BioReason Chat Export

Exported on March 22, 2026 at 01:19 AM

Organism: Caenorhabditis elegans

Sequence:

MFPQTTMDHILHPTPREGYYVVELNRSVWVVPNYYINLTPIGTGAYGTVCAAECTRSGTRVAIKKFNRPFQSIIHARRTYRELRLLRCMCHENIIDLLDVFTPNENVNDIEDVYFVSMLMGADLSNILKIQRLNDDHIQFLVYQILRGLKYIHSADIIHRDLKPSNIAVNEDCELKILDFGLARQTDSEMTGYVATRWYRAPEIMLNWMHYTQTVDVWSVGCILAELITGKTLFPGSDHIDQLTRIMSVTGTPDEEFLKKISSEEARNYIRNLPKMTRRDFKRLFAQATPQAIDLLEKMLHLDPDRRPTAKEAMEHEYLAAYHDETDEPIAEEMDLNDDVRADTIDEWKKIIWEEISDFQKNVAFADEEEDEEKMES

Thinking Trace

I begin by examining the InterPro architecture and its order along the sequence. An N-terminal to C-terminal arrangement places IPR008352 (Mitogen-activated protein (MAP) kinase HOG-like family, residues 23–328) and IPR050117 (Mitogen-activated protein (MAP) kinase family, residues 38–332) as overlapping family signatures that define a canonical MAP kinase scaffold. Embedded within this MAPK framework is IPR000719 (Protein kinase domain, residues 35–319), establishing a bilobal catalytic core that binds ATP and transfers phosphate to protein substrates. The core is further specified by IPR011009 (Protein kinase-like domain superfamily, residues 26–357), indicating a typical eukaryotic protein kinase fold extending into the C-terminal region, and by IPR017441 (Protein kinase, ATP binding site, residues 41–65), which marks the glycine-rich loop and adjacent motifs that coordinate ATP. IPR003527 (MAP kinase, conserved site, residues 70–173) highlights hallmark MAPK conserved elements in the activation loop and docking grooves that confer MAPK substrate recognition and pathway coupling. The contiguous placement of these domains—from ATP-binding elements through the catalytic core and MAPK-specific conserved sites—causally dictates a phosphotransferase mechanism with proline-directed specificity typical of MAPKs.

From this architecture, the molecular function resolves to ATP-dependent protein phosphorylation. The explicit ATP-binding site (IPR017441) and the canonical kinase domain (IPR000719) enforce GO:0004672 protein kinase activity and GO:0005524 ATP binding. The MAPK family signatures (IPR008352, IPR050117) and the MAPK conserved site (IPR003527) constrain substrate preference and docking interactions characteristic of mitogen-activated protein kinases, supporting GO:0004707 MAP kinase activity. Together, these features define an enzyme that uses ATP to phosphorylate downstream targets in signaling cascades.

The biological process follows directly from MAPK identity. A MAPK fold with MAPK-specific conserved motifs orchestrates stimulus-responsive signaling cascades that propagate extracellular and intracellular cues. This causally links the enzyme to GO:0000165 MAPK cascade and situates it within broader intracellular signal transduction. By phosphorylating effectors that regulate transcription, cytoskeletal dynamics, and stress responses, the kinase modulates pathway outputs central to signal transduction.

Cellular localization is inferred from the soluble kinase architecture and absence of transmembrane or secretion signals. The soluble, cytosolic kinase domain and extended kinase-like superfamily coverage (IPR011009, residues 26–357) argue for a non-membranous, intracellular distribution. MAPKs typically operate in the cytoplasm and often translocate or signal near the nucleus to regulate transcription; thus, the most parsimonious placement is the cytoplasm with functional access to cytosolic signaling hubs.

Mechanistically, the kinase is activated by phosphorylation of its activation loop within the IPR003527 conserved region, switching the active site into a high-affinity, high-turnover state. Once activated, it binds substrates via MAPK docking grooves and transfers phosphate from ATP to specific serine/threonine residues, driving pathway flux through the MAPK cascade. I hypothesize interactions with upstream MAPKKs and MAPKKKs that assemble the cascade, scaffold proteins that localize signaling modules, and effector proteins such as transcriptional regulators and cytoskeletal modulators. These assemblies would concentrate the kinase in cytoplasmic signaling nodes, with transient nuclear access during stress or developmental signaling.

Functional Summary

A soluble signaling kinase in nematode that uses an ATP-dependent catalytic core to phosphorylate downstream targets within a mitogen-activated signaling cascade. Its MAP kinase architecture enables activation by phosphorylation and docking-driven substrate recognition, thereby propagating intracellular signals that regulate pathway outputs. The enzyme most plausibly functions in the cytoplasm where signaling modules and scaffolds concentrate it, with transient access to nuclear effectors through its pathway.

UniProt Summary

Mitogen-activated protein kinase.

InterPro Domains

• Mitogen-activated protein (MAP) kinase HOG-like (IPR008352, family) — residues 23-328
• Protein kinase-like domain superfamily (IPR011009, homologous_superfamily) — residues 26-357
• Protein kinase domain (IPR000719, domain) — residues 35-319
• Mitogen-activated protein (MAP) kinase (IPR050117, family) — residues 38-332
• Protein kinase, ATP binding site (IPR017441, binding_site) — residues 41-65
• Mitogen-activated protein (MAP) kinase, conserved site (IPR003527, conserved_site) — residues 70-173

GO Terms

Molecular Function: molecular_function (GO:0003674), binding (GO:0005488), catalytic activity (GO:0003824), transferase activity (GO:0016740), catalytic activity, acting on a protein (GO:0140096), protein binding (GO:0005515), transcription factor binding (GO:0008134), transferase activity, transferring phosphorus-containing groups (GO:0016772), protein kinase activity (GO:0004672), protein serine/threonine kinase activity (GO:0004674), kinase activity (GO:0016301), phosphotransferase activity, alcohol group as acceptor (GO:0016773), MAP kinase activity (GO:0004707)

