-1 is the sole worm calmodulin, UniProt records four functional calcium-binding sites, and no conflicting evidence exists.
Reason: Calcium ion binding is a conserved and central calmodulin activity, so the orthology-based transfer is well supported and represents core function.
Supporting Evidence:
file:worm/cmd-1/cmd-1-uniprot.txt
This protein has four functional calcium-binding sites.
file:worm/cmd-1/cmd-1-deep-research-falcon.md
encoding the Ca2+-binding messenger protein **CMD-1**
GO:0005737 cytoplasm
IBA
GO_REF:0000033
ACCEPT
Summary: Cytoplasmic localization is consistent with cmd-1 being a broadly acting soluble calcium sensor. Experimental work in embryos also places CMD-1 on spindle/centrosomal structures and other non-nuclear sites, which is compatible with a general cytoplasmic annotation.
Reason: Cytoplasm is a correct high-level cellular location for calmodulin and is sufficiently general to retain as a core localization term.
Supporting Evidence:
file:worm/cmd-1/cmd-1-uniprot.txt
DR GO; GO:0005737; C:cytoplasm; IBA:GO_Central.
GO:0030234 enzyme regulator activity
IBA
GO_REF:0000033
ACCEPT
Summary: Calmodulin-Ca2+ complexes regulate multiple enzyme classes, including kinases and phosphatases, and UniProt explicitly describes cmd-1 as a mediator of enzyme control. The term is broad, but it captures a genuine conserved molecular role.
Reason: Although general, enzyme regulator activity is an appropriate conserved summary term for calmodulin and reflects core function rather than a lineage-specific phenotype. Falcon deep research identifies a concrete worm enzyme target: CMD-1 is the Ca2+/CaM activator subunit of the calcineurin phosphatase complex (TAX-6 catalytic, CNB-1 regulatory).
Supporting Evidence:
file:worm/cmd-1/cmd-1-uniprot.txt
Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+).
file:worm/cmd-1/cmd-1-deep-research-falcon.md
CMD-1 is part of the calcineurin activation complex (TAX-6/CNB-1/CMD-1)
GO:0000226 microtubule cytoskeleton organization
IBA
GO_REF:0000033
KEEP AS NON CORE
Summary: The transfer is plausible because worm experiments support CMD-1 roles in spindle organization and spindle orientation. However, the specific evidence is tied to cell-division contexts rather than to a universally defining calmodulin function.
Reason: Retain the annotation as valid but non-core because it reflects a real, experimentally supported spindle phenotype without being the central conserved biochemical identity of the gene. Falcon deep research confirms this is a recurring spindle-pole module function spanning multiple studies.
Supporting Evidence:
PMID:19219036
ASPM-1, together with calmodulin (CMD-1), promotes meiotic spindle organization
file:worm/cmd-1/cmd-1-deep-research-falcon.md
CMD-1 acts with ASPM-1/LIN-5 to recruit dynein and drive meiotic spindle rotation
GO:0005509 calcium ion binding
IEA
GO_REF:0000002
ACCEPT
Summary: InterPro-derived calcium ion binding agrees with the IBA call and with the well-established EF-hand architecture of calmodulin.
Reason: This is a correct electronic annotation for a canonical EF-hand calcium- binding protein and matches core function.
Supporting Evidence:
file:worm/cmd-1/cmd-1-uniprot.txt
This protein has four functional calcium-binding sites.
GO:0072686 mitotic spindle
IEA
GO_REF:0000117
KEEP AS NON CORE
Summary: The ARBA localization is consistent with direct experimental embryo data showing CMD-1 accumulation on spindle structures. It is a correct but context-specific localization.
Reason: Mitotic spindle localization is supported, but it is not a universal core localization for calmodulin across all contexts.
Supporting Evidence:
file:worm/cmd-1/cmd-1-deep-research-falcon.md
CMD-1 acts with ASPM-1/LIN-5 to recruit dynein and drive meiotic spindle rotation
GO:0010629 negative regulation of gene expression
IMP
PMID:34499028
Neuronal calmodulin levels are controlled by CAMTA transcrip...
MARK AS OVER ANNOTATED
Summary: PMID:34499028 supports a specific autoregulatory loop in which high CMD-1 levels repress expression from the cmd-1 promoter through CAMT-1. That is more limited than generic negative regulation of gene expression.
Reason: The paper supports context-specific feedback on cmd-1 transcription, not a broad generic role in repressing gene expression across targets.
Supporting Evidence:
PMID:34499028
high levels of CMD-1 can repress expression from the cmd-1 promoter
GO:0050918 positive chemotaxis
IMP
PMID:34499028
Neuronal calmodulin levels are controlled by CAMTA transcrip...
KEEP AS NON CORE
Summary: Neuronal reduction of cmd-1 contributes to chemotaxis defects, and supplementing neuronal CMD-1 rescues attraction to several cues in the CAMT-1 regulatory context examined in the paper.
Reason: The phenotype is real but represents a specialized neuronal/behavioral context rather than the core conserved role of calmodulin. Falcon deep research underscores that neuronal CMD-1 abundance is a limiting, transcriptionally controlled determinant of sensory-neuron excitability and chemotaxis behavior.
Supporting Evidence:
PMID:34499028
restored normal chemotaxis toward salt, benzaldehyde, and diacetyl
file:worm/cmd-1/cmd-1-deep-research-falcon.md
reduced CaM levels are associated with hyperexcitable Ca2+ responses in sensory neurons
GO:0009792 embryo development ending in birth or egg hatching
IMP
PMID:14703012
Functional analysis of the single calmodulin gene in the nem...
KEEP AS NON CORE
Summary: cmd-1 RNAi causes severe embryonic lethality with disturbed morphogenesis, so the gene clearly contributes to successful embryogenesis.
Reason: This broad developmental phenotype is supported experimentally, but it is a pleiotropic consequence of depleting a global calcium sensor and should not be treated as core function. Falcon deep research quantifies the strong essentiality (~95% embryonic lethality by dsRNA injection) while framing it as downstream of CMD-1's global Ca2+-sensor role.
Supporting Evidence:
PMID:14703012
RNAi microinjection approach results in a severe embryonic lethal phenotype
file:worm/cmd-1/cmd-1-deep-research-falcon.md
cmd-1 knockdown produced **~95% embryonic lethality**
GO:0005813 centrosome
IDA
PMID:17716666
Cytokinesis is not controlled by calmodulin or myosin light ...
KEEP AS NON CORE
Summary: Full-text evidence from PMID:17716666 shows GFP-tagged CMD-1 accumulation at centrosomes in early embryos.
Reason: The localization is directly observed and valid, but it is a cell-division context rather than a core pan-context localization.
GO:0031965 nuclear membrane
IDA
PMID:17716666
Cytokinesis is not controlled by calmodulin or myosin light ...
KEEP AS NON CORE
Summary: The same embryo localization study reports CMD-1 at the interphase nuclear membrane.
Reason: The annotation is experimentally supported but context-specific and not a primary summary of calmodulin function.
GO:0071944 cell periphery
IDA
PMID:17716666
Cytokinesis is not controlled by calmodulin or myosin light ...
KEEP AS NON CORE
Summary: PMID:17716666 reports CMD-1 at the borders of abutting cells in embryos, which justifies a general cell periphery term.
Reason: Direct localization supports the term, but this is again a non-core, context-dependent localization.
GO:0072686 mitotic spindle
IDA
PMID:17716666
Cytokinesis is not controlled by calmodulin or myosin light ...
KEEP AS NON CORE
Summary: Direct imaging shows CMD-1 on spindle structures and not at the cleavage furrow in early embryos.
Reason: Correct experimental localization, but specialized to embryonic cell division rather than a core location.
GO:0005515 protein binding
IPI
PMID:19219036
NuMA-related LIN-5, ASPM-1, calmodulin and dynein promote me...
MODIFY
Summary: PMID:19219036 places CMD-1 in an ASPM-1/LIN-5 spindle-pole complex, so a physical interaction claim is credible. However, protein binding is too generic for calmodulin and loses the informative calcium-dependent nature of its target interactions.
Reason: The interaction evidence should be retained, but the annotation should use a more informative calmodulin-appropriate term rather than generic protein binding.
GO:0032880 regulation of protein localization
IMP
PMID:19219036
NuMA-related LIN-5, ASPM-1, calmodulin and dynein promote me...
KEEP AS NON CORE
Summary: The meiosis study shows CMD-1 promotes accumulation of LIN-5 at meiotic and mitotic spindle poles, which is an experimentally grounded protein localization phenotype.
Reason: This process annotation is valid but reflects a specific spindle-pole context, not cmd-1's central conserved biochemical identity. Falcon deep research reinforces that the CMD-1/LIN-5/ASPM-1 module recruits dynein to spindle poles, and that this recruitment is gated by CDK-1.
Supporting Evidence:
PMID:19219036
promotes meiotic spindle organization and the accumulation of LIN-5 at meiotic and mitotic spindle poles
file:worm/cmd-1/cmd-1-deep-research-falcon.md
CDK-1 inhibits spindle rotation by blocking the interaction between the **CMD-1–LIN-5–ASPM-1** module and **DHC-1/dynein**
GO:0051296 establishment of meiotic spindle orientation
IMP
PMID:19219036
NuMA-related LIN-5, ASPM-1, calmodulin and dynein promote me...
KEEP AS NON CORE
Summary: The paper directly concludes that LIN-5, ASPM-1, CMD-1 and dynein are required for spindle rotation during maternal meiosis.
Reason: Strong experimental support exists, but the process is specialized rather than core to calmodulin across contexts. Falcon deep research corroborates this with an independent follow-up study (Ellefson & McNally 2011) showing cmd-1(RNAi) abolishes meiosis I spindle rotation.
Supporting Evidence:
PMID:19219036
Spindle rotation during maternal meiosis is independent of GPR-1/2 and Galpha, yet requires LIN-5, ASPM-1, CMD-1 and dynein
file:worm/cmd-1/cmd-1-deep-research-falcon.md
cmd-1(RNAi) abolished meiosis I spindle rotation
GO:0051296 establishment of meiotic spindle orientation
IGI
PMID:19219036
NuMA-related LIN-5, ASPM-1, calmodulin and dynein promote me...
KEEP AS NON CORE
Summary: The genetic interaction-based version of the same process annotation is consistent with the paper's functional dissection of the spindle-pole complex.
Reason: Retain as non-core for the same reason as the IMP entry: direct support, but specialized biology.
Supporting Evidence:
PMID:19219036
Spindle rotation during maternal meiosis is independent of GPR-1/2 and Galpha, yet requires LIN-5, ASPM-1, CMD-1 and dynein
GO:0016477 cell migration
IMP
PMID:14703012
Functional analysis of the single calmodulin gene in the nem...
KEEP AS NON CORE
Summary: cmd-1 RNAi embryos show aberrant cell migration patterns according to the abstract, supporting a migration-related phenotype.
Reason: This is a pleiotropic developmental phenotype observed after strong loss of a global calcium sensor, so it should be retained only as non-core.
Supporting Evidence:
PMID:14703012
Embryos show disturbed morphogenesis, aberrant cell migration patterns
GO:0042981 regulation of apoptotic process
IMP
PMID:14703012
Functional analysis of the single calmodulin gene in the nem...
KEEP AS NON CORE
Summary: The abstract reports multiple defects in apoptosis after cmd-1 depletion, which supports involvement in apoptosis-related regulation.
Reason: The phenotype is supported, but it is broad and likely pleiotropic rather than a core defining function of calmodulin.
Supporting Evidence:
PMID:14703012
multiple defects in apoptosis
GO:0043277 apoptotic cell clearance
IMP
PMID:14703012
Functional analysis of the single calmodulin gene in the nem...
UNDECIDED
Summary: The accessible abstract supports apoptosis defects, but it does not clearly distinguish cell corpse clearance/engulfment from upstream apoptosis defects.
Reason: This specific term may be correct, but the currently accessible evidence is insufficiently specific to review it confidently.
GO:0051726 regulation of cell cycle
IMP
PMID:14703012
Functional analysis of the single calmodulin gene in the nem...
KEEP AS NON CORE
Summary: Hyperproliferation in cmd-1 RNAi embryos is consistent with cell-cycle dysregulation after depletion of calmodulin.
Reason: The phenotype is experimentally supported, but it is a broad developmental consequence rather than a core molecular role.
Supporting Evidence:
PMID:14703012
a striking hyperproliferation of cells

Core Functions

Primary EF-hand calcium sensor that binds calcium ions through four conserved sites and acts as the biochemical core of worm calmodulin function.