Biological Process: biological_process (GO:0008150), metabolic process (GO:0008152), positive regulation of biological process (GO:0048518), regulation of biological process (GO:0050789), biological process involved in interspecies interaction between organisms (GO:0044419), immune system process (GO:0002376), signaling (GO:0023052), multicellular organismal process (GO:0032501), biological regulation (GO:0065007), response to stimulus (GO:0050896), cellular process (GO:0009987), negative regulation of biological process (GO:0048519), response to external stimulus (GO:0009605), response to abiotic stimulus (GO:0009628), response to chemical (GO:0042221), regulation of metabolic process (GO:0019222), positive regulation of response to stimulus (GO:0048584), immune response (GO:0006955), regulation of localization (GO:0032879), nitrogen compound metabolic process (GO:0006807), organic substance metabolic process (GO:0071704), cellular metabolic process (GO:0044237), positive regulation of cellular process (GO:0048522), response to biotic stimulus (GO:0009607), cell death (GO:0008219), regulation of cellular process (GO:0050794), regulation of response to stimulus (GO:0048583), positive regulation of metabolic process (GO:0009893), cellular response to stimulus (GO:0051716), primary metabolic process (GO:0044238), response to stress (GO:0006950), negative regulation of cellular process (GO:0048523), response to other organism (GO:0051707), cell communication (GO:0007154), signal transduction (GO:0007165), behavior (GO:0007610), response to temperature stimulus (GO:0009266), positive regulation of response to external stimulus (GO:0032103), programmed cell death (GO:0012501), positive regulation of protein localization (GO:1903829), organonitrogen compound metabolic process (GO:1901564), response to external biotic stimulus (GO:0043207), negative regulation of cell death (GO:0060548), intracellular signal transduction (GO:0035556), response to oxidative stress (GO:0006979), positive regulation of macromolecule metabolic process (GO:0010604), regulation of response to stress (GO:0080134), regulation of cellular localization (GO:0060341), protein metabolic process (GO:0019538), response to toxic substance (GO:0009636), defense response (GO:0006952), response to osmotic stress (GO:0006970), regulation of macromolecule metabolic process (GO:0060255), regulation of response to external stimulus (GO:0032101), response to oxygen-containing compound (GO:1901700), adult behavior (GO:0030534), macromolecule metabolic process (GO:0043170), innate immune response (GO:0045087), positive regulation of biosynthetic process (GO:0009891), defense response to other organism (GO:0098542), phosphorus metabolic process (GO:0006793), response to heat (GO:0009408), regulation of response to biotic stimulus (GO:0002831), response to inorganic substance (GO:0010035), regulation of cell death (GO:0010941), positive regulation of cellular metabolic process (GO:0031325), cellular response to chemical stimulus (GO:0070887), cellular response to stress (GO:0033554), positive regulation of response to biotic stimulus (GO:0002833), response to bacterium (GO:0009617), regulation of biosynthetic process (GO:0009889), regulation of nitrogen compound metabolic process (GO:0051171), regulation of cellular metabolic process (GO:0031323), positive regulation of defense response (GO:0031349), regulation of primary metabolic process (GO:0080090), response to nicotine (GO:0035094), positive regulation of nitrogen compound metabolic process (GO:0051173), response to metal ion (GO:0010038), regulation of defense response (GO:0031347), negative regulation of neuron death (GO:1901215), regulation of macromolecule biosynthetic process (GO:0010556), positive regulation of defense response to bacterium (GO:1900426), MAPK cascade (GO:0000165), regulation of neuron death (GO:1901214), positive regulation of gene expression (GO:0010628), phosphate-containing compound metabolic process (GO:0006796), regulation of protein localization (GO:0032880), regulation of defense response to bacterium (GO:1900424), regulation of gene expression (GO:0010468), stress-activated protein kinase signaling cascade (GO:0031098), response to oxygen radical (GO:0000305), hyperosmotic response (GO:0006972), protein modification process (GO:0036211), response to endoplasmic reticulum stress (GO:0034976), positive regulation of macromolecule biosynthetic process (GO:0010557), positive regulation of nucleobase-containing compound metabolic process (GO:0045935), positive regulation of RNA metabolic process (GO:0051254), macromolecule modification (GO:0043412), cellular response to inorganic substance (GO:0071241), behavioral response to nicotine (GO:0035095), defense response to bacterium (GO:0042742), regulation of cellular biosynthetic process (GO:0031326), regulation of nucleobase-containing compound metabolic process (GO:0019219), positive regulation of protein localization to nucleus (GO:1900182), regulation of RNA metabolic process (GO:0051252), response to reactive oxygen species (GO:0000302), positive regulation of cellular biosynthetic process (GO:0031328), stress-activated MAPK cascade (GO:0051403), regulation of RNA biosynthetic process (GO:2001141), protein phosphorylation (GO:0006468), regulation of DNA-templated transcription (GO:0006355), peptidyl-amino acid modification (GO:0018193), phosphorylation (GO:0016310), cellular response to metal ion (GO:0071248), response to superoxide (GO:0000303), defense response to Gram-negative bacterium (GO:0050829), positive regulation of RNA biosynthetic process (GO:1902680), regulation of protein localization to nucleus (GO:1900180), regulation of transcription by RNA polymerase II (GO:0006357), positive regulation of DNA-templated transcription (GO:0045893), p38MAPK cascade (GO:0038066), positive regulation of nucleic acid-templated transcription (GO:1903508), regulation of nucleic acid-templated transcription (GO:1903506), peptidyl-serine phosphorylation (GO:0018105), peptidyl-serine modification (GO:0018209), positive regulation of transcription by RNA polymerase II (GO:0045944)

Cellular Component: cellular_component (GO:0005575), cellular anatomical entity (GO:0110165), cytosol (GO:0005829), intracellular anatomical structure (GO:0005622), organelle (GO:0043226), cytoplasm (GO:0005737), intracellular organelle (GO:0043229), membrane-bounded organelle (GO:0043227), intracellular membrane-bounded organelle (GO:0043231), nucleus (GO:0005634)

Generated by BioReason

BioReason Chat Export

Exported on March 22, 2026 at 01:19 AM

Organism: Caenorhabditis elegans

Sequence:

MFPQTTMDHILHPTPREGYYVVELNRSVWVVPNYYINLTPIGTGAYGTVCAAECTRSGTRVAIKKFNRPFQSIIHARRTYRELRLLRCMCHENIIDLLDVFTPNENVNDIEDVYFVSMLMGADLSNILKIQRLNDDHIQFLVYQILRGLKYIHSADIIHRDLKPSNIAVNEDCELKILDFGLARQTDSEMTGYVATRWYRAPEIMLNWMHYTQTVDVWSVGCILAELITGKTLFPGSDHIDQLTRIMSVTGTPDEEFLKKISSEEARNYIRNLPKMTRRDFKRLFAQATPQAIDLLEKMLHLDPDRRPTAKEAMEHEYLAAYHDETDEPIAEEMDLNDDVRADTIDEWKKIIWEEISDFQKNVAFADEEEDEEKMES

Thinking Trace

I begin by examining the InterPro architecture and its order along the sequence. An N-terminal to C-terminal arrangement places IPR008352 (Mitogen-activated protein (MAP) kinase HOG-like family, residues 23–328) and IPR050117 (Mitogen-activated protein (MAP) kinase family, residues 38–332) as overlapping family signatures that define a canonical MAP kinase scaffold. Embedded within this MAPK framework is IPR000719 (Protein kinase domain, residues 35–319), establishing a bilobal catalytic core that binds ATP and transfers phosphate to protein substrates. The core is further specified by IPR011009 (Protein kinase-like domain superfamily, residues 26–357), indicating a typical eukaryotic protein kinase fold extending into the C-terminal region, and by IPR017441 (Protein kinase, ATP binding site, residues 41–65), which marks the glycine-rich loop and adjacent motifs that coordinate ATP. IPR003527 (MAP kinase, conserved site, residues 70–173) highlights hallmark MAPK conserved elements in the activation loop and docking grooves that confer MAPK substrate recognition and pathway coupling. The contiguous placement of these domains—from ATP-binding elements through the catalytic core and MAPK-specific conserved sites—causally dictates a phosphotransferase mechanism with proline-directed specificity typical of MAPKs.

From this architecture, the molecular function resolves to ATP-dependent protein phosphorylation. The explicit ATP-binding site (IPR017441) and the canonical kinase domain (IPR000719) enforce GO:0004672 protein kinase activity and GO:0005524 ATP binding. The MAPK family signatures (IPR008352, IPR050117) and the MAPK conserved site (IPR003527) constrain substrate preference and docking interactions characteristic of mitogen-activated protein kinases, supporting GO:0004707 MAP kinase activity. Together, these features define an enzyme that uses ATP to phosphorylate downstream targets in signaling cascades.

The biological process follows directly from MAPK identity. A MAPK fold with MAPK-specific conserved motifs orchestrates stimulus-responsive signaling cascades that propagate extracellular and intracellular cues. This causally links the enzyme to GO:0000165 MAPK cascade and situates it within broader intracellular signal transduction. By phosphorylating effectors that regulate transcription, cytoskeletal dynamics, and stress responses, the kinase modulates pathway outputs central to signal transduction.

Cellular localization is inferred from the soluble kinase architecture and absence of transmembrane or secretion signals. The soluble, cytosolic kinase domain and extended kinase-like superfamily coverage (IPR011009, residues 26–357) argue for a non-membranous, intracellular distribution. MAPKs typically operate in the cytoplasm and often translocate or signal near the nucleus to regulate transcription; thus, the most parsimonious placement is the cytoplasm with functional access to cytosolic signaling hubs.