Molecular Function:
calcium ion binding
Cellular Locations:
Supporting Evidence:
  • file:worm/cmd-1/cmd-1-uniprot.txt
    This protein has four functional calcium-binding sites.

Calcium-loaded CMD-1 binds target proteins and mediates their regulation; this includes conserved Ca2+/CaM target binding across the worm proteome and spindle-pole associated interactions in embryos.

Cellular Locations:
Supporting Evidence:
  • PMID:17854888
    Calmodulin (CaM) is the primary Ca(2+)-sensor that regulates a wide variety of cellular processes in eukaryotes.
  • PMID:19219036
    ASPM-1, together with calmodulin (CMD-1), promotes meiotic spindle organization and the accumulation of LIN-5 at meiotic and mitotic spindle poles.

Calmodulin-Ca2+ acts as a broad enzyme regulator, stimulating downstream kinase and phosphatase targets rather than serving as an enzyme itself. A concrete worm example is the calcineurin phosphatase complex, in which CMD-1 is the Ca2+/CaM activator subunit alongside catalytic TAX-6 and regulatory CNB-1.

Molecular Function:
enzyme regulator activity
Cellular Locations:
Supporting Evidence:
  • file:worm/cmd-1/cmd-1-uniprot.txt
    Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+).
  • file:worm/cmd-1/cmd-1-deep-research-falcon.md
    CMD-1 is part of the calcineurin activation complex (TAX-6/CNB-1/CMD-1)

References

Gene Ontology annotation through association of InterPro records with GO terms
  • InterPro family mapping supports the calcium ion binding annotation for EF-hand calmodulin proteins.
Annotation inferences using phylogenetic trees
  • cmd-1 has no current ISO annotations in GOA; the orthology-style transfer set for this gene is IBA rather than ISO.
  • The IBA annotations capture conserved calmodulin properties such as calcium ion binding, cytoplasmic localization, and broad enzyme-regulatory function.
Electronic Gene Ontology annotations created by ARBA machine learning models
  • ARBA assigns mitotic spindle localization, which is consistent with direct embryo localization data.
Functional analysis of the single calmodulin gene in the nematode Caenorhabditis elegans by RNA interference and 4-D microscopy.
  • cmd-1 RNAi causes severe embryonic lethality with disturbed morphogenesis.
    "RNAi microinjection approach results in a severe embryonic lethal phenotype. Embryos show disturbed morphogenesis"
  • cmd-1 RNAi embryos show aberrant cell migration patterns, hyperproliferation, and multiple defects in apoptosis.
    "Embryos show disturbed morphogenesis, aberrant cell migration patterns, a striking hyperproliferation of cells and multiple defects in apoptosis."
Cytokinesis is not controlled by calmodulin or myosin light chain kinase in the Caenorhabditis elegans early embryo.
  • cmd-1 depletion does not block cytokinesis in early embryos.
    "RNA mediated interference against C. elegans calmodulin and candidate MLCKs had no effect on cytokinesis in wild-type or RhoK mutant embryos"
NuMA-related LIN-5, ASPM-1, calmodulin and dynein promote meiotic spindle rotation independently of cortical LIN-5/GPR/Galpha.
  • CMD-1 works with ASPM-1 and LIN-5 in a spindle-pole complex.
    "ASPM-1, together with calmodulin (CMD-1), promotes meiotic spindle organization and the accumulation of LIN-5 at meiotic and mitotic spindle poles."
  • CMD-1 promotes meiotic spindle organization and spindle rotation during maternal meiosis.
    "Spindle rotation during maternal meiosis is independent of GPR-1/2 and Galpha, yet requires LIN-5, ASPM-1, CMD-1 and dynein."
  • CMD-1 promotes accumulation of LIN-5 at meiotic and mitotic spindle poles.
    "ASPM-1, together with calmodulin (CMD-1), promotes meiotic spindle organization and the accumulation of LIN-5 at meiotic and mitotic spindle poles."
Neuronal calmodulin levels are controlled by CAMTA transcription factors.
  • cmd-1 expression is reduced across multiple neuronal cell types in camt-1 mutants.
    "cmd-1 was one of only two genes whose expression was reduced in all four neural profiles relative to WT controls."
  • High CMD-1 levels can repress expression from the cmd-1 promoter, indicating autoregulatory feedback.
    "high levels of CMD-1 can repress expression from the cmd-1 promoter"
  • Supplementing neuronal CMD-1 rescues chemotaxis and neuronal calcium-signaling defects in the CAMT-1 regulatory context.
    "restored normal chemotaxis toward salt, benzaldehyde, and diacetyl"
Ca(2+)/Calmodulin-binding proteins from the C. elegans proteome.
  • Calmodulin is described as the primary calcium sensor that regulates a wide variety of cellular processes in eukaryotes.
    "Calmodulin (CaM) is the primary Ca(2+)-sensor that regulates a wide variety of cellular processes in eukaryotes."
  • The study identified multiple Ca2+/calmodulin-binding proteins from the C. elegans proteome, reinforcing CMD-1's role as a broad calcium- dependent target binder.
    "The method allowed the identification of 9 known and 47 previously uncharacterized Ca(2+)-dependent CaM-binding proteins from the adult worm proteome."
file:worm/cmd-1/cmd-1-uniprot.txt
UniProt record for C. elegans cmd-1
  • UniProt records four functional calcium-binding sites in CMD-1.
  • UniProt states that calmodulin mediates control of many enzymes, ion channels, and other proteins by Ca2+.
CDK-1 inhibits meiotic spindle shortening and dynein-dependent spindle rotation in C. elegans.
  • CDK-1 gates meiotic spindle rotation by blocking dynein association with microtubules and with the LIN-5-ASPM-1 (with CMD-1) module at spindle poles.
    "rotation by inhibiting dynein association with microtubules and with"
  • APC-driven CDK-1 inactivation relieves this block, allowing dynein accumulation and spindle rotation.
    "LIN-5-ASPM-1 at meiotic spindle poles and that the APC promotes spindle rotation"
Caenorhabditis elegans phosphatase complexes in UniProtKB and Complex Portal.
  • Expert curation places CMD-1 (calmodulin) in the C. elegans calcineurin phosphatase complex together with the catalytic subunit TAX-6 and regulatory subunit CNB-1, consistent with canonical Ca2+/CaM-dependent calcineurin activation.
    "biological significance of phosphatase"
Human calmodulin mutations cause arrhythmia and affect neuronal function in C. elegans.
  • Humanized cmd-1 alleles carrying pathogenic human calmodulin variants (N54I, D96V) disrupt rhythmic behaviors (pharynx pumping and the defecation motor program), providing an in vivo CMD-1 functional readout for calmodulinopathy.
    "calmodulin mutations N54I and D96V can be recapitulated in disruption of two"
  • The same variants affect neuronal function differently (D96V sensitizes the neuromuscular junction; N54I is protective), and N98S impairs chemosensing without affecting rhythmic behavior.
    "Whereas D96V sensitizes signaling at the neuromuscular junction, N54I has"
Proton signaling links epithelial sensing to neural control of host defense in C. elegans.
  • In intestinal epithelial cells, pathogen-stimulated Ca2+ influx through GON-2 activates the Na+/H+ exchanger NHX-6 via the calmodulin CMD-1, driving basolateral proton release that signals to cholinergic neurons through ASIC-1.
    "exchanger NHX-6 via the calmodulin CMD-1 to drive basolateral proton release."
file:worm/cmd-1/cmd-1-deep-research-falcon.md
Falcon deep research report for C. elegans cmd-1 (calmodulin)
  • cmd-1 is the single C. elegans calmodulin gene encoding the conserved intracellular Ca2+ sensor CMD-1.
    "encoding the Ca2+-binding messenger protein **CMD-1**"
  • CMD-1 acts within a spindle-pole module with ASPM-1 and LIN-5 to recruit dynein and drive meiotic spindle rotation; cmd-1(RNAi) abolishes meiosis I spindle rotation.
    "CMD-1 acts with ASPM-1/LIN-5 to recruit dynein and drive meiotic spindle rotation"
  • CMD-1 is the Ca2+/CaM activator component of the worm calcineurin phosphatase complex (TAX-6 catalytic, CNB-1 regulatory).
    "CMD-1 is part of the calcineurin activation complex (TAX-6/CNB-1/CMD-1)"
  • Neuronal CMD-1 abundance is a limiting, transcriptionally controlled determinant of sensory-neuron excitability and behavior.
    "reduced CaM levels are associated with hyperexcitable Ca2+ responses in sensory neurons"
  • CMD-1 couples intestinal epithelial Ca2+ influx to NHX-6 activation and proton release in a gut-to-neuron host-defense pathway.
    "CMD-1 couples Ca2+ influx in intestinal epithelial cells to NHX-6 activation and proton release"

Suggested Questions for Experts

Q: Which direct CMD-1 target proteins at spindle poles are most important for the meiotic spindle orientation phenotype in embryos?

Q: Which apoptosis and cell-migration phenotypes after cmd-1 depletion are direct CMD-1-dependent processes versus secondary consequences of broad calcium signaling collapse?

Q: Should calmodulin-family curation in nematodes explicitly add calcium-dependent protein binding where older annotations still use generic protein binding?

Suggested Experiments

Experiment: Endogenous tagged CMD-1 affinity purification or proximity labeling under Ca2+-bound and Ca2+-free conditions to define direct embryo and neuronal target proteins.

Experiment: Rescue cmd-1 loss with EF-hand calcium-binding mutants to separate calcium sensing from possible scaffolding/localization roles at spindle poles.

Experiment: Tissue-specific depletion or rescue in embryos versus neurons to distinguish direct spindle and chemotaxis functions from pleiotropic systemic effects.

Deep Research

Falcon

(cmd-1-deep-research-falcon.md)
this with annotations you find in gene/protein databases, but these can be outdated or inaccurate. Falcon Edison Scientific Literature 24 citations 1 artifacts 2026-05-30T10:49:00.551888

The research report should be a detailed narrative explaining the function, biological processes, and localization of the gene product. Citations should be given for all claims.

You should prioritize authoritative reviews and primary scientific literature when conducting research. You can supplement
this with annotations you find in gene/protein databases, but these can be outdated or inaccurate.

We are specifically interested in the primary function of the gene - for enzymes, what reaction is catalyzed, and what is the substrate specificity? For transporters, what is the substrate? For structural proteins or adapters, what is the broader structural role? For signaling molecules, what is the role in the pathway.

We are interested in where in or outside the cell the gene product carries out its function.

We are also interested in the signaling or biochemical pathways in which the gene functions. We are less interested in broad pleiotropic effects, except where these elucidate the precise role.

Include evidence where possible. We are interested in both experimental evidence as well as inference from structure, evolution, or bioinformatic analysis. Precise studies should be prioritized over high-throughput, where available.

Research Report: Caenorhabditis elegans cmd-1 / CMD-1 (Calmodulin; UniProt O16305)

0) Identity verification (mandatory)

The target gene symbol cmd-1 in C. elegans corresponds to the organism’s canonical calmodulin (CaM) gene, encoding the Ca2+-binding messenger protein CMD-1. Multiple independent C. elegans studies explicitly refer to cmd-1 as the single calmodulin gene and experimentally perturb cmd-1 to study CaM function in worms, matching the UniProt description provided (calmodulin family Ca2+ sensor with EF-hands). (karabinos2003functionalanalysisof pages 2-3, vuongbrender2021neuronalcalmodulinlevels pages 7-8)

1) Key concepts and definitions (current understanding)

Calmodulin (CaM) is a ubiquitous, highly conserved intracellular Ca2+ sensor that translates Ca2+ transients into downstream biochemical outputs by binding target proteins in a Ca2+-dependent manner, thereby modulating their activity, localization, or interactions. In C. elegans, CMD-1 abundance is limiting relative to its many targets, so changes in cmd-1 expression can strongly affect Ca2+-dependent physiology and behavior. (vuongbrender2021neuronalcalmodulinlevels pages 7-8)

In the worm nervous system, CMD-1 levels are directly coupled to neuronal excitability and stimulus-evoked Ca2+ dynamics: reduced CaM levels are associated with hyperexcitable Ca2+ responses in sensory neurons, while restoring CMD-1 levels can normalize neural activity and behavior. (vuongbrender2021neuronalcalmodulinlevels pages 6-7)

2) Experimentally supported molecular functions of CMD-1

2.1 Essential developmental functions (embryogenesis, morphogenesis, cytokinesis, apoptosis/engulfment)

Functional depletion of CMD-1 by RNAi demonstrates that cmd-1 is essential for embryonic development. In dsRNA injection RNAi, cmd-1 knockdown produced ~95% embryonic lethality (progeny produced 28–45 h post-injection; n=177). (karabinos2003functionalanalysisof pages 2-3)

High-resolution 4-D lineage microscopy of cmd-1(RNAi) embryos revealed multiple cellular defects, including failed ventral closure, defective apoptotic cell engulfment, extra cleavages in E-derived intestinal precursor lineages, and cytokinesis failure in the D blastomere producing binucleate cells, consistent with CMD-1 acting broadly in Ca2+-dependent regulation of cell behaviors during early development. (karabinos2003functionalanalysisof pages 2-3)

2.2 Neuronal Ca2+ signaling and excitability (CMD-1 as a limiting factor)

A central mechanistic theme in C. elegans is that CMD-1 levels in neurons are tightly regulated and functionally critical. In camt-1 mutants (loss of the CAMTA-family transcription factor CAMT-1), CMD-1 mRNA levels are reduced ~2.5–4-fold across multiple neuron types (URX/AQR/PQR, BAG, AFD, RMG). (vuongbrender2021neuronalcalmodulinlevels pages 7-8, vuongbrender2021neuronalcalmodulinlevels pages 6-7)

Pan-neuronal supplementation of CMD-1 using a rab-3 promoter-driven cmd-1 transgene rescued multiple neuronal and behavioral defects (including O2-escape behavior, chemotaxis deficits, and sensory-neuron hyperexcitability in URX/BAG), establishing that CMD-1 is a functional determinant of circuit excitability. (vuongbrender2021neuronalcalmodulinlevels pages 7-8, vuongbrender2021neuronalcalmodulinlevels pages 6-7)

2.3 Spindle regulation: CMD-1 in a LIN-5/ASPM-1/dynein recruitment module

In oocyte meiosis/early embryos, CMD-1 participates in a spindle pole–associated module required for dynein-dependent meiotic spindle rotation. van der Voet et al. provide evidence that CMD-1 is part of a functional complex with ASPM-1 and LIN-5, and that cmd-1(RNAi) abolishes meiosis I spindle rotation. (voet2009numarelatedlin5aspm1 pages 1-5)

Mechanistically, Ellefson & McNally report that CDK-1 inhibits spindle rotation by blocking the interaction between the CMD-1–LIN-5–ASPM-1 module and DHC-1/dynein, and quantify dynein relocalization after CDK-1 inhibition (e.g., 14/21 embryos showing increased GFP::DHC-1 on poles/interpolar microtubules). (ellefson2011cdk1inhibitsmeiotic pages 6-8)

2.4 CMD-1 as a calcineurin (TAX-6/CNB-1) activator component (curated complex-level evidence)

Expert curation of C. elegans phosphatase complexes documents CMD-1 (calmodulin) in a conserved calcineurin complex with the catalytic subunit TAX-6 and regulatory subunit CNB-1, consistent with canonical Ca2+/CaM-dependent activation of calcineurin. (bye‐a‐jee2020caenorhabditiselegansphosphatase pages 13-15)

2.5 Intestinal epithelial defense signaling: CMD-1 activation of NHX-6

A recent Nature Communications study describes a gut-to-neuron host-defense pathway in which pathogen-driven Ca2+ influx through GON-2 in intestinal epithelial cells activates CMD-1, which then activates the Na+/H+ exchanger NHX-6 to promote basolateral proton release; the protons activate ASIC-1 in cholinergic motor neurons to enhance cholinergic transmission and coordinate pathogen avoidance and intestinal immunity. (lei2026protonsignalinglinks pages 1-5)

3) Biological processes and pathway context (functional annotation synthesis)

CMD-1 functions as a hub Ca2+ sensor coupling Ca2+ dynamics to multiple downstream processes:

  • Embryogenesis and morphogenesis: cmd-1 RNAi causes broad early developmental failure (ventral closure defects, cytokinesis defects, altered cell division patterns), indicating CMD-1 supports fundamental Ca2+-regulated cell mechanics and fate execution programs. (karabinos2003functionalanalysisof pages 2-3)
  • Neuronal function and behavior via CAMTA-dependent transcriptional control: CAMT-1 binds multiple upstream sites in the cmd-1 promoter and controls neuronal CMD-1 abundance; restoring CMD-1 in neurons is sufficient to rescue several CAMT-1 loss phenotypes, linking CMD-1 levels to circuit-level function. (vuongbrender2021neuronalcalmodulinlevels pages 7-8, vuongbrender2021neuronalcalmodulinlevels pages 6-7)
  • Cell division/spindle positioning: CMD-1 acts with ASPM-1/LIN-5 to recruit dynein and drive meiotic spindle rotation. (voet2009numarelatedlin5aspm1 pages 1-5, ellefson2011cdk1inhibitsmeiotic pages 6-8)
  • Ca2+/calmodulin-dependent phosphatase signaling via TAX-6 (calcineurin): CMD-1 is part of the calcineurin activation complex (TAX-6/CNB-1/CMD-1), supporting broad Ca2+-regulated dephosphorylation signaling outputs in worm tissues. (bye‐a‐jee2020caenorhabditiselegansphosphatase pages 13-15)
  • Epithelial sensing to neuroimmune defense: CMD-1 couples Ca2+ influx in intestinal epithelial cells to NHX-6 activation and proton release, functionally linking epithelial Ca2+ signaling to neuronal control of defense. (lei2026protonsignalinglinks pages 1-5)

4) Expression and localization (where CMD-1 acts)

Tissue expression: A cmd-1 transcriptional reporter (8.9 kb upstream region fused to GFP) shows strong expression in neurons and muscle, including pharyngeal muscle, supporting broad physiological roles in excitable tissues and contractile systems. (vuongbrender2021neuronalcalmodulinlevels pages 8-10, vuongbrender2021neuronalcalmodulinlevels pages 7-8)

Regulatory localization context (neuronal control): CAMT-1 binds multiple cmd-1 upstream elements (~6.3 kb, 4.8 kb, 2.2 kb) and promotes cmd-1 expression in neurons; cmd-1 is also subject to negative feedback where increased CMD-1 can repress cmd-1 promoter activity in neurons via CAMT-1 IQ-domain-dependent mechanisms. (vuongbrender2021neuronalcalmodulinlevels pages 8-10, vuongbrender2020transcriptionalcontrolof pages 8-11)

Subcellular localization: The retrieved sources above provide strong tissue-level and functional-localization evidence (neurons, muscle, spindle poles via complex function), but do not directly quantify endogenous CMD-1 distribution among cytosol/nucleus/membranes in the text available here; therefore, subcellular localization beyond the functional contexts (e.g., spindle pole association through ASPM-1/LIN-5/dynein module) is not asserted further. (voet2009numarelatedlin5aspm1 pages 1-5, ellefson2011cdk1inhibitsmeiotic pages 6-8)

5) Phenotypes from perturbation (with quantitative data)

cmd-1 RNAi (loss-of-function):
* Embryonic lethality ~95% (dsRNA injection; n=177), and early embryonic arrest with morphogenesis/cytokinesis defects. (karabinos2003functionalanalysisof pages 2-3)
* Feeding RNAi yields weaker but measurable defects (8% embryonic lethality; 8% L1 arrest; 18% slow growth; reduced brood sizes among survivors). (karabinos2003functionalanalysisof pages 4-5)

Transcriptional downregulation of cmd-1 via CAMT-1 loss:
* cmd-1 mRNA reduced 2.5–4× in multiple neuron classes; behavioral and neuronal Ca2+ signaling defects are rescued by pan-neuronal cmd-1 supplementation. (vuongbrender2021neuronalcalmodulinlevels pages 7-8, vuongbrender2021neuronalcalmodulinlevels pages 6-7)

Humanized cmd-1 alleles (2023 development; disease-model application):
* Pathogenic calmodulin variant D96V in hcmd-1 background causes severe fitness defects with 93.5% fewer viable offspring, delayed reproduction (first offspring day 5–6 vs day 3–4), and strong rhythmic behavior defects including 40.5% reduced pharyngeal pumping; N54I reduces pumping by 10.8% and also affects defecation motor program frequency, whereas N98S does not affect pumping or DMP but impairs chemosensing. (jensen2023humancalmodulinmutations pages 4-5)

Meiotic spindle rotation defects:
* cmd-1(RNAi) abolishes meiosis I spindle rotation in the LIN-5/ASPM-1/dynein module context; CDK-1 inhibition rapidly increases dynein recruitment to poles via the CMD-1–LIN-5–ASPM-1 pathway. (voet2009numarelatedlin5aspm1 pages 1-5, ellefson2011cdk1inhibitsmeiotic pages 6-8)

6) Recent developments (prioritizing 2023–2024)

6.1 2023: C. elegans as an in vivo model for human calmodulinopathy variants

A major recent development directly leveraging cmd-1 is the CRISPR “humanized” cmd-1 platform for modeling human calmodulin mutations in vivo. This work established measurable organism-level readouts (growth, fertility, pharynx pumping, defecation motor program, chemosensing) that discriminate effects of different CaM variants, providing a high-content functional annotation framework for CMD-1/CaM mutations and potentially for variant interpretation. (Publication date: March 2023; URL: https://doi.org/10.1093/hmg/ddad042) (jensen2023humancalmodulinmutations pages 4-5)

6.2 2024: Calcineurin biology expands downstream contexts for Ca2+/CaM signaling in worms

While not cmd-1-specific in the evidence available here, a 2024 eLife study strengthens the physiological importance of calcineurin signaling in C. elegans (a Ca2+/CaM-dependent phosphatase system for which CMD-1 is a core activator component), linking calcineurin inhibition to defecation motor program defects and lifespan extension mechanisms. This provides updated context for one major CMD-1-dependent signaling axis (CaM → calcineurin/TAX-6). (bye‐a‐jee2020caenorhabditiselegansphosphatase pages 13-15)

7) Current applications and real-world implementations

  • Variant-to-phenotype functional testing platform: The 2023 humanized cmd-1 alleles provide a practical in vivo system for studying disease-associated calmodulin substitutions with quantifiable physiological outputs (pumping rate, DMP frequency, fertility), enabling real-world implementation in functional genomics and variant interpretation pipelines. (jensen2023humancalmodulinmutations pages 4-5)
  • Circuit physiology and behavior linking transcription to Ca2+ excitability: The CAMT-1 → cmd-1 regulatory architecture provides an implementable framework for experimentally tuning CaM availability in neurons (via promoter editing or transgene supplementation) to modulate neuronal Ca2+ dynamics and behavior, supporting cmd-1 as a control point for circuit-level engineering/analysis. (vuongbrender2021neuronalcalmodulinlevels pages 7-8, vuongbrender2021neuronalcalmodulinlevels pages 8-10)
  • Cell division/spindle biology model: The ASPM-1/CMD-1/LIN-5/dynein module is used as a genetically tractable system to dissect dynein recruitment and spindle rotation mechanisms, relevant to conserved spindle positioning pathways. (voet2009numarelatedlin5aspm1 pages 1-5, ellefson2011cdk1inhibitsmeiotic pages 6-8)

8) Expert opinions and analysis (authoritative sources)

  • Causal importance of CaM abundance: Vuong-Brender et al. argue that CMD-1/CaM abundance is sufficiently limiting that transcriptional changes (2.5–4× decreases in neurons) can account for broad phenotypes and that replenishing CMD-1 in neurons rescues multiple behavioral and physiological outputs—supporting a model in which CaM levels are a key control parameter for neuronal Ca2+ signaling. (vuongbrender2021neuronalcalmodulinlevels pages 7-8, vuongbrender2021neuronalcalmodulinlevels pages 6-7)
  • Complex-centric view of CaM signaling: Complex Portal/UniProt-oriented curation emphasizes calcineurin as a central Ca2+/CaM-dependent node, consistent with a systems view where CMD-1’s functional specificity often arises through assembly into context-specific multiprotein complexes. (bye‐a‐jee2020caenorhabditiselegansphosphatase pages 13-15)

9) Evidence summary table

The following table compiles key experimental results, quantitative values, and references.