Mechanistically, the kinase is activated by phosphorylation of its activation loop within the IPR003527 conserved region, switching the active site into a high-affinity, high-turnover state. Once activated, it binds substrates via MAPK docking grooves and transfers phosphate from ATP to specific serine/threonine residues, driving pathway flux through the MAPK cascade. I hypothesize interactions with upstream MAPKKs and MAPKKKs that assemble the cascade, scaffold proteins that localize signaling modules, and effector proteins such as transcriptional regulators and cytoskeletal modulators. These assemblies would concentrate the kinase in cytoplasmic signaling nodes, with transient nuclear access during stress or developmental signaling.

Functional Summary

A soluble signaling kinase in nematode that uses an ATP-dependent catalytic core to phosphorylate downstream targets within a mitogen-activated signaling cascade. Its MAP kinase architecture enables activation by phosphorylation and docking-driven substrate recognition, thereby propagating intracellular signals that regulate pathway outputs. The enzyme most plausibly functions in the cytoplasm where signaling modules and scaffolds concentrate it, with transient access to nuclear effectors through its pathway.

UniProt Summary

Mitogen-activated protein kinase.

InterPro Domains

• Mitogen-activated protein (MAP) kinase HOG-like (IPR008352, family) — residues 23-328
• Protein kinase-like domain superfamily (IPR011009, homologous_superfamily) — residues 26-357
• Protein kinase domain (IPR000719, domain) — residues 35-319
• Mitogen-activated protein (MAP) kinase (IPR050117, family) — residues 38-332
• Protein kinase, ATP binding site (IPR017441, binding_site) — residues 41-65
• Mitogen-activated protein (MAP) kinase, conserved site (IPR003527, conserved_site) — residues 70-173

GO Terms

Molecular Function: molecular_function (GO:0003674), binding (GO:0005488), catalytic activity (GO:0003824), transferase activity (GO:0016740), catalytic activity, acting on a protein (GO:0140096), protein binding (GO:0005515), transcription factor binding (GO:0008134), transferase activity, transferring phosphorus-containing groups (GO:0016772), protein kinase activity (GO:0004672), protein serine/threonine kinase activity (GO:0004674), kinase activity (GO:0016301), phosphotransferase activity, alcohol group as acceptor (GO:0016773), MAP kinase activity (GO:0004707)

Biological Process: biological_process (GO:0008150), metabolic process (GO:0008152), positive regulation of biological process (GO:0048518), regulation of biological process (GO:0050789), biological process involved in interspecies interaction between organisms (GO:0044419), immune system process (GO:0002376), signaling (GO:0023052), multicellular organismal process (GO:0032501), biological regulation (GO:0065007), response to stimulus (GO:0050896), cellular process (GO:0009987), negative regulation of biological process (GO:0048519), response to external stimulus (GO:0009605), response to abiotic stimulus (GO:0009628), response to chemical (GO:0042221), regulation of metabolic process (GO:0019222), positive regulation of response to stimulus (GO:0048584), immune response (GO:0006955), regulation of localization (GO:0032879), nitrogen compound metabolic process (GO:0006807), organic substance metabolic process (GO:0071704), cellular metabolic process (GO:0044237), positive regulation of cellular process (GO:0048522), response to biotic stimulus (GO:0009607), cell death (GO:0008219), regulation of cellular process (GO:0050794), regulation of response to stimulus (GO:0048583), positive regulation of metabolic process (GO:0009893), cellular response to stimulus (GO:0051716), primary metabolic process (GO:0044238), response to stress (GO:0006950), negative regulation of cellular process (GO:0048523), response to other organism (GO:0051707), cell communication (GO:0007154), signal transduction (GO:0007165), behavior (GO:0007610), response to temperature stimulus (GO:0009266), positive regulation of response to external stimulus (GO:0032103), programmed cell death (GO:0012501), positive regulation of protein localization (GO:1903829), organonitrogen compound metabolic process (GO:1901564), response to external biotic stimulus (GO:0043207), negative regulation of cell death (GO:0060548), intracellular signal transduction (GO:0035556), response to oxidative stress (GO:0006979), positive regulation of macromolecule metabolic process (GO:0010604), regulation of response to stress (GO:0080134), regulation of cellular localization (GO:0060341), protein metabolic process (GO:0019538), response to toxic substance (GO:0009636), defense response (GO:0006952), response to osmotic stress (GO:0006970), regulation of macromolecule metabolic process (GO:0060255), regulation of response to external stimulus (GO:0032101), response to oxygen-containing compound (GO:1901700), adult behavior (GO:0030534), macromolecule metabolic process (GO:0043170), innate immune response (GO:0045087), positive regulation of biosynthetic process (GO:0009891), defense response to other organism (GO:0098542), phosphorus metabolic process (GO:0006793), response to heat (GO:0009408), regulation of response to biotic stimulus (GO:0002831), response to inorganic substance (GO:0010035), regulation of cell death (GO:0010941), positive regulation of cellular metabolic process (GO:0031325), cellular response to chemical stimulus (GO:0070887), cellular response to stress (GO:0033554), positive regulation of response to biotic stimulus (GO:0002833), response to bacterium (GO:0009617), regulation of biosynthetic process (GO:0009889), regulation of nitrogen compound metabolic process (GO:0051171), regulation of cellular metabolic process (GO:0031323), positive regulation of defense response (GO:0031349), regulation of primary metabolic process (GO:0080090), response to nicotine (GO:0035094), positive regulation of nitrogen compound metabolic process (GO:0051173), response to metal ion (GO:0010038), regulation of defense response (GO:0031347), negative regulation of neuron death (GO:1901215), regulation of macromolecule biosynthetic process (GO:0010556), positive regulation of defense response to bacterium (GO:1900426), MAPK cascade (GO:0000165), regulation of neuron death (GO:1901214), positive regulation of gene expression (GO:0010628), phosphate-containing compound metabolic process (GO:0006796), regulation of protein localization (GO:0032880), regulation of defense response to bacterium (GO:1900424), regulation of gene expression (GO:0010468), stress-activated protein kinase signaling cascade (GO:0031098), response to oxygen radical (GO:0000305), hyperosmotic response (GO:0006972), protein modification process (GO:0036211), response to endoplasmic reticulum stress (GO:0034976), positive regulation of macromolecule biosynthetic process (GO:0010557), positive regulation of nucleobase-containing compound metabolic process (GO:0045935), positive regulation of RNA metabolic process (GO:0051254), macromolecule modification (GO:0043412), cellular response to inorganic substance (GO:0071241), behavioral response to nicotine (GO:0035095), defense response to bacterium (GO:0042742), regulation of cellular biosynthetic process (GO:0031326), regulation of nucleobase-containing compound metabolic process (GO:0019219), positive regulation of protein localization to nucleus (GO:1900182), regulation of RNA metabolic process (GO:0051252), response to reactive oxygen species (GO:0000302), positive regulation of cellular biosynthetic process (GO:0031328), stress-activated MAPK cascade (GO:0051403), regulation of RNA biosynthetic process (GO:2001141), protein phosphorylation (GO:0006468), regulation of DNA-templated transcription (GO:0006355), peptidyl-amino acid modification (GO:0018193), phosphorylation (GO:0016310), cellular response to metal ion (GO:0071248), response to superoxide (GO:0000303), defense response to Gram-negative bacterium (GO:0050829), positive regulation of RNA biosynthetic process (GO:1902680), regulation of protein localization to nucleus (GO:1900180), regulation of transcription by RNA polymerase II (GO:0006357), positive regulation of DNA-templated transcription (GO:0045893), p38MAPK cascade (GO:0038066), positive regulation of nucleic acid-templated transcription (GO:1903508), regulation of nucleic acid-templated transcription (GO:1903506), peptidyl-serine phosphorylation (GO:0018105), peptidyl-serine modification (GO:0018209), positive regulation of transcription by RNA polymerase II (GO:0045944)