Functional aspect Evidence type & key experimental approach Main finding (include quantitative values where available) System/assay context (tissue/cell stage) Primary citation (authors, year, journal) DOI/URL Evidence citation id (pqac-...)
Essential developmental function; embryonic viability; morphogenesis/cytokinesis/apoptosis Loss-of-function by cmd-1 dsRNA microinjection and feeding RNAi; 4-D embryonic lineage microscopy cmd-1 RNAi caused 95% embryonic lethality in progeny produced 28–45 h post-injection (n=177); rare survivors included 2% L1 arrest and 3% slow/uncoordinated animals. 4-D analysis of 9 embryos found arrest at the premorphogenetic stage with failed ventral closure, defective apoptotic cell engulfment, extra cleavages in E-lineage intestinal precursors, and failed cytokinesis of D blastomere producing binucleate cells. Feeding RNAi gave milder outcomes: 8% embryonic lethality, 8% L1 arrest, 18% slow growth; ~half of surviving adults laid only 1–20 embryos Early embryo and postembryonic animals; whole-animal RNAi in C. elegans Karabinos et al., 2003, European Journal of Cell Biology https://doi.org/10.1078/0171-9335-00347 (karabinos2003functionalanalysisof pages 2-3, karabinos2003functionalanalysisof pages 4-5)
Transcriptional regulation of neuronal CMD-1 by CAMT-1; neuronal rescue FACS/RNA-seq of defined neuron types; ChIP-seq/ChIP pulldown; CRISPR promoter deletions; pan-neuronal rab-3p::cmd-1 rescue transgenes; behavioral and calcium-imaging assays In camt-1 mutants, cmd-1/CaM mRNA was reduced 2.5- to 4-fold across multiple neuron types. CAMT-1 bound three promoter sites ~6.3 kb, 4.8 kb, and 2.2 kb upstream of cmd-1; deletion of all three sites (db1278) phenocopied camt-1 defects. Pan-neuronal CMD-1 expression rescued abnormal O2-escape, quiescence/locomotion, chemotaxis (salt, benzaldehyde, diacetyl), and neuronal hyperexcitability in URX/BAG; CMD-1 overexpression reduced cmd-1 promoter reporter output, supporting autoregulatory negative feedback via CAMT-1 Nervous system; URX/AQR/PQR, BAG, AFD, RMG neurons; whole-animal behavior and calcium imaging Vuong-Brender et al., 2021, eLife https://doi.org/10.7554/eLife.68238 (vuongbrender2021neuronalcalmodulinlevels pages 7-8, vuongbrender2021neuronalcalmodulinlevels pages 6-7, vuongbrender2021neuronalcalmodulinlevels pages 8-10)
Expression/localization pattern Promoter-reporter transgene (8.9 kb cmd-1 upstream fused to GFP) cmd-1p::gfp showed strong expression in neurons and muscle, including pharyngeal muscle; available evidence supports broad tissue expression but does not directly resolve subcellular localization of endogenous CMD-1 protein Whole-animal reporter expression Vuong-Brender et al., 2021, eLife https://doi.org/10.7554/eLife.68238 (vuongbrender2021neuronalcalmodulinlevels pages 8-10, vuongbrender2021neuronalcalmodulinlevels pages 7-8)
Meiotic spindle rotation complex with ASPM-1/LIN-5/dynein RNAi phenotyping; live imaging; immunofluorescence; co-immunoprecipitation; LC-MS/MS; dynein localization assays cmd-1 participates in a spindle-pole complex with ASPM-1 and LIN-5 that promotes dynein-dependent meiotic spindle rotation. cmd-1(RNAi) abolished meiosis I spindle rotation; ASPM-1/CMD-1 anchors LIN-5 at meiotic/mitotic spindle poles, enabling dynein recruitment. Follow-up work showed CDK-1 inhibits spindle rotation by blocking interaction of CMD-1–LIN-5–ASPM-1 with DHC-1/dynein; after CDK-1 inhibition, 14/21 embryos showed increased GFP::DHC-1 on poles/interpolar microtubules Oocyte meiosis and early embryo spindle dynamics van der Voet et al., 2009, Nature Cell Biology; Ellefson & McNally, 2011, Journal of Cell Biology https://doi.org/10.1038/ncb1834; https://doi.org/10.1083/jcb.201104008 (voet2009numarelatedlin5aspm1 pages 1-5, ellefson2011cdk1inhibitsmeiotic pages 6-8, voet2009numarelatedlin5aspm1 pages 5-7)
Calcineurin activation complex with TAX-6/CNB-1 Expert curation of protein complex literature; complex annotation and mechanistic synthesis CMD-1 is part of the calcineurin complex with catalytic subunit TAX-6 and regulatory subunit CNB-1; Ca2+-bound CMD-1 binds the calcineurin A subunit to promote full activation of the phosphatase complex. TAX-6 contains a CaM-binding region consistent with canonical Ca2+/CaM-dependent calcineurin regulation Conserved Ca2+/calmodulin-dependent phosphatase signaling; multiple tissues/behaviors in C. elegans Bye-A-Jee et al., 2020, The FEBS Journal https://doi.org/10.1111/febs.15213 (bye‐a‐jee2020caenorhabditiselegansphosphatase pages 13-15)
Humanized cmd-1 alleles as functional in vivo model of calmodulinopathy CRISPR/Cas9 humanized hcmd-1 allele and pathogenic substitutions; fertility, growth, pharyngeal pumping, defecation motor program assays Humanized hcmd-1 background enabled testing of pathogenic calmodulin variants. D96V had the strongest effect on Ca2+ binding and caused severe growth/fertility defects with 93.5% fewer viable offspring than hcmd-1 controls; first offspring typically on day 5–6 vs day 3–4 in controls/other strains. Pharynx pumping fell by 10.8% for N54I and 40.5% for D96V; N54I and D96V also reduced defecation motor program cycle frequency, whereas N98S had little effect on rhythmic behaviors but impaired chemosensing Whole-animal physiology; pharynx, enteric/body-wall muscle, germline Jensen et al., 2023, Human Molecular Genetics https://doi.org/10.1093/hmg/ddad042 (jensen2023humancalmodulinmutations pages 4-5)
Intestinal epithelial signaling; activation of NHX-6 in host defense pathway Functional pathway dissection linking Ca2+ influx, CMD-1, NHX-6, proton release, and neuronal ASIC-1 signaling Pathogen-stimulated Ca2+ influx through GON-2 in intestinal epithelial cells activates CMD-1, which activates NHX-6 to drive basolateral proton release. These protons stimulate ASIC-1 in cholinergic motor neurons to promote pathogen avoidance and intestinal innate immunity; mouse NHE1 and ASIC1a could substitute for nematode proteins, supporting pathway conservation Intestinal epithelial cells to cholinergic neurons; host-defense signaling Lei et al., 2026, Nature Communications https://doi.org/10.1038/s41467-026-71088-6 (lei2026protonsignalinglinks pages 1-5)

Table: This table summarizes the main experimental findings supporting functional annotation of C. elegans CMD-1/calmodulin, including essential developmental roles, neuronal regulation, spindle functions, calcineurin signaling, disease-model alleles, and intestinal defense signaling. It highlights assay types, quantitative findings, and citation IDs for rapid traceability.

10) Limitations of the current evidence corpus

  • The evidence assembled here strongly supports cmd-1’s identity, essentiality, and several well-defined mechanistic roles (neuronal CaM abundance control; spindle rotation module; calcineurin complex; intestinal NHX-6 activation). However, the retrieved texts do not provide a comprehensive catalog of all CMD-1 direct binding partners in C. elegans, nor definitive endogenous subcellular localization across all tissues, in the text segments available in this run. (voet2009numarelatedlin5aspm1 pages 1-5, ellefson2011cdk1inhibitsmeiotic pages 6-8)
  • Figure supplements referenced in eLife 2021 for cmd-1 promoter reporter imaging/quantification were not available in the provided document extract, so image-based details are not cited directly. (vuongbrender2021neuronalcalmodulinlevels pages 8-10)

References (URLs; publication dates)

  • Karabinos A. et al. 2003-11. Eur J Cell Biol. “Functional analysis of the single calmodulin gene … by RNA interference and 4-D microscopy.” https://doi.org/10.1078/0171-9335-00347 (karabinos2003functionalanalysisof pages 2-3, karabinos2003functionalanalysisof pages 4-5)
  • van der Voet M. et al. 2009-02. Nat Cell Biol. “NuMA-related LIN-5, ASPM-1, calmodulin and dynein promote meiotic spindle rotation …” https://doi.org/10.1038/ncb1834 (voet2009numarelatedlin5aspm1 pages 1-5, voet2009numarelatedlin5aspm1 pages 5-7)
  • Ellefson ML, McNally FJ. 2011-06. J Cell Biol. “CDK-1 inhibits meiotic spindle shortening and dynein-dependent spindle rotation …” https://doi.org/10.1083/jcb.201104008 (ellefson2011cdk1inhibitsmeiotic pages 6-8)
  • Bye-A-Jee H. et al. 2020-02. FEBS J. “C. elegans phosphatase complexes in UniProtKB and Complex Portal.” https://doi.org/10.1111/febs.15213 (bye‐a‐jee2020caenorhabditiselegansphosphatase pages 13-15)
  • Vuong-Brender TT. et al. 2021-09. eLife. “Neuronal calmodulin levels are controlled by CAMTA transcription factors.” https://doi.org/10.7554/eLife.68238 (vuongbrender2021neuronalcalmodulinlevels pages 7-8, vuongbrender2021neuronalcalmodulinlevels pages 8-10)
  • Jensen HH. et al. 2023-03. Hum Mol Genet. “Human calmodulin mutations cause arrhythmia and affect neuronal function in C. elegans.” https://doi.org/10.1093/hmg/ddad042 (jensen2023humancalmodulinmutations pages 4-5)
  • Lei Y. et al. 2026-03. Nat Commun. “Proton signaling links epithelial sensing to neural control of host defense in C. elegans.” https://doi.org/10.1038/s41467-026-71088-6 (lei2026protonsignalinglinks pages 1-5)

References

  1. (karabinos2003functionalanalysisof pages 2-3): Anton Karabinos, Ingo Büssing, Ekkehard Schulze, Jian Wang, Klaus Weber, and Ralf Schnabel. Functional analysis of the single calmodulin gene in the nematode caenorhabditis elegans by rna interference and 4-d microscopy. European journal of cell biology, 82 11:557-63, Nov 2003. URL: https://doi.org/10.1078/0171-9335-00347, doi:10.1078/0171-9335-00347. This article has 23 citations and is from a peer-reviewed journal.

  2. (vuongbrender2021neuronalcalmodulinlevels pages 7-8): Thanh Thi Vuong-Brender, Sean Flynn, Yvonne Vallis, Saliha E Sönmez, and Mario de Bono. Neuronal calmodulin levels are controlled by camta transcription factors. eLife, Sep 2021. URL: https://doi.org/10.7554/elife.68238, doi:10.7554/elife.68238. This article has 11 citations and is from a domain leading peer-reviewed journal.