Cellular Component: cellular_component (GO:0005575), cellular anatomical entity (GO:0110165), cytosol (GO:0005829), intracellular anatomical structure (GO:0005622), organelle (GO:0043226), cytoplasm (GO:0005737), intracellular organelle (GO:0043229), membrane-bounded organelle (GO:0043227), intracellular membrane-bounded organelle (GO:0043231), nucleus (GO:0005634)

Generated by BioReason

provider: falcon
model: Edison Scientific Literature
cached: false
start_time: '2025-12-29T11:13:59.224435'
end_time: '2025-12-29T11:18:24.245125'
duration_seconds: 265.02
template_file: templates/gene_research_go_focused.md
template_variables:
organism: worm
gene_id: pmk-1
gene_symbol: pmk-1
uniprot_accession: Q17446
protein_description: 'RecName: Full=Mitogen-activated protein kinase pmk-1; EC=2.7.11.24
{ECO:0000269|PubMed:11703092, ECO:0000269|PubMed:16166371, ECO:0000269|PubMed:22308034};
AltName: Full=Stress-activated protein kinase pmk-1; AltName: Full=p38 MAP kinase
1;'
gene_info: Name=pmk-1 {ECO:0000312|WormBase:B0218.3}; ORFNames=B0218.3 {ECO:0000312|WormBase:B0218.3};
organism_full: Caenorhabditis elegans.
protein_family: Belongs to the protein kinase superfamily. CMGC Ser/Thr
protein_domains: Kinase-like_dom_sf. (IPR011009); MAP_kinase. (IPR050117); MAP_kinase_CS.
(IPR003527); MAPK_p38-like. (IPR008352); Prot_kinase_dom. (IPR000719)
provider_config:
timeout: 600
max_retries: 3
parameters:
allowed_domains: []
temperature: 0.1
citation_count: 27

Question

Gene Research for Functional Annotation

⚠️ CRITICAL: Gene/Protein Identification Context

BEFORE YOU BEGIN RESEARCH: You MUST verify you are researching the CORRECT gene/protein. Gene symbols can be ambiguous, especially for less well-characterized genes from non-model organisms.

Target Gene/Protein Identity (from UniProt):

• UniProt Accession: Q17446
• Protein Description: RecName: Full=Mitogen-activated protein kinase pmk-1; EC=2.7.11.24 {ECO:0000269|PubMed:11703092, ECO:0000269|PubMed:16166371, ECO:0000269|PubMed:22308034}; AltName: Full=Stress-activated protein kinase pmk-1; AltName: Full=p38 MAP kinase 1;
• Gene Information: Name=pmk-1 {ECO:0000312|WormBase:B0218.3}; ORFNames=B0218.3 {ECO:0000312|WormBase:B0218.3};
• Organism (full): Caenorhabditis elegans.
• Protein Family: Belongs to the protein kinase superfamily. CMGC Ser/Thr
• Key Domains: Kinase-like_dom_sf. (IPR011009); MAP_kinase. (IPR050117); MAP_kinase_CS. (IPR003527); MAPK_p38-like. (IPR008352); Prot_kinase_dom. (IPR000719)

MANDATORY VERIFICATION STEPS:

1. Check if the gene symbol "pmk-1" matches the protein description above
2. Verify the organism is correct: Caenorhabditis elegans.
3. Check if protein family/domains align with what you find in literature
4. If you find literature for a DIFFERENT gene with the same or similar symbol, STOP

If Gene Symbol is Ambiguous or You Cannot Find Relevant Literature:

DO NOT PROCEED WITH RESEARCH ON A DIFFERENT GENE. Instead:
- State clearly: "The gene symbol 'pmk-1' is ambiguous or literature is limited for this specific protein"
- Explain what you found (e.g., "Found extensive literature on a different gene with the same symbol in a different organism")
- Describe the protein based ONLY on the UniProt information provided above
- Suggest that the protein function can be inferred from domain/family information

Research Target:

Please provide a comprehensive research report on the gene pmk-1 (gene ID: pmk-1, UniProt: Q17446) in worm.

The research report should be a detailed narrative explaining the function, biological processes, and localization of the gene product. Citations should be given for all claims.

You should prioritize authoritative reviews and primary scientific literature when conducting research. You can supplement
this with annotations you find in gene/protein databases, but these can be outdated or inaccurate.

We are specifically interested in the primary function of the gene - for enzymes, what reaction is catalyzed, and what is the substrate specificity? For transporters, what is the substrate? For structural proteins or adapters, what is the broader structural role? For signaling molecules, what is the role in the pathway.

We are interested in where in or outside the cell the gene product carries out its function.

We are also interested in the signaling or biochemical pathways in which the gene functions. We are less interested in broad pleiotropic effects, except where these elucidate the precise role.

Include evidence where possible. We are interested in both experimental evidence as well as inference from structure, evolution, or bioinformatic analysis. Precise studies should be prioritized over high-throughput, where available.

Output

Question: You are an expert researcher providing comprehensive, well-cited information.

Provide detailed information focusing on:
1. Key concepts and definitions with current understanding
2. Recent developments and latest research (prioritize 2023-2024 sources)
3. Current applications and real-world implementations
4. Expert opinions and analysis from authoritative sources
5. Relevant statistics and data from recent studies

Format as a comprehensive research report with proper citations. Include URLs and publication dates where available.
Always prioritize recent, authoritative sources and provide specific citations for all major claims.

Gene Research for Functional Annotation

⚠️ CRITICAL: Gene/Protein Identification Context

BEFORE YOU BEGIN RESEARCH: You MUST verify you are researching the CORRECT gene/protein. Gene symbols can be ambiguous, especially for less well-characterized genes from non-model organisms.

Target Gene/Protein Identity (from UniProt):

• UniProt Accession: Q17446
• Protein Description: RecName: Full=Mitogen-activated protein kinase pmk-1; EC=2.7.11.24 {ECO:0000269|PubMed:11703092, ECO:0000269|PubMed:16166371, ECO:0000269|PubMed:22308034}; AltName: Full=Stress-activated protein kinase pmk-1; AltName: Full=p38 MAP kinase 1;
• Gene Information: Name=pmk-1 {ECO:0000312|WormBase:B0218.3}; ORFNames=B0218.3 {ECO:0000312|WormBase:B0218.3};
• Organism (full): Caenorhabditis elegans.
• Protein Family: Belongs to the protein kinase superfamily. CMGC Ser/Thr
• Key Domains: Kinase-like_dom_sf. (IPR011009); MAP_kinase. (IPR050117); MAP_kinase_CS. (IPR003527); MAPK_p38-like. (IPR008352); Prot_kinase_dom. (IPR000719)

MANDATORY VERIFICATION STEPS:

1. Check if the gene symbol "pmk-1" matches the protein description above
2. Verify the organism is correct: Caenorhabditis elegans.
3. Check if protein family/domains align with what you find in literature
4. If you find literature for a DIFFERENT gene with the same or similar symbol, STOP

If Gene Symbol is Ambiguous or You Cannot Find Relevant Literature:

DO NOT PROCEED WITH RESEARCH ON A DIFFERENT GENE. Instead:
- State clearly: "The gene symbol 'pmk-1' is ambiguous or literature is limited for this specific protein"
- Explain what you found (e.g., "Found extensive literature on a different gene with the same symbol in a different organism")
- Describe the protein based ONLY on the UniProt information provided above
- Suggest that the protein function can be inferred from domain/family information

Research Target:

Please provide a comprehensive research report on the gene pmk-1 (gene ID: pmk-1, UniProt: Q17446) in worm.

The research report should be a detailed narrative explaining the function, biological processes, and localization of the gene product. Citations should be given for all claims.