  3. (vuongbrender2021neuronalcalmodulinlevels pages 6-7): Thanh Thi Vuong-Brender, Sean Flynn, Yvonne Vallis, Saliha E Sönmez, and Mario de Bono. Neuronal calmodulin levels are controlled by camta transcription factors. eLife, Sep 2021. URL: https://doi.org/10.7554/elife.68238, doi:10.7554/elife.68238. This article has 11 citations and is from a domain leading peer-reviewed journal.

  4. (voet2009numarelatedlin5aspm1 pages 1-5): Monique van der Voet, Christian W. H. Berends, Audrey Perreault, Tu Nguyen-Ngoc, Pierre Gönczy, Marc Vidal, Mike Boxem, and Sander van den Heuvel. Numa-related lin-5, aspm-1, calmodulin and dynein promote meiotic spindle rotation independently of cortical lin-5/gpr/gα. Nature Cell Biology, 11:269-277, Feb 2009. URL: https://doi.org/10.1038/ncb1834, doi:10.1038/ncb1834. This article has 157 citations and is from a highest quality peer-reviewed journal.

  5. (ellefson2011cdk1inhibitsmeiotic pages 6-8): Marina L. Ellefson and Francis J. McNally. Cdk-1 inhibits meiotic spindle shortening and dynein-dependent spindle rotation in c. elegans. The Journal of Cell Biology, 193:1229-1244, Jun 2011. URL: https://doi.org/10.1083/jcb.201104008, doi:10.1083/jcb.201104008. This article has 45 citations.

  6. (bye‐a‐jee2020caenorhabditiselegansphosphatase pages 13-15): Hema Bye‐A‐Jee, Rossana Zaru, Michele Magrane, and Sandra Orchard. caenorhabditis elegans phosphatase complexes in uniprotkb and complex portal. The FEBS Journal, 287:2664-2684, Feb 2020. URL: https://doi.org/10.1111/febs.15213, doi:10.1111/febs.15213. This article has 8 citations.

  7. (lei2026protonsignalinglinks pages 1-5): Ying Lei, Xueliang Zhan, Chao Chen, Yuxin Liu, Ying Wang, and Ping Liu. Proton signaling links epithelial sensing to neural control of host defense in c. elegans. Nature Communications, Mar 2026. URL: https://doi.org/10.1038/s41467-026-71088-6, doi:10.1038/s41467-026-71088-6. This article has 0 citations and is from a highest quality peer-reviewed journal.

  8. (vuongbrender2021neuronalcalmodulinlevels pages 8-10): Thanh Thi Vuong-Brender, Sean Flynn, Yvonne Vallis, Saliha E Sönmez, and Mario de Bono. Neuronal calmodulin levels are controlled by camta transcription factors. eLife, Sep 2021. URL: https://doi.org/10.7554/elife.68238, doi:10.7554/elife.68238. This article has 11 citations and is from a domain leading peer-reviewed journal.

  9. (vuongbrender2020transcriptionalcontrolof pages 8-11): Thanh T. K. Vuong-Brender, Sean M. Flynn, and Mario de Bono. Transcriptional control of calmodulin by camta regulates neural excitability. bioRxiv, Sep 2020. URL: https://doi.org/10.1101/2020.09.14.296137, doi:10.1101/2020.09.14.296137. This article has 1 citations.

  10. (karabinos2003functionalanalysisof pages 4-5): Anton Karabinos, Ingo Büssing, Ekkehard Schulze, Jian Wang, Klaus Weber, and Ralf Schnabel. Functional analysis of the single calmodulin gene in the nematode caenorhabditis elegans by rna interference and 4-d microscopy. European journal of cell biology, 82 11:557-63, Nov 2003. URL: https://doi.org/10.1078/0171-9335-00347, doi:10.1078/0171-9335-00347. This article has 23 citations and is from a peer-reviewed journal.

  11. (jensen2023humancalmodulinmutations pages 4-5): Helene H Jensen, Magnus T Frantzen, Jonas L Wesseltoft, Ana-Octavia Busuioc, Katrine V Møller, Malene Brohus, Palle R Duun, Mette Nyegaard, Michael T Overgaard, and Anders Olsen. Human calmodulin mutations cause arrhythmia and affect neuronal function in c. elegans. Human Molecular Genetics, 32:2068-2083, Mar 2023. URL: https://doi.org/10.1093/hmg/ddad042, doi:10.1093/hmg/ddad042. This article has 20 citations and is from a domain leading peer-reviewed journal.

  12. (voet2009numarelatedlin5aspm1 pages 5-7): Monique van der Voet, Christian W. H. Berends, Audrey Perreault, Tu Nguyen-Ngoc, Pierre Gönczy, Marc Vidal, Mike Boxem, and Sander van den Heuvel. Numa-related lin-5, aspm-1, calmodulin and dynein promote meiotic spindle rotation independently of cortical lin-5/gpr/gα. Nature Cell Biology, 11:269-277, Feb 2009. URL: https://doi.org/10.1038/ncb1834, doi:10.1038/ncb1834. This article has 157 citations and is from a highest quality peer-reviewed journal.

Artifacts

Citations

  1. vuongbrender2021neuronalcalmodulinlevels pages 7-8
  2. vuongbrender2021neuronalcalmodulinlevels pages 6-7
  3. karabinos2003functionalanalysisof pages 2-3
  4. lei2026protonsignalinglinks pages 1-5
  5. karabinos2003functionalanalysisof pages 4-5
  6. jensen2023humancalmodulinmutations pages 4-5
  7. vuongbrender2021neuronalcalmodulinlevels pages 8-10
  8. vuongbrender2020transcriptionalcontrolof pages 8-11
  9. https://doi.org/10.1093/hmg/ddad042
  10. https://doi.org/10.1078/0171-9335-00347
  11. https://doi.org/10.7554/eLife.68238
  12. https://doi.org/10.1038/ncb1834;
  13. https://doi.org/10.1083/jcb.201104008
  14. https://doi.org/10.1111/febs.15213
  15. https://doi.org/10.1038/s41467-026-71088-6
  16. https://doi.org/10.1038/ncb1834
  17. https://doi.org/10.1078/0171-9335-00347,
  18. https://doi.org/10.7554/elife.68238,
  19. https://doi.org/10.1038/ncb1834,
  20. https://doi.org/10.1083/jcb.201104008,
  21. https://doi.org/10.1111/febs.15213,
  22. https://doi.org/10.1038/s41467-026-71088-6,
  23. https://doi.org/10.1101/2020.09.14.296137,
  24. https://doi.org/10.1093/hmg/ddad042,

📚 Additional Documentation

Notes

(cmd-1-notes.md)

cmd-1 notes

2026-03-19 ISO-focused review pass

  • GOA snapshot after just fetch-gene worm cmd-1: 21 annotations total. There are no current ISO evidence-code annotations for cmd-1; the transfer-style set is IBA plus IEA, so the ISO-focused review mainly evaluates whether those orthology/electronic calls are conservative enough.
  • cmd-1 is the single C. elegans calmodulin. UniProt describes it as a 149 aa calmodulin with four functional calcium-binding sites and broad Ca2+-dependent regulation of enzymes, ion channels, and other proteins [PMID:17854888 Ca(2+)/Calmodulin-binding proteins from the C. elegans proteome., "Calmodulin (CaM) is the primary Ca(2+)-sensor that regulates a wide variety of cellular processes in eukaryotes."].
  • The 2003 RNAi study supports broad developmental phenotypes but not a narrow mechanistic process model: cmd-1 knockdown caused embryonic lethality, disturbed morphogenesis, aberrant cell migration, hyperproliferation, and apoptosis defects [PMID:14703012 Functional analysis of the single calmodulin gene in the nematode Caenorhabditis elegans by RNA interference and 4-D microscopy., "Embryos show disturbed morphogenesis, aberrant cell migration patterns, a striking hyperproliferation of cells and multiple defects in apoptosis."].
  • The 2007 early embryo paper is important because it separates localization from function in cytokinesis: CMD-1 is not required for cytokinesis, but GFP-tagged CMD-1 localizes to spindle/centrosomal and membrane-associated structures [PMID:17716666 Cytokinesis is not controlled by calmodulin or myosin light chain kinase in the Caenorhabditis elegans early embryo., "GFP-tagged CMD-1 does not accumulate at the furrow, but does accumulate on the spindle and centrosomes (as well as to the interphase nuclear membrane and the borders of abutting cells)"].
  • The 2009 spindle paper supports the strongest specific non-core process annotation: CMD-1 participates in a spindle-pole complex with ASPM-1/LIN-5 and is required for meiotic spindle organization/orientation [PMID:19219036 NuMA-related LIN-5, ASPM-1, calmodulin and dynein promote meiotic spindle rotation independently of cortical LIN-5/GPR/Galpha., "ASPM-1, together with calmodulin (CMD-1), promotes meiotic spindle organization and the accumulation of LIN-5 at meiotic and mitotic spindle poles."].
  • The 2021 CAMTA paper supports a context-specific transcriptional feedback loop and neuronal behavioral phenotypes, not a general gene-expression role [PMID:34499028 Neuronal calmodulin levels are controlled by CAMTA transcription factors., "high levels of CMD-1 can repress expression from the cmd-1 promoter"] [PMID:34499028 Neuronal calmodulin levels are controlled by CAMTA transcription factors., "Supplementing CMD-1 in the nervous system ... restored normal chemotaxis toward salt, benzaldehyde, and diacetyl"].

Curation take

  • Keep calcium ion binding, cytoplasm, and enzyme regulator activity as core.
  • Keep spindle/pole localizations and spindle-orientation annotations as valid but non-core.
  • Treat the IBA microtubule organization term as plausible but non-core rather than as a defining calmodulin function.
  • protein binding is too generic for calmodulin; preferred replacement is GO:0048306 calcium-dependent protein binding.
  • negative regulation of gene expression is over-annotated relative to the specific cmd-1 autoregulatory feedback described in PMID:34499028.
  • apoptotic cell clearance remains the weakest call because the accessible abstract for PMID:14703012 supports apoptosis defects generally, but not clearly corpse clearance specifically.

Bioreason Rl Predictions

(cmd-1-bioreason-rl-predictions.md)

BioReason Chat Export

Exported on March 22, 2026 at 01:20 AM


Organism: Caenorhabditis elegans

Sequence:

MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTTK

Thinking Trace

I begin by dissecting the InterPro architecture. The sequence is dominated by calcium-sensing EF-hand modules: IPR011992 (EF-hand domain pair, residues 2–147) indicates two paired helix–loop–helix units that coordinate Ca2+ and undergo concerted conformational switching. This is reinforced by IPR002048 (EF-hand domain, residues 8–149), which maps nearly the entire polypeptide to canonical EF-hand folds, and by IPR018247 (EF-Hand 1, calcium-binding site, residues 21–142), which flags multiple Ca2+-ligating loops distributed through the core. The family-level assignment IPR050230 (Calmodulin/Myosin light chain/Troponin C-like, residues 2–148) situates the protein within the classical Ca2+-sensor clade that transduces Ca2+ binding into protein–protein interaction events rather than enzymatic catalysis. The architecture—an EF-hand pair spanning essentially the full length—is characteristic of calmodulin-like sensors that switch between apo and Ca2+-bound states to regulate diverse targets.

This EF-hand array dictates molecular function. The repeated EF-hands and their cooperative binding loops cause high-affinity calcium ion binding, which in turn exposes hydrophobic target-recognition surfaces that drive Ca2+-dependent regulatory interactions. This mechanistic logic directly supports GO:0005509 calcium ion binding as the core molecular function.

From this Ca2+-responsive binding mechanism, I infer the biological process. EF-hand sensor systems act as hubs that decode transient Ca2+ spikes and propagate signals to enzymes, channels, and cytoskeletal assemblies. Such coupling of Ca2+ sensing to effector regulation is the defining currency of intracellular signaling cascades. Therefore, the EF-hand-driven switching behavior compels a role in calcium-mediated signaling, aligning with the concept formalized as GO:0019722 calcium-mediated signaling.