You should prioritize authoritative reviews and primary scientific literature when conducting research. You can supplement
this with annotations you find in gene/protein databases, but these can be outdated or inaccurate.

We are specifically interested in the primary function of the gene - for enzymes, what reaction is catalyzed, and what is the substrate specificity? For transporters, what is the substrate? For structural proteins or adapters, what is the broader structural role? For signaling molecules, what is the role in the pathway.

We are interested in where in or outside the cell the gene product carries out its function.

We are also interested in the signaling or biochemical pathways in which the gene functions. We are less interested in broad pleiotropic effects, except where these elucidate the precise role.

Include evidence where possible. We are interested in both experimental evidence as well as inference from structure, evolution, or bioinformatic analysis. Precise studies should be prioritized over high-throughput, where available.

Plan and verification
- Target identity: pmk-1 encodes the C. elegans p38-class mitogen-activated protein kinase PMK-1 (EC 2.7.11.24), a CMGC Ser/Thr protein kinase that functions in canonical MAPK cascades; it is activated by dual phosphorylation in the activation loop and transduces stress and innate immunity signals. This matches the UniProt record (Q17446) and literature referring to PMK-1 as the C. elegans p38 MAPK ortholog. Organism is Caenorhabditis elegans. The upstream MAP3K→MAP2K→MAPK module (NSY-1→SEK-1→PMK-1) and TIR-1/SARM adaptor are consistently reported, aligning with MAP_kinase and p38-like domain annotations. No conflicting gene symbol usage from other organisms is used in this report. (raj2023cisplatintoxicityis pages 1-2, hajdu2024modelinghost–pathogeninteractions pages 6-7, ding2023salmonellaentericaserovar pages 1-2)

Comprehensive research report on pmk-1 (C. elegans; UniProt Q17446)

1) Key concepts and definitions
- Molecular identity and catalytic activity: PMK-1 is the p38 MAP kinase ortholog in C. elegans; as a Ser/Thr kinase (EC 2.7.11.24), it is activated by upstream MAP2K SEK-1 and phosphorylates downstream transcription factors to regulate innate immunity and stress responses. PMK-1 signaling canonically proceeds via TIR-1 (TIR-domain adaptor) → NSY-1 (MAP3K) → SEK-1 (MAP2K) → PMK-1 (MAPK). (Raj et al., Nature Communications, 2023-05-20; DOI: https://doi.org/10.1038/s41467-023-38568-5) (raj2023cisplatintoxicityis pages 1-2, raj2023cisplatintoxicityis pages 4-7)
- Upstream activators and sensors: Pathogen- and damage-associated signals can engage TIR-1/SARM, with additional inputs from organelle stress (e.g., IRE-1/TRF-1 axis), lysosome-related organelles, and lipid/nutrient cues that converge on the NSY-1→SEK-1→PMK-1 module. (Raj et al., 2023-05-20, https://doi.org/10.1038/s41467-023-38568-5; Hajdú et al., IJMS, 2024-06-27, https://doi.org/10.3390/ijms25137034) (raj2023cisplatintoxicityis pages 1-2, hajdu2024modelinghost–pathogeninteractions pages 6-7)
- Downstream substrates/effectors: PMK-1 phosphorylates ATF-7 to switch it from a repressor to an activator of immune effector genes; it also controls SKN-1/Nrf2-mediated oxidative stress/detoxification programs under some contexts. Multiple bZIP factors integrate with PMK-1, including ZIP-10/BATF3 as a negative regulator of PMK-1 signaling. (Raj et al., 2023-05-20, https://doi.org/10.1038/s41467-023-38568-5; Afridi et al., International Immunology, 2023-11-15, https://doi.org/10.1093/intimm/dxac053) (raj2023cisplatintoxicityis pages 1-2, afridi2023thebziptranscription pages 1-2, afridi2023thebziptranscription pages 15-15)
- Tissues and subcellular/localization context: PMK-1 signaling is prominent in the intestinal epithelium for innate defense and stress tolerance; epidermal immune responses to cuticle/collagen damage can be partly PMK-1-dependent; PMK-1 also participates in non-autonomous circuits affecting other tissues via neuroendocrine and germline-intestinal axes. (Raj et al., 2023-05-20, https://doi.org/10.1038/s41467-023-38568-5; Zhu et al., Cells, 2023-09-06, https://doi.org/10.3390/cells12182223; Zhang et al., Frontiers in Immunology, 2023-10-19, https://doi.org/10.3389/fimmu.2023.1249436; Hajdú et al., 2024-06-27, https://doi.org/10.3390/ijms25137034) (raj2023cisplatintoxicityis pages 1-2, zhu2023c.eleganshemidesmosomes pages 1-2, zhu2023c.eleganshemidesmosomes pages 2-4, zhang2023agonadalgap pages 1-2, zhang2023agonadalgap pages 2-4, hajdu2024modelinghost–pathogeninteractions pages 6-7)
- Core biological roles: PMK-1 drives transcriptional programs of innate immunity (lysozymes, C-type lectins, AMPs), integrates oxidative/ER/lysosomal stress signals, and contributes to pathogen resistance and toxin resilience. (Raj et al., 2023-05-20, https://doi.org/10.1038/s41467-023-38568-5; Ding et al., Frontiers in Immunology, 2023-04-12, https://doi.org/10.3389/fimmu.2023.1118003; Hajdú et al., 2024-06-27, https://doi.org/10.3390/ijms25137034) (raj2023cisplatintoxicityis pages 4-7, ding2023salmonellaentericaserovar pages 1-2, hajdu2024modelinghost–pathogeninteractions pages 6-7)

2) Recent developments and latest research (priority 2023–2024)
- Cisplatin resilience via intestinal PMK-1/ATF-7: In adult post-mitotic C. elegans, cisplatin exposure (e.g., 300 μg/mL; 6–24 h) induces ROS and activates PMK-1 and ATF-7; mutants in tir-1, nsy-1, sek-1, or pmk-1 are hypersensitive (LD50 shift; sek-1(km4) LD50 ~150 μg/mL, ~3.5× lower than WT). IRE-1 and TRF-1 act upstream of PMK-1 in a UPRER-independent route. Proteomics showed innate immune proteins are the most enriched induced class (>160 proteins). Conclusion: innate immune arm via PMK-1→ATF-7 is pivotal for cisplatin resilience in adults. (Nature Communications, 2023-05-20, https://doi.org/10.1038/s41467-023-38568-5) (raj2023cisplatintoxicityis pages 2-4, raj2023cisplatintoxicityis pages 1-2, raj2023cisplatintoxicityis pages 4-7)
- Epidermal collagen damage sensing: C. elegans hemidesmosomes sense specific cuticle collagen damage; DPY-collagen substructures and BLI-1 interacting with MUP-4 disengage upon damage, releasing STA-2 to drive AMP genes. Loss of PMK-1 partially suppresses nlp-29 induction in dpy mutants, indicating a partial dependence of epidermal AMP induction on p38/PMK-1. (Cells, 2023-09-06, https://doi.org/10.3390/cells12182223) (zhu2023c.eleganshemidesmosomes pages 1-2, zhu2023c.eleganshemidesmosomes pages 2-4)
- Intestinal lysosome–PMK-1 crosstalk governed by gonadal signaling: A germline gap junction INX-14/Notch GLP-1 axis suppresses intestinal defense by acting through an intestinal lysosome pathway upstream of PMK-1; inx-14 or glp-1 disruption enhances PA14 resistance, reduces gut colonization, and upregulates lysosome and PMK-1 pathway genes. Tissue-specific RNAi pinpoints the germline as the site of inx-14 action affecting intestinal PMK-1. (Frontiers in Immunology, 2023-10-19, https://doi.org/10.3389/fimmu.2023.1249436) (zhang2023agonadalgap pages 1-2, zhang2023agonadalgap pages 2-4)
- Diet/probiotic/peptide modulation: An antimicrobial peptide (2K4L) reduces bacterial burden and inflammation and downregulates PMK-1 phosphorylation and “core gene” expression in the p38/PMK-1 pathway in worms infected with A. baumannii, improving worm survival; this links anti-infective interventions to PMK-1 pathway attenuation under certain pathogen contexts. (Scientific Reports, 2024-07-09, https://doi.org/10.1038/s41598-024-64511-9) (ji2024antimicrobialpeptide2k4l pages 1-2, ji2024antimicrobialpeptide2k4l pages 2-4)
- Pathogen models beyond PA14: Salmonella Paratyphi A infection engages tir-1, nsy-1, sek-1, pmk-1, mpk-1, skn-1 and insulin pathway components; pmk-1(km25) is used as a sensitized background confirming PMK-1’s role in defense and oxidative stress responses. (Frontiers in Immunology, 2023-04-12, https://doi.org/10.3389/fimmu.2023.1118003) (ding2023salmonellaentericaserovar pages 1-2)
- Integrative reviews underscore lysosome-related organelles (LROs) and metabolic cues (cholesterol status) as inputs to TIR-1/NSY-1/SEK-1/PMK-1 and emphasize cross-talk with UPRER and insulin signaling. (IJMS review, 2024-06-27, https://doi.org/10.3390/ijms25137034) (hajdu2024modelinghost–pathogeninteractions pages 6-7)