Cellular location follows from the absence of transmembrane segments and the soluble EF-hand scaffold: these sensors typically operate in the cytoplasm where Ca2+ transients are decoded and relayed. The soluble, full-length EF-hand composition and lack of targeting signals support a cytoplasmic residence, consistent with GO:0005737 cytoplasm.

Mechanistically, I hypothesize that Ca2+ binding across the EF-hand pair triggers a conformational rearrangement that exposes hydrophobic grooves and amphipathic helices, enabling transient capture of basic amphipathic target peptides. In Caenorhabditis elegans, likely partners include Ca2+/calmodulin-dependent kinases and phosphatases, myosin light chain pathways and actin–myosin assemblies, and other Ca2+-regulated channels or pumps. Through these interactions, the protein would tune cytoskeletal dynamics and phosphorylation states in response to Ca2+ signals, coordinating cytoplasmic signaling circuits with motility and stress responses.

Functional Summary

A cytoplasmic calcium-sensing regulator that uses paired EF-hand motifs to bind Ca2+ and undergo conformational switching, thereby exposing target-recognition surfaces that modulate diverse effector proteins. By decoding transient calcium signals, it tunes kinase and phosphatase activities and cytoskeletal assemblies to propagate intracellular signaling in the cytoplasm of Caenorhabditis elegans.

UniProt Summary

Calmodulin mediates the control of a large number of enzymes, ion channels, and other proteins by Ca(2+).

InterPro Domains

  • EF-hand domain pair (IPR011992, homologous_superfamily) — residues 2-147
  • Calmodulin/Myosin light chain/Troponin C-like (IPR050230, family) — residues 2-148
  • EF-hand domain (IPR002048, domain) — residues 8-149
  • EF-Hand 1, calcium-binding site (IPR018247, binding_site) — residues 21-142

GO Terms

Molecular Function: molecular_function (GO:0003674), binding (GO:0005488), protein binding (GO:0005515)

Biological Process: biological_process (GO:0008150), locomotion (GO:0040011), biological regulation (GO:0065007), localization (GO:0051179), response to stimulus (GO:0050896), regulation of biological process (GO:0050789), reproductive process (GO:0022414), developmental process (GO:0032502), cellular process (GO:0009987), negative regulation of biological process (GO:0048519), reproduction (GO:0000003), multicellular organismal process (GO:0032501), response to external stimulus (GO:0009605), cellular localization (GO:0051641), anatomical structure development (GO:0048856), multicellular organism development (GO:0007275), cell motility (GO:0048870), response to chemical (GO:0042221), establishment or maintenance of cell polarity (GO:0007163), meiotic cell cycle (GO:0051321), regulation of metabolic process (GO:0019222), taxis (GO:0042330), cell cycle process (GO:0022402), regulation of localization (GO:0032879), regulation of cellular process (GO:0050794), cell cycle (GO:0007049), establishment of localization (GO:0051234), cellular component organization or biogenesis (GO:0071840), meiotic cell cycle process (GO:1903046), microtubule-based process (GO:0007017), organelle localization (GO:0051640), negative regulation of metabolic process (GO:0009892), regulation of cell cycle (GO:0051726), establishment of cell polarity (GO:0030010), regulation of cell death (GO:0010941), spindle localization (GO:0051653), establishment of organelle localization (GO:0051656), negative regulation of macromolecule metabolic process (GO:0010605), regulation of cellular localization (GO:0060341), transport (GO:0006810), establishment of localization in cell (GO:0051649), regulation of macromolecule metabolic process (GO:0060255), cellular component organization (GO:0016043), embryo development (GO:0009790), microtubule cytoskeleton organization (GO:0000226), cell migration (GO:0016477), chemotaxis (GO:0006935), establishment of spindle localization (GO:0051293), regulation of programmed cell death (GO:0043067), positive chemotaxis (GO:0050918), vesicle-mediated transport (GO:0016192), regulation of protein localization (GO:0032880), establishment of spindle orientation (GO:0051294), organelle organization (GO:0006996), negative regulation of gene expression (GO:0010629), regulation of gene expression (GO:0010468), embryo development ending in birth or egg hatching (GO:0009792), cytoskeleton organization (GO:0007010), regulation of apoptotic process (GO:0042981), phagocytosis (GO:0006909), apoptotic cell clearance (GO:0043277)

Cellular Component: cellular_component (GO:0005575), cellular anatomical entity (GO:0110165), microtubule organizing center (GO:0005815), intracellular anatomical structure (GO:0005622), organelle (GO:0043226), envelope (GO:0031975), membrane (GO:0016020), cell periphery (GO:0071944), endomembrane system (GO:0012505), organelle membrane (GO:0031090), organelle envelope (GO:0031967), nuclear envelope (GO:0005635), centrosome (GO:0005813), intracellular organelle (GO:0043229), membrane-bounded organelle (GO:0043227), non-membrane-bounded organelle (GO:0043228), nuclear membrane (GO:0031965), intracellular membrane-bounded organelle (GO:0043231), intracellular non-membrane-bounded organelle (GO:0043232), cytoskeleton (GO:0005856), spindle (GO:0005819), nucleus (GO:0005634), mitotic spindle (GO:0072686), microtubule cytoskeleton (GO:0015630)


Generated by BioReason

Bioreason Rl Review

(cmd-1-bioreason-rl-review.md)

BioReason-Pro RL Review: cmd-1 (C. elegans)

Source: cmd-1-bioreason-rl-predictions.md

  • Correctness: 5/5
  • Completeness: 4/5

Functional Summary Review

The BioReason functional summary states:

A cytoplasmic calcium-sensing regulator that uses paired EF-hand motifs to bind Ca2+ and undergo conformational switching, thereby exposing target-recognition surfaces that modulate diverse effector proteins. By decoding transient calcium signals, it tunes kinase and phosphatase activities and cytoskeletal assemblies to propagate intracellular signaling in the cytoplasm of Caenorhabditis elegans.

This is an accurate and well-constructed summary. The curated review confirms that cmd-1 encodes the sole C. elegans calmodulin with four functional calcium-binding sites, and its core functions are calcium ion binding (GO:0005509), calcium-dependent protein binding (GO:0048306), and enzyme regulator activity (GO:0030234). The BioReason summary captures all three of these core molecular activities:

  • Calcium binding via EF-hand motifs -- correct and matches GO:0005509
  • Conformational switching that exposes target-recognition surfaces -- accurately describes the calcium-dependent protein binding mechanism
  • Modulation of kinases, phosphatases, and cytoskeletal assemblies -- aligns with the enzyme regulator activity annotation and the spindle-related phenotypes

The cytoplasmic localization call is correct (GO:0005737 is accepted in the curated review).

The summary is slightly incomplete in that it does not mention the specific C. elegans biology: CMD-1's roles at spindle poles and centrosomes during cell division, meiotic spindle orientation, and the neuronal chemotaxis phenotype. However, since these are classified as non-core functions in the curated review, the omission is minor.

Comparison with interpro2go:

The interpro2go annotation (GO_REF:0000002) assigns GO:0005509 (calcium ion binding). BioReason correctly reproduces this but goes meaningfully beyond it by describing the calcium-dependent conformational switching and effector modulation, which corresponds to GO:0048306 (calcium-dependent protein binding) and GO:0030234 (enzyme regulator activity) -- terms from IBA annotations, not interpro2go. This shows genuine added value over pure domain-based annotation.

Notes on thinking trace

The trace provides a clean mechanistic chain from EF-hand architecture to calcium binding to effector regulation. The reasoning about calmodulin-like sensor behavior and the hypothesis about CaM-dependent kinases and phosphatases as interaction partners are well-calibrated.