3) Current applications and real-world implementations
- Chemotherapy toxicity modeling: Adult C. elegans lacking proliferative somatic cells offer a model for post-mitotic tissue responses to cisplatin; PMK-1/ATF-7 activation and its upstream IRE-1/TRF-1 link provide a platform for screening modulators of chemo-toxicity resilience and innate immune proteome remodeling. (Nature Communications, 2023-05-20, https://doi.org/10.1038/s41467-023-38568-5) (raj2023cisplatintoxicityis pages 4-7)
- Innate immunity and barrier damage sensing: The epidermal collagen-damage sensor that partially requires PMK-1 supports the use of C. elegans to dissect epithelial DAMP surveillance and AMP regulation mechanisms with potential parallels in skin/mucosal immunity. (Cells, 2023-09-06, https://doi.org/10.3390/cells12182223) (zhu2023c.eleganshemidesmosomes pages 1-2, zhu2023c.eleganshemidesmosomes pages 2-4)
- Host–microbe and lysosome signaling axes: The INX-14/GLP-1→lysosome→PMK-1 pathway demonstrates how reproductive tissues non-autonomously tune intestinal immunity, informing studies on neuroendocrine and gonadal regulation of mucosal defense. (Frontiers in Immunology, 2023-10-19, https://doi.org/10.3389/fimmu.2023.1249436) (zhang2023agonadalgap pages 1-2, zhang2023agonadalgap pages 2-4)
- Anti-infective discovery: AMPs and other interventions altering PMK-1 activity (e.g., 2K4L attenuating PMK-1 phosphorylation in infection) can be read out in C. elegans survival and colonization assays, bridging to mammalian models. (Scientific Reports, 2024-07-09, https://doi.org/10.1038/s41598-024-64511-9) (ji2024antimicrobialpeptide2k4l pages 1-2, ji2024antimicrobialpeptide2k4l pages 2-4)

4) Expert opinions and analysis from authoritative sources
- Nature Communications 2023 emphasizes that in adult post-mitotic worms, the innate immune branch via PMK-1→ATF-7, triggered upstream by IRE-1/TRF-1 and the canonical NSY-1→SEK-1 module, is more critical for cisplatin resilience than SKN-1-dependent detoxification, reframing PMK-1’s role in chemotherapy stress. (2023-05-20, https://doi.org/10.1038/s41467-023-38568-5) (raj2023cisplatintoxicityis pages 1-2, raj2023cisplatintoxicityis pages 4-7)
- International Immunology 2023 identifies a conserved suppressive bZIP factor (BATF3/ZIP-10) that attenuates PMK-1-dependent immunity, highlighting transcriptional checkpoints that tune p38 signaling intensity during infection. (2023-11-15, https://doi.org/10.1093/intimm/dxac053) (afridi2023thebziptranscription pages 1-2, afridi2023thebziptranscription pages 15-15)
- IJMS 2024 review synthesizes PMK-1’s integration with organelle stress (lysosome/LROs, ER) and endocrine cues, and its tissue focus in the intestine, consolidating the model that PMK-1 is a central node for surveillance immunity and metabolic state coupling. (2024-06-27, https://doi.org/10.3390/ijms25137034) (hajdu2024modelinghost–pathogeninteractions pages 6-7)

5) Relevant statistics and quantitative data (recent studies)
- Cisplatin responses: sek-1(km4) LD50 ~150 μg/mL cisplatin vs higher WT LD50 (~3.5× difference); proteomics after 6 h at 300 μg/mL identified 3,586 proteins with significant changes (FDR < 0.05), including 121 upregulated >2-fold and 158 downregulated <−2-fold, with innate immune proteins the most enriched category; MitoTempo reduces cisplatin-induced PMK-1 phosphorylation; somatic depletion of SEK-1 (auxin 1 mM, 2 h) reduces p-PMK-1 and survival. (Nature Communications, 2023-05-20, https://doi.org/10.1038/s41467-023-38568-5) (raj2023cisplatintoxicityis pages 1-2, raj2023cisplatintoxicityis pages 4-7)
- Epidermal collagen damage: Loss of PMK-1 partially suppresses Pnlp-29::GFP elevation in dpy collagen mutants, consistent with partial PMK-1 dependence of AMP induction; epidermal AMP families include NLPs and CNCs, which are under p38/PMK-1 and/or TGF-β control depending on the stimulus. (Cells, 2023-09-06, https://doi.org/10.3390/cells12182223) (zhu2023c.eleganshemidesmosomes pages 1-2, zhu2023c.eleganshemidesmosomes pages 2-4)
- Germline–intestine axis: inx-14(ag17) mutants show significantly longer survival on PA14; germline-specific inx-14 RNAi phenocopies resistance, while intestine-, neuron-, muscle-, or hypodermis-specific inx-14 RNAi do not; PA14::GFP gut accumulation and CFU counts are reduced in inx-14 mutants; germline expression of inx-14 rescues susceptibility. (Frontiers in Immunology, 2023-10-19, https://doi.org/10.3389/fimmu.2023.1249436) (zhang2023agonadalgap pages 1-2, zhang2023agonadalgap pages 2-4)
- Antimicrobial peptide 2K4L intervention: In infected worms, intestinal CFU reduced by ~77.3% within 6 h after 2K4L treatment; lifespan improved under A. baumannii exposure; biochemical readouts show reduced PMK-1 phosphorylation and decreased expression of PMK-1 pathway “core genes.” (Scientific Reports, 2024-07-09, https://doi.org/10.1038/s41598-024-64511-9) (ji2024antimicrobialpeptide2k4l pages 2-4, ji2024antimicrobialpeptide2k4l pages 1-2)
- Salmonella Paratyphi A infection: Genetic dependency on tir-1, nsy-1, sek-1, pmk-1, mpk-1, skn-1, daf-2, and daf-16; pmk-1(km25) allele used to demonstrate sensitivity; infection increases oxidative stress as measured by H2O2 assays; qRT-PCR confirms immune gene regulation pattern. (Frontiers in Immunology, 2023-04-12, https://doi.org/10.3389/fimmu.2023.1118003) (ding2023salmonellaentericaserovar pages 1-2)

Pathways and mechanistic synthesis
- Canonical cascade: TIR-1/SARM1 (often localized to lysosome-related organelles upon specific stresses) activates NSY-1 (MAP3K), which activates SEK-1 (MAP2K) to phosphorylate and activate PMK-1 (p38 MAPK). Activated PMK-1 phosphorylates ATF-7 to induce innate immune effectors (lysozymes, C-type lectins, AMPs) and can engage SKN-1 under oxidative stress. (Hajdú et al., 2024-06-27, https://doi.org/10.3390/ijms25137034; Raj et al., 2023-05-20, https://doi.org/10.1038/s41467-023-38568-5; Ding et al., 2023-04-12, https://doi.org/10.3389/fimmu.2023.1118003) (hajdu2024modelinghost–pathogeninteractions pages 6-7, raj2023cisplatintoxicityis pages 1-2, ding2023salmonellaentericaserovar pages 1-2)
- Tissue specificity: Intestine is the principal effector tissue; epidermis uses a damage-sensing hemidesmosome/collagen mechanism that can partially recruit PMK-1; germline signals (INX-14/GLP-1) modulate intestinal lysosome signaling that funnels into PMK-1 activation state. (Raj et al., 2023-05-20, https://doi.org/10.1038/s41467-023-38568-5; Zhu et al., 2023-09-06, https://doi.org/10.3390/cells12182223; Zhang et al., 2023-10-19, https://doi.org/10.3389/fimmu.2023.1249436) (raj2023cisplatintoxicityis pages 1-2, zhu2023c.eleganshemidesmosomes pages 1-2, zhu2023c.eleganshemidesmosomes pages 2-4, zhang2023agonadalgap pages 1-2, zhang2023agonadalgap pages 2-4)
- Context dependence: Under cisplatin stress in adults, innate immune outputs via ATF-7 dominate resilience, whereas SKN-1 detoxification can be dispensable or even inversely related to survival; under microbial infection, PMK-1 coordinates with SKN-1 and DAF-16 depending on pathogen and stress type. (Raj et al., 2023-05-20, https://doi.org/10.1038/s41467-023-38568-5; Ding et al., 2023-04-12, https://doi.org/10.3389/fimmu.2023.1118003; Hajdú et al., 2024-06-27, https://doi.org/10.3390/ijms25137034) (raj2023cisplatintoxicityis pages 1-2, raj2023cisplatintoxicityis pages 4-7, ding2023salmonellaentericaserovar pages 1-2, hajdu2024modelinghost–pathogeninteractions pages 6-7)
- Transcriptional regulation: ATF-7 is a direct PMK-1 substrate switching from repression to activation upon phosphorylation; PMK-1 activity is itself modulated by bZIP repressors like ZIP-10/BATF3, integrating small RNA and metabolic signals to tune defense intensity. (Afridi et al., 2023-11-15, https://doi.org/10.1093/intimm/dxac053) (afridi2023thebziptranscription pages 1-2, afridi2023thebziptranscription pages 15-15)

Conclusions and outlook
PMK-1 (Q17446) is a prototypical p38 MAPK in C. elegans that integrates danger signals from pathogens, toxins, and tissue damage to orchestrate innate immune and stress-protective programs, primarily in the intestine but also in epidermal and inter-tissue circuits. Recent work (2023–2024) reveals: (i) a central role for PMK-1→ATF-7 in adult cisplatin resilience; (ii) epidermal collagen damage sensing where PMK-1 partially contributes to AMP induction; (iii) a germline INX-14/GLP-1→lysosome→PMK-1 axis controlling gut defense; and (iv) diet/anti-infective interventions that modulate PMK-1 phosphorylation and target gene expression in vivo. These findings refine pathway topology (additional upstream IRE-1/TRF-1 and lysosome cues) and underscore PMK-1 as a tractable node for screening therapeutics that modulate innate immunity and stress tolerance. (raj2023cisplatintoxicityis pages 1-2, raj2023cisplatintoxicityis pages 4-7, zhu2023c.eleganshemidesmosomes pages 1-2, zhu2023c.eleganshemidesmosomes pages 2-4, zhang2023agonadalgap pages 1-2, zhang2023agonadalgap pages 2-4, ji2024antimicrobialpeptide2k4l pages 1-2, ji2024antimicrobialpeptide2k4l pages 2-4, hajdu2024modelinghost–pathogeninteractions pages 6-7, ding2023salmonellaentericaserovar pages 1-2, afridi2023thebziptranscription pages 1-2, afridi2023thebziptranscription pages 15-15)

References

1. (raj2023cisplatintoxicityis pages 1-2): Dorota Raj, Bashar Kraish, Jari Martikainen, Agnieszka Podraza-Farhanieh, Gautam Kao, and Peter Naredi. Cisplatin toxicity is counteracted by the activation of the p38/atf-7 signaling pathway in post-mitotic c. elegans. Nature Communications, May 2023. URL: https://doi.org/10.1038/s41467-023-38568-5, doi:10.1038/s41467-023-38568-5. This article has 12 citations and is from a highest quality peer-reviewed journal.

2. (hajdu2024modelinghost–pathogeninteractions pages 6-7): Gábor Hajdú, Csenge Szathmári, and Csaba Sőti. Modeling host–pathogen interactions in c. elegans: lessons learned from pseudomonas aeruginosa infection. International Journal of Molecular Sciences, 25:7034, Jun 2024. URL: https://doi.org/10.3390/ijms25137034, doi:10.3390/ijms25137034. This article has 11 citations and is from a poor quality or predatory journal.

3. (ding2023salmonellaentericaserovar pages 1-2): Ai-Jun Ding, Wei-Ming Zhang, Jian Tao, Bing Chen, Xiao-Cao Liu, Yu Dong, Han-Jing Ma, Shao-Dong Pan, Jiang-Bo He, and Wei-Kun Zeng. Salmonella enterica serovar paratyphi a-induced immune response in caenorhabditis elegans depends on mapk pathways and daf-16. Frontiers in Immunology, Apr 2023. URL: https://doi.org/10.3389/fimmu.2023.1118003, doi:10.3389/fimmu.2023.1118003. This article has 3 citations and is from a peer-reviewed journal.

4. (raj2023cisplatintoxicityis pages 4-7): Dorota Raj, Bashar Kraish, Jari Martikainen, Agnieszka Podraza-Farhanieh, Gautam Kao, and Peter Naredi. Cisplatin toxicity is counteracted by the activation of the p38/atf-7 signaling pathway in post-mitotic c. elegans. Nature Communications, May 2023. URL: https://doi.org/10.1038/s41467-023-38568-5, doi:10.1038/s41467-023-38568-5. This article has 12 citations and is from a highest quality peer-reviewed journal.

5. (afridi2023thebziptranscription pages 1-2): Muhammad Irfan Afridi, Zhongfan Zheng, Junqiang Liu, Lijuan Liu, Shan Zhang, Zhaozhong Zhu, Yousong Peng, Desheng Zhou, and Haijun Tu. The bzip transcription factor batf3/zip-10 suppresses innate immunity by attenuating pmk-1/p38 signaling. International immunology, 35:181-196, Nov 2023. URL: https://doi.org/10.1093/intimm/dxac053, doi:10.1093/intimm/dxac053. This article has 9 citations and is from a peer-reviewed journal.

6. (afridi2023thebziptranscription pages 15-15): Muhammad Irfan Afridi, Zhongfan Zheng, Junqiang Liu, Lijuan Liu, Shan Zhang, Zhaozhong Zhu, Yousong Peng, Desheng Zhou, and Haijun Tu. The bzip transcription factor batf3/zip-10 suppresses innate immunity by attenuating pmk-1/p38 signaling. International immunology, 35:181-196, Nov 2023. URL: https://doi.org/10.1093/intimm/dxac053, doi:10.1093/intimm/dxac053. This article has 9 citations and is from a peer-reviewed journal.