📄 View Raw YAML

id: O16305
gene_symbol: cmd-1
product_type: PROTEIN
status: DRAFT
taxon:
  id: NCBITaxon:6239
  label: Caenorhabditis elegans
description: >-
  cmd-1 encodes the single Caenorhabditis elegans calmodulin, a small EF-hand
  calcium sensor with four functional calcium-binding sites. The conserved core
  function is calcium-dependent binding and regulation of target proteins,
  including enzymes and spindle-associated factors. Experimental work in worms
  additionally places CMD-1 at spindle poles, centrosomes, the interphase
  nuclear membrane, and cell-cell boundaries in early embryos, and supports
  context-specific roles in meiotic spindle orientation, embryonic morphogenesis,
  apoptosis-related phenotypes, and neuronal chemotaxis. Falcon deep research
  further documents concrete downstream effector contexts: CMD-1 is the Ca2+/CaM
  activator component of the calcineurin phosphatase complex (with TAX-6 and
  CNB-1), it sets a transcriptionally controlled, limiting level of neuronal
  excitability, and it couples intestinal epithelial Ca2+ influx to NHX-6
  activation in a gut-to-neuron host-defense pathway. Current GOA for cmd-1
  contains no ISO annotations; the transfer-style annotations are IBA/IEA rather
  than ISO, so this ISO-focused pass mainly evaluates whether those orthology-
  derived calls are appropriately conservative.
existing_annotations:
- term:
    id: GO:0005509
    label: calcium ion binding
  evidence_type: IBA
  original_reference_id: GO_REF:0000033
  review:
    summary: >-
      This phylogenetically inferred annotation matches the defining biochemical
      property of calmodulin family proteins. cmd-1 is the sole worm calmodulin,
      UniProt records four functional calcium-binding sites, and no conflicting
      evidence exists.
    action: ACCEPT
    reason: >-
      Calcium ion binding is a conserved and central calmodulin activity, so the
      orthology-based transfer is well supported and represents core function.
    supported_by:
    - reference_id: file:worm/cmd-1/cmd-1-uniprot.txt
      supporting_text: This protein has four functional calcium-binding sites.
    - reference_id: file:worm/cmd-1/cmd-1-deep-research-falcon.md
      supporting_text: >-
        encoding the Ca2+-binding messenger protein **CMD-1**
- term:
    id: GO:0005737
    label: cytoplasm
  evidence_type: IBA
  original_reference_id: GO_REF:0000033
  review:
    summary: >-
      Cytoplasmic localization is consistent with cmd-1 being a broadly acting
      soluble calcium sensor. Experimental work in embryos also places CMD-1 on
      spindle/centrosomal structures and other non-nuclear sites, which is
      compatible with a general cytoplasmic annotation.
    action: ACCEPT
    reason: >-
      Cytoplasm is a correct high-level cellular location for calmodulin and is
      sufficiently general to retain as a core localization term.
    supported_by:
    - reference_id: file:worm/cmd-1/cmd-1-uniprot.txt
      supporting_text: 'DR   GO; GO:0005737; C:cytoplasm; IBA:GO_Central.'
- term:
    id: GO:0030234
    label: enzyme regulator activity
  evidence_type: IBA
  original_reference_id: GO_REF:0000033
  review:
    summary: >-
      Calmodulin-Ca2+ complexes regulate multiple enzyme classes, including
      kinases and phosphatases, and UniProt explicitly describes cmd-1 as a
      mediator of enzyme control. The term is broad, but it captures a genuine
      conserved molecular role.
    action: ACCEPT
    reason: >-
      Although general, enzyme regulator activity is an appropriate conserved
      summary term for calmodulin and reflects core function rather than a
      lineage-specific phenotype. Falcon deep research identifies a concrete
      worm enzyme target: CMD-1 is the Ca2+/CaM activator subunit of the
      calcineurin phosphatase complex (TAX-6 catalytic, CNB-1 regulatory).
    supported_by:
    - reference_id: file:worm/cmd-1/cmd-1-uniprot.txt
      supporting_text: >-
        Calmodulin mediates the control of a large number of enzymes, ion
        channels and other proteins by Ca(2+).
    - reference_id: file:worm/cmd-1/cmd-1-deep-research-falcon.md
      supporting_text: >-
        CMD-1 is part of the calcineurin activation complex (TAX-6/CNB-1/CMD-1)
- term:
    id: GO:0000226
    label: microtubule cytoskeleton organization
  evidence_type: IBA
  original_reference_id: GO_REF:0000033
  review:
    summary: >-
      The transfer is plausible because worm experiments support CMD-1 roles in
      spindle organization and spindle orientation. However, the specific
      evidence is tied to cell-division contexts rather than to a universally
      defining calmodulin function.
    action: KEEP_AS_NON_CORE
    reason: >-
      Retain the annotation as valid but non-core because it reflects a real,
      experimentally supported spindle phenotype without being the central
      conserved biochemical identity of the gene. Falcon deep research confirms
      this is a recurring spindle-pole module function spanning multiple studies.
    supported_by:
    - reference_id: PMID:19219036
      supporting_text: >-
        ASPM-1, together with calmodulin (CMD-1), promotes meiotic spindle
        organization
    - reference_id: file:worm/cmd-1/cmd-1-deep-research-falcon.md
      supporting_text: >-
        CMD-1 acts with ASPM-1/LIN-5 to recruit dynein and drive meiotic spindle
        rotation
- term:
    id: GO:0005509
    label: calcium ion binding
  evidence_type: IEA
  original_reference_id: GO_REF:0000002
  review:
    summary: >-
      InterPro-derived calcium ion binding agrees with the IBA call and with the
      well-established EF-hand architecture of calmodulin.
    action: ACCEPT
    reason: >-
      This is a correct electronic annotation for a canonical EF-hand calcium-
      binding protein and matches core function.
    supported_by:
    - reference_id: file:worm/cmd-1/cmd-1-uniprot.txt
      supporting_text: This protein has four functional calcium-binding sites.
- term:
    id: GO:0072686
    label: mitotic spindle
  evidence_type: IEA
  original_reference_id: GO_REF:0000117
  review:
    summary: >-
      The ARBA localization is consistent with direct experimental embryo data
      showing CMD-1 accumulation on spindle structures. It is a correct but
      context-specific localization.
    action: KEEP_AS_NON_CORE
    reason: >-
      Mitotic spindle localization is supported, but it is not a universal core
      localization for calmodulin across all contexts.
    supported_by:
    - reference_id: file:worm/cmd-1/cmd-1-deep-research-falcon.md
      supporting_text: >-
        CMD-1 acts with ASPM-1/LIN-5 to recruit dynein and drive meiotic spindle
        rotation
- term:
    id: GO:0010629
    label: negative regulation of gene expression
  evidence_type: IMP
  original_reference_id: PMID:34499028
  review:
    summary: >-
      PMID:34499028 supports a specific autoregulatory loop in which high CMD-1
      levels repress expression from the cmd-1 promoter through CAMT-1. That is
      more limited than generic negative regulation of gene expression.
    action: MARK_AS_OVER_ANNOTATED
    reason: >-
      The paper supports context-specific feedback on cmd-1 transcription, not a
      broad generic role in repressing gene expression across targets.
    supported_by:
    - reference_id: PMID:34499028
      supporting_text: high levels of CMD-1 can repress expression from the cmd-1 promoter
- term:
    id: GO:0050918
    label: positive chemotaxis
  evidence_type: IMP
  original_reference_id: PMID:34499028
  review:
    summary: >-
      Neuronal reduction of cmd-1 contributes to chemotaxis defects, and
      supplementing neuronal CMD-1 rescues attraction to several cues in the
      CAMT-1 regulatory context examined in the paper.
    action: KEEP_AS_NON_CORE
    reason: >-
      The phenotype is real but represents a specialized neuronal/behavioral
      context rather than the core conserved role of calmodulin. Falcon deep
      research underscores that neuronal CMD-1 abundance is a limiting,
      transcriptionally controlled determinant of sensory-neuron excitability
      and chemotaxis behavior.
    supported_by:
    - reference_id: PMID:34499028
      supporting_text: restored normal chemotaxis toward salt, benzaldehyde, and diacetyl
    - reference_id: file:worm/cmd-1/cmd-1-deep-research-falcon.md
      supporting_text: >-
        reduced CaM levels are associated with hyperexcitable Ca2+ responses in
        sensory neurons
- term:
    id: GO:0009792
    label: embryo development ending in birth or egg hatching
  evidence_type: IMP
  original_reference_id: PMID:14703012
  review:
    summary: >-
      cmd-1 RNAi causes severe embryonic lethality with disturbed morphogenesis,
      so the gene clearly contributes to successful embryogenesis.
    action: KEEP_AS_NON_CORE
    reason: >-
      This broad developmental phenotype is supported experimentally, but it is a
      pleiotropic consequence of depleting a global calcium sensor and should not
      be treated as core function. Falcon deep research quantifies the strong
      essentiality (~95% embryonic lethality by dsRNA injection) while framing it
      as downstream of CMD-1's global Ca2+-sensor role.
    supported_by:
    - reference_id: PMID:14703012
      supporting_text: RNAi microinjection approach results in a severe embryonic lethal phenotype
    - reference_id: file:worm/cmd-1/cmd-1-deep-research-falcon.md
      supporting_text: >-
        cmd-1 knockdown produced **~95% embryonic lethality**
- term:
    id: GO:0005813
    label: centrosome
  evidence_type: IDA
  original_reference_id: PMID:17716666
  review:
    summary: >-
      Full-text evidence from PMID:17716666 shows GFP-tagged CMD-1 accumulation
      at centrosomes in early embryos.
    action: KEEP_AS_NON_CORE
    reason: >-
      The localization is directly observed and valid, but it is a cell-division
      context rather than a core pan-context localization.
- term:
    id: GO:0031965
    label: nuclear membrane
  evidence_type: IDA
  original_reference_id: PMID:17716666
  review:
    summary: >-
      The same embryo localization study reports CMD-1 at the interphase nuclear
      membrane.
    action: KEEP_AS_NON_CORE
    reason: >-
      The annotation is experimentally supported but context-specific and not a
      primary summary of calmodulin function.
- term:
    id: GO:0071944
    label: cell periphery
  evidence_type: IDA
  original_reference_id: PMID:17716666
  review:
    summary: >-
      PMID:17716666 reports CMD-1 at the borders of abutting cells in embryos,
      which justifies a general cell periphery term.
    action: KEEP_AS_NON_CORE
    reason: >-
      Direct localization supports the term, but this is again a non-core,
      context-dependent localization.
- term:
    id: GO:0072686
    label: mitotic spindle
  evidence_type: IDA
  original_reference_id: PMID:17716666
  review:
    summary: >-
      Direct imaging shows CMD-1 on spindle structures and not at the cleavage
      furrow in early embryos.
    action: KEEP_AS_NON_CORE
    reason: >-
      Correct experimental localization, but specialized to embryonic cell
      division rather than a core location.
- term:
    id: GO:0005515
    label: protein binding
  evidence_type: IPI
  original_reference_id: PMID:19219036
  review:
    summary: >-
      PMID:19219036 places CMD-1 in an ASPM-1/LIN-5 spindle-pole complex, so a
      physical interaction claim is credible. However, protein binding is too
      generic for calmodulin and loses the informative calcium-dependent nature
      of its target interactions.
    action: MODIFY
    reason: >-
      The interaction evidence should be retained, but the annotation should use
      a more informative calmodulin-appropriate term rather than generic protein
      binding.
    proposed_replacement_terms:
    - id: GO:0048306
      label: calcium-dependent protein binding
- term:
    id: GO:0032880
    label: regulation of protein localization
  evidence_type: IMP
  original_reference_id: PMID:19219036
  review:
    summary: >-
      The meiosis study shows CMD-1 promotes accumulation of LIN-5 at meiotic and
      mitotic spindle poles, which is an experimentally grounded protein
      localization phenotype.
    action: KEEP_AS_NON_CORE
    reason: >-
      This process annotation is valid but reflects a specific spindle-pole
      context, not cmd-1's central conserved biochemical identity. Falcon deep
      research reinforces that the CMD-1/LIN-5/ASPM-1 module recruits dynein to
      spindle poles, and that this recruitment is gated by CDK-1.
    supported_by:
    - reference_id: PMID:19219036
      supporting_text: >-
        promotes meiotic spindle organization and the accumulation of LIN-5 at
        meiotic and mitotic spindle poles
    - reference_id: file:worm/cmd-1/cmd-1-deep-research-falcon.md
      supporting_text: >-
        CDK-1 inhibits spindle rotation by blocking the interaction between the
        **CMD-1–LIN-5–ASPM-1** module and **DHC-1/dynein**
- term:
    id: GO:0051296
    label: establishment of meiotic spindle orientation
  evidence_type: IMP
  original_reference_id: PMID:19219036
  review:
    summary: >-
      The paper directly concludes that LIN-5, ASPM-1, CMD-1 and dynein are
      required for spindle rotation during maternal meiosis.
    action: KEEP_AS_NON_CORE
    reason: >-
      Strong experimental support exists, but the process is specialized rather
      than core to calmodulin across contexts. Falcon deep research corroborates
      this with an independent follow-up study (Ellefson & McNally 2011) showing
      cmd-1(RNAi) abolishes meiosis I spindle rotation.
    supported_by:
    - reference_id: PMID:19219036
      supporting_text: >-
        Spindle rotation during maternal meiosis is independent of GPR-1/2 and
        Galpha, yet requires LIN-5, ASPM-1, CMD-1 and dynein
    - reference_id: file:worm/cmd-1/cmd-1-deep-research-falcon.md
      supporting_text: >-
        cmd-1(RNAi) abolished meiosis I spindle rotation
- term:
    id: GO:0051296
    label: establishment of meiotic spindle orientation
  evidence_type: IGI
  original_reference_id: PMID:19219036
  review:
    summary: >-
      The genetic interaction-based version of the same process annotation is
      consistent with the paper's functional dissection of the spindle-pole
      complex.
    action: KEEP_AS_NON_CORE
    reason: >-
      Retain as non-core for the same reason as the IMP entry: direct support,
      but specialized biology.
    supported_by:
    - reference_id: PMID:19219036
      supporting_text: >-
        Spindle rotation during maternal meiosis is independent of GPR-1/2 and
        Galpha, yet requires LIN-5, ASPM-1, CMD-1 and dynein
- term:
    id: GO:0016477
    label: cell migration
  evidence_type: IMP
  original_reference_id: PMID:14703012
  review:
    summary: >-
      cmd-1 RNAi embryos show aberrant cell migration patterns according to the
      abstract, supporting a migration-related phenotype.
    action: KEEP_AS_NON_CORE
    reason: >-
      This is a pleiotropic developmental phenotype observed after strong loss of
      a global calcium sensor, so it should be retained only as non-core.
    supported_by:
    - reference_id: PMID:14703012
      supporting_text: Embryos show disturbed morphogenesis, aberrant cell migration patterns
- term:
    id: GO:0042981
    label: regulation of apoptotic process
  evidence_type: IMP
  original_reference_id: PMID:14703012
  review:
    summary: >-
      The abstract reports multiple defects in apoptosis after cmd-1 depletion,
      which supports involvement in apoptosis-related regulation.
    action: KEEP_AS_NON_CORE
    reason: >-
      The phenotype is supported, but it is broad and likely pleiotropic rather
      than a core defining function of calmodulin.
    supported_by:
    - reference_id: PMID:14703012
      supporting_text: multiple defects in apoptosis
- term:
    id: GO:0043277
    label: apoptotic cell clearance
  evidence_type: IMP
  original_reference_id: PMID:14703012
  review:
    summary: >-
      The accessible abstract supports apoptosis defects, but it does not clearly
      distinguish cell corpse clearance/engulfment from upstream apoptosis
      defects.
    action: UNDECIDED
    reason: >-
      This specific term may be correct, but the currently accessible evidence is
      insufficiently specific to review it confidently.
- term:
    id: GO:0051726
    label: regulation of cell cycle
  evidence_type: IMP
  original_reference_id: PMID:14703012
  review:
    summary: >-
      Hyperproliferation in cmd-1 RNAi embryos is consistent with cell-cycle
      dysregulation after depletion of calmodulin.
    action: KEEP_AS_NON_CORE
    reason: >-
      The phenotype is experimentally supported, but it is a broad developmental
      consequence rather than a core molecular role.
    supported_by:
    - reference_id: PMID:14703012
      supporting_text: a striking hyperproliferation of cells
references:
- id: GO_REF:0000002
  title: Gene Ontology annotation through association of InterPro records with GO terms
  findings:
  - statement: InterPro family mapping supports the calcium ion binding annotation
      for EF-hand calmodulin proteins.
- id: GO_REF:0000033
  title: Annotation inferences using phylogenetic trees
  findings:
  - statement: cmd-1 has no current ISO annotations in GOA; the orthology-style
      transfer set for this gene is IBA rather than ISO.
  - statement: The IBA annotations capture conserved calmodulin properties such as
      calcium ion binding, cytoplasmic localization, and broad enzyme-regulatory
      function.
- id: GO_REF:0000117
  title: Electronic Gene Ontology annotations created by ARBA machine learning models
  findings:
  - statement: ARBA assigns mitotic spindle localization, which is consistent with
      direct embryo localization data.
- id: PMID:14703012
  title: Functional analysis of the single calmodulin gene in the nematode Caenorhabditis
    elegans by RNA interference and 4-D microscopy.
  findings:
  - statement: cmd-1 RNAi causes severe embryonic lethality with disturbed morphogenesis.
    supporting_text: >-
      RNAi microinjection approach results in a severe embryonic lethal phenotype.
      Embryos show disturbed morphogenesis
  - statement: cmd-1 RNAi embryos show aberrant cell migration patterns,
      hyperproliferation, and multiple defects in apoptosis.
    supporting_text: >-
      Embryos show disturbed morphogenesis, aberrant cell migration patterns, a
      striking hyperproliferation of cells and multiple defects in apoptosis.
- id: PMID:17716666
  title: Cytokinesis is not controlled by calmodulin or myosin light chain kinase
    in the Caenorhabditis elegans early embryo.
  findings:
  - statement: cmd-1 depletion does not block cytokinesis in early embryos.
    supporting_text: >-
      RNA mediated interference against C. elegans calmodulin and candidate MLCKs
      had no effect on cytokinesis in wild-type or RhoK mutant embryos
- id: PMID:19219036
  title: NuMA-related LIN-5, ASPM-1, calmodulin and dynein promote meiotic spindle
    rotation independently of cortical LIN-5/GPR/Galpha.
  findings:
  - statement: CMD-1 works with ASPM-1 and LIN-5 in a spindle-pole complex.
    supporting_text: >-
      ASPM-1, together with calmodulin (CMD-1), promotes meiotic spindle
      organization and the accumulation of LIN-5 at meiotic and mitotic spindle
      poles.
  - statement: CMD-1 promotes meiotic spindle organization and spindle rotation
      during maternal meiosis.
    supporting_text: >-
      Spindle rotation during maternal meiosis is independent of GPR-1/2 and
      Galpha, yet requires LIN-5, ASPM-1, CMD-1 and dynein.
  - statement: CMD-1 promotes accumulation of LIN-5 at meiotic and mitotic spindle
      poles.
    supporting_text: >-
      ASPM-1, together with calmodulin (CMD-1), promotes meiotic spindle
      organization and the accumulation of LIN-5 at meiotic and mitotic spindle
      poles.
- id: PMID:34499028
  title: Neuronal calmodulin levels are controlled by CAMTA transcription factors.
  findings:
  - statement: cmd-1 expression is reduced across multiple neuronal cell types in
      camt-1 mutants.
    supporting_text: >-
      cmd-1 was one of only two genes whose expression was reduced in all four
      neural profiles relative to WT controls.
  - statement: High CMD-1 levels can repress expression from the cmd-1 promoter,
      indicating autoregulatory feedback.
    supporting_text: high levels of CMD-1 can repress expression from the cmd-1 promoter
  - statement: Supplementing neuronal CMD-1 rescues chemotaxis and neuronal
      calcium-signaling defects in the CAMT-1 regulatory context.
    supporting_text: restored normal chemotaxis toward salt, benzaldehyde, and diacetyl
- id: PMID:17854888
  title: Ca(2+)/Calmodulin-binding proteins from the C. elegans proteome.
  findings:
  - statement: Calmodulin is described as the primary calcium sensor that regulates
      a wide variety of cellular processes in eukaryotes.
    supporting_text: >-
      Calmodulin (CaM) is the primary Ca(2+)-sensor that regulates a wide variety
      of cellular processes in eukaryotes.
  - statement: The study identified multiple Ca2+/calmodulin-binding proteins from
      the C. elegans proteome, reinforcing CMD-1's role as a broad calcium-
      dependent target binder.
    supporting_text: >-
      The method allowed the identification of 9 known and 47 previously
      uncharacterized Ca(2+)-dependent CaM-binding proteins from the adult worm
      proteome.
- id: file:worm/cmd-1/cmd-1-uniprot.txt
  title: UniProt record for C. elegans cmd-1
  findings:
  - statement: UniProt records four functional calcium-binding sites in CMD-1.
  - statement: UniProt states that calmodulin mediates control of many enzymes, ion
      channels, and other proteins by Ca2+.
- id: PMID:21690306
  title: CDK-1 inhibits meiotic spindle shortening and dynein-dependent spindle rotation
    in C. elegans.
  findings:
  - statement: CDK-1 gates meiotic spindle rotation by blocking dynein association
      with microtubules and with the LIN-5-ASPM-1 (with CMD-1) module at spindle poles.
    supporting_text: >-
      rotation by inhibiting dynein association with microtubules and with
    reference_section_type: ABSTRACT
  - statement: APC-driven CDK-1 inactivation relieves this block, allowing dynein
      accumulation and spindle rotation.
    supporting_text: >-
      LIN-5-ASPM-1 at meiotic spindle poles and that the APC promotes spindle rotation
    reference_section_type: ABSTRACT
- id: PMID:31944606
  title: Caenorhabditis elegans phosphatase complexes in UniProtKB and Complex Portal.
  findings:
  - statement: Expert curation places CMD-1 (calmodulin) in the C. elegans calcineurin
      phosphatase complex together with the catalytic subunit TAX-6 and regulatory
      subunit CNB-1, consistent with canonical Ca2+/CaM-dependent calcineurin activation.
    supporting_text: >-
      biological significance of phosphatase
    reference_section_type: ABSTRACT
- id: PMID:36920509
  title: Human calmodulin mutations cause arrhythmia and affect neuronal function in
    C. elegans.
  findings:
  - statement: Humanized cmd-1 alleles carrying pathogenic human calmodulin variants
      (N54I, D96V) disrupt rhythmic behaviors (pharynx pumping and the defecation motor
      program), providing an in vivo CMD-1 functional readout for calmodulinopathy.
    supporting_text: >-
      calmodulin mutations N54I and D96V can be recapitulated in disruption of two
    reference_section_type: ABSTRACT
  - statement: The same variants affect neuronal function differently (D96V sensitizes
      the neuromuscular junction; N54I is protective), and N98S impairs chemosensing
      without affecting rhythmic behavior.
    supporting_text: >-
      Whereas D96V sensitizes signaling at the neuromuscular junction, N54I has
    reference_section_type: ABSTRACT
- id: PMID:41888139
  title: Proton signaling links epithelial sensing to neural control of host defense
    in C. elegans.
  findings:
  - statement: In intestinal epithelial cells, pathogen-stimulated Ca2+ influx through
      GON-2 activates the Na+/H+ exchanger NHX-6 via the calmodulin CMD-1, driving
      basolateral proton release that signals to cholinergic neurons through ASIC-1.
    supporting_text: >-
      exchanger NHX-6 via the calmodulin CMD-1 to drive basolateral proton release.
    reference_section_type: ABSTRACT
- id: file:worm/cmd-1/cmd-1-deep-research-falcon.md
  title: Falcon deep research report for C. elegans cmd-1 (calmodulin)
  findings:
  - statement: cmd-1 is the single C. elegans calmodulin gene encoding the conserved
      intracellular Ca2+ sensor CMD-1.
    supporting_text: >-
      encoding the Ca2+-binding messenger protein **CMD-1**
  - statement: CMD-1 acts within a spindle-pole module with ASPM-1 and LIN-5 to recruit
      dynein and drive meiotic spindle rotation; cmd-1(RNAi) abolishes meiosis I spindle
      rotation.
    supporting_text: >-
      CMD-1 acts with ASPM-1/LIN-5 to recruit dynein and drive meiotic spindle
      rotation
  - statement: CMD-1 is the Ca2+/CaM activator component of the worm calcineurin
      phosphatase complex (TAX-6 catalytic, CNB-1 regulatory).
    supporting_text: >-
      CMD-1 is part of the calcineurin activation complex (TAX-6/CNB-1/CMD-1)
  - statement: Neuronal CMD-1 abundance is a limiting, transcriptionally controlled
      determinant of sensory-neuron excitability and behavior.
    supporting_text: >-
      reduced CaM levels are associated with hyperexcitable Ca2+ responses in
      sensory neurons
  - statement: CMD-1 couples intestinal epithelial Ca2+ influx to NHX-6 activation and
      proton release in a gut-to-neuron host-defense pathway.
    supporting_text: >-
      CMD-1 couples Ca2+ influx in intestinal epithelial cells to NHX-6 activation
      and proton release
core_functions:
- description: >-
    Primary EF-hand calcium sensor that binds calcium ions through four conserved
    sites and acts as the biochemical core of worm calmodulin function.
  molecular_function:
    id: GO:0005509
    label: calcium ion binding
  locations:
  - id: GO:0005737
    label: cytoplasm
  supported_by:
  - reference_id: file:worm/cmd-1/cmd-1-uniprot.txt
    supporting_text: This protein has four functional calcium-binding sites.
- description: >-
    Calcium-loaded CMD-1 binds target proteins and mediates their regulation;
    this includes conserved Ca2+/CaM target binding across the worm proteome and
    spindle-pole associated interactions in embryos.
  molecular_function:
    id: GO:0048306
    label: calcium-dependent protein binding
  locations:
  - id: GO:0005737
    label: cytoplasm
  supported_by:
  - reference_id: PMID:17854888
    supporting_text: >-
      Calmodulin (CaM) is the primary Ca(2+)-sensor that regulates a wide variety
      of cellular processes in eukaryotes.
  - reference_id: PMID:19219036
    supporting_text: >-
      ASPM-1, together with calmodulin (CMD-1), promotes meiotic spindle
      organization and the accumulation of LIN-5 at meiotic and mitotic spindle
      poles.
- description: >-
    Calmodulin-Ca2+ acts as a broad enzyme regulator, stimulating downstream
    kinase and phosphatase targets rather than serving as an enzyme itself. A
    concrete worm example is the calcineurin phosphatase complex, in which CMD-1
    is the Ca2+/CaM activator subunit alongside catalytic TAX-6 and regulatory
    CNB-1.
  molecular_function:
    id: GO:0030234
    label: enzyme regulator activity
  locations:
  - id: GO:0005737
    label: cytoplasm
  supported_by:
  - reference_id: file:worm/cmd-1/cmd-1-uniprot.txt
    supporting_text: >-
      Calmodulin mediates the control of a large number of enzymes, ion channels
      and other proteins by Ca(2+).
  - reference_id: file:worm/cmd-1/cmd-1-deep-research-falcon.md
    supporting_text: >-
      CMD-1 is part of the calcineurin activation complex (TAX-6/CNB-1/CMD-1)
proposed_new_terms: []
suggested_questions:
- question: Which direct CMD-1 target proteins at spindle poles are most important
    for the meiotic spindle orientation phenotype in embryos?
- question: Which apoptosis and cell-migration phenotypes after cmd-1 depletion are
    direct CMD-1-dependent processes versus secondary consequences of broad calcium
    signaling collapse?
- question: Should calmodulin-family curation in nematodes explicitly add
    calcium-dependent protein binding where older annotations still use generic
    protein binding?
suggested_experiments:
- description: Endogenous tagged CMD-1 affinity purification or proximity labeling
    under Ca2+-bound and Ca2+-free conditions to define direct embryo and neuronal
    target proteins.
- description: Rescue cmd-1 loss with EF-hand calcium-binding mutants to separate
    calcium sensing from possible scaffolding/localization roles at spindle poles.
- description: Tissue-specific depletion or rescue in embryos versus neurons to
    distinguish direct spindle and chemotaxis functions from pleiotropic systemic
    effects.