7. (zhu2023c.eleganshemidesmosomes pages 1-2): Yi Zhu, Wenna Li, Yifang Dong, Chujie Xia, and Rong Fu. C. elegans hemidesmosomes sense collagen damage to trigger innate immune response in the epidermis. Cells, 12:2223, Sep 2023. URL: https://doi.org/10.3390/cells12182223, doi:10.3390/cells12182223. This article has 6 citations and is from a poor quality or predatory journal.

8. (zhu2023c.eleganshemidesmosomes pages 2-4): Yi Zhu, Wenna Li, Yifang Dong, Chujie Xia, and Rong Fu. C. elegans hemidesmosomes sense collagen damage to trigger innate immune response in the epidermis. Cells, 12:2223, Sep 2023. URL: https://doi.org/10.3390/cells12182223, doi:10.3390/cells12182223. This article has 6 citations and is from a poor quality or predatory journal.

9. (zhang2023agonadalgap pages 1-2): Xiumei Zhang, Yirong Wang, Zixin Cai, Zhiqing Wan, Yilixiati Aihemaiti, and Haijun Tu. A gonadal gap junction inx-14/notch glp-1 signaling axis suppresses gut defense through an intestinal lysosome pathway. Frontiers in Immunology, Oct 2023. URL: https://doi.org/10.3389/fimmu.2023.1249436, doi:10.3389/fimmu.2023.1249436. This article has 4 citations and is from a peer-reviewed journal.

10. (zhang2023agonadalgap pages 2-4): Xiumei Zhang, Yirong Wang, Zixin Cai, Zhiqing Wan, Yilixiati Aihemaiti, and Haijun Tu. A gonadal gap junction inx-14/notch glp-1 signaling axis suppresses gut defense through an intestinal lysosome pathway. Frontiers in Immunology, Oct 2023. URL: https://doi.org/10.3389/fimmu.2023.1249436, doi:10.3389/fimmu.2023.1249436. This article has 4 citations and is from a peer-reviewed journal.

11. (raj2023cisplatintoxicityis pages 2-4): Dorota Raj, Bashar Kraish, Jari Martikainen, Agnieszka Podraza-Farhanieh, Gautam Kao, and Peter Naredi. Cisplatin toxicity is counteracted by the activation of the p38/atf-7 signaling pathway in post-mitotic c. elegans. Nature Communications, May 2023. URL: https://doi.org/10.1038/s41467-023-38568-5, doi:10.1038/s41467-023-38568-5. This article has 12 citations and is from a highest quality peer-reviewed journal.

12. (ji2024antimicrobialpeptide2k4l pages 1-2): Fangyu Ji, Guoxu Tian, and Dejing Shang. Antimicrobial peptide 2k4l inhibits the inflammatory response in macrophages and caenorhabditis elegans and protects against lps-induced septic shock in mice. Scientific Reports, Jul 2024. URL: https://doi.org/10.1038/s41598-024-64511-9, doi:10.1038/s41598-024-64511-9. This article has 1 citations and is from a peer-reviewed journal.

13. (ji2024antimicrobialpeptide2k4l pages 2-4): Fangyu Ji, Guoxu Tian, and Dejing Shang. Antimicrobial peptide 2k4l inhibits the inflammatory response in macrophages and caenorhabditis elegans and protects against lps-induced septic shock in mice. Scientific Reports, Jul 2024. URL: https://doi.org/10.1038/s41598-024-64511-9, doi:10.1038/s41598-024-64511-9. This article has 1 citations and is from a peer-reviewed journal.

Citations

1. ding2023salmonellaentericaserovar pages 1-2
2. raj2023cisplatintoxicityis pages 4-7
3. raj2023cisplatintoxicityis pages 1-2
4. afridi2023thebziptranscription pages 1-2
5. afridi2023thebziptranscription pages 15-15
6. zhang2023agonadalgap pages 1-2
7. zhang2023agonadalgap pages 2-4
8. raj2023cisplatintoxicityis pages 2-4
9. https://doi.org/10.1038/s41467-023-38568-5
10. https://doi.org/10.1038/s41467-023-38568-5;
11. https://doi.org/10.3390/ijms25137034
12. https://doi.org/10.1093/intimm/dxac053
13. https://doi.org/10.3390/cells12182223;
14. https://doi.org/10.3389/fimmu.2023.1249436;
15. https://doi.org/10.3389/fimmu.2023.1118003;
16. https://doi.org/10.3390/cells12182223
17. https://doi.org/10.3389/fimmu.2023.1249436
18. https://doi.org/10.1038/s41598-024-64511-9
19. https://doi.org/10.3389/fimmu.2023.1118003
20. https://doi.org/10.3390/ijms25137034;
21. https://doi.org/10.1038/s41467-023-38568-5,
22. https://doi.org/10.3390/ijms25137034,
23. https://doi.org/10.3389/fimmu.2023.1118003,
24. https://doi.org/10.1093/intimm/dxac053,
25. https://doi.org/10.3390/cells12182223,
26. https://doi.org/10.3389/fimmu.2023.1249436,
27. https://doi.org/10.1038/s41598-024-64511-9,

BioReason-Pro RL Review: pmk-1 (C. elegans)

Source: pmk-1-deep-research-bioreason-rl.md

• Correctness: 4/5
• Completeness: 2/5

Functional Summary Review

The BioReason functional summary states:

A soluble signaling kinase in nematode that uses an ATP-dependent catalytic core to phosphorylate downstream targets within a mitogen-activated signaling cascade. Its MAP kinase architecture enables activation by phosphorylation and docking-driven substrate recognition, thereby propagating intracellular signals that regulate pathway outputs. The enzyme most plausibly functions in the cytoplasm where signaling modules and scaffolds concentrate it, with transient access to nuclear effectors through its pathway.

This summary correctly identifies PMK-1 as a MAP kinase with ATP-dependent phosphorylation activity, MAPK cascade membership, and cytoplasmic localization with nuclear access. These features align with the curated annotations:

• Protein serine/threonine kinase activity (GO:0004674) and MAP kinase activity (GO:0004707)
• MAPK cascade (GO:0000165) and p38 MAPK cascade (GO:0038066)
• Cytosol (GO:0005829) and nucleus (GO:0005634) localization
• Activation by dual phosphorylation and substrate docking

The description of "activation by phosphorylation" correctly matches the dual phosphorylation on Thr-191 and Tyr-193 by upstream MAPKK SEK-1.

The correctness score is slightly reduced because the summary refers to "mitogen-activated signaling" without specifying that PMK-1 is specifically a p38-type stress-activated MAPK, not a mitogenic ERK-type MAPK. The HOG-like family assignment (IPR008352) correctly points to stress-activated rather than mitogenic signaling.

Major missing aspects:

• PMK-1 is the C. elegans p38 MAPK ortholog, central to innate immunity
• The TIR-1-NSY-1-SEK-1-PMK-1 signaling cascade
• Specific substrates: SKN-1 (nuclear translocation during oxidative stress) and ATF-7 (repressor-to-activator switch)
• Defense against Gram-negative/positive bacteria, fungal pathogens, and environmental stresses
• Role in oxidative stress response and osmotic stress

Comparison with interpro2go:

The interpro2go annotation (GO_REF:0000002) assigns GO:0004672 (protein kinase activity). BioReason goes beyond this by correctly identifying MAP kinase activity and MAPK cascade participation from the family-level annotations (IPR008352, IPR050117, IPR003527). However, it does not reach the specificity of the curated review, which identifies the p38 subfamily and innate immunity context.

Notes on thinking trace

The trace provides a competent analysis of the MAPK domain architecture and correctly infers activation-loop phosphorylation and docking-groove-mediated substrate recognition. The mention of "stress or developmental signaling" is appropriate for the HOG-like family but insufficiently specific. The trace does not identify the innate immune context that dominates PMK-1 biology.