ppgn-1

UniProt ID: G5EDB6
Organism: Caenorhabditis elegans
Review Status: DRAFT
πŸ“ Provide Detailed Feedback

Gene Description

ppgn-1 (Y38F2AR.7) encodes the Caenorhabditis elegans paraplegin-subfamily subunit of the mitochondrial m-AAA protease, an ATP-dependent proteolytic machine embedded in the inner mitochondrial membrane. The protein has the diagnostic two-module architecture of this family: an N-terminal AAA+ ATPase module that uses ATP binding and hydrolysis to unfold and translocate substrates, and a C-terminal M41 (FtsH-type) zinc-metallopeptidase module that cleaves peptide bonds; the catalytic residues of both modules (Walker A P-loop GPPGCGKT, Walker B IIYIDE, and the HExxH zinc-binding motif HEAGH) are intact in the ppgn-1 sequence. It is predicted to be an integral, multi-pass inner-membrane protein with matrix-facing catalytic domains and an N-terminal mitochondrial targeting region. Within the conserved m-AAA complex, family members carry out two coupled activities: quality-control degradation of misfolded or unassembled inner-membrane proteins, and regulated proteolytic maturation of specific substrates (the paradigm being processing of the ribosomal protein MrpL32 to control mitochondrial ribosome assembly and translation). The orthologous human subunit is paraplegin (SPG7), whose loss causes autosomal-recessive hereditary spastic paraplegia. The specific in vivo role, substrates, and complex partners of ppgn-1 in C. elegans have not been experimentally determined; C. elegans additionally carries the well-studied AFG3L2-type m-AAA subunit spg-7.

Existing Annotations Review

GO Term Evidence Action Reason
GO:0034982 mitochondrial protein processing
IBA
GO_REF:0000033
ACCEPT
Summary: Phylogenetic (IBA) propagation of the conserved m-AAA processing role from paraplegin/AFG3L2 orthologs. Consistent with ppgn-1's intact M41 protease domain and the family paradigm of regulated substrate maturation (e.g. MrpL32). Retained as a core function, with the caveat that no C. elegans substrate has been shown.
Reason: ppgn-1 is a clear paraplegin-subfamily m-AAA subunit (PANTHER PTHR43655:SF8) with a complete M41 zinc-peptidase module (HExxH motif HEAGH intact at residue 555), so the conserved processing activity is appropriately propagated. The direct substrate in the worm is unknown (see knowledge_gaps).
Supporting Evidence:
PMID:16239145
The mitochondrial ribosomal protein MrpL32 is processed by the m-AAA protease, allowing its association with preassembled ribosomal particles and completion of ribosome assembly in close proximity to the inner membrane.
GO:0005745 m-AAA complex
IBA
GO_REF:0000033
ACCEPT
Summary: IBA propagation that ppgn-1 is a subunit of the inner-membrane m-AAA protease complex. Well supported by orthology to paraplegin (a conserved m-AAA subunit) and by the shared two-module (AAA+ + M41) architecture. Core.
Reason: Paraplegin is a conserved subunit of the m-AAA complex; ppgn-1 is its C. elegans ortholog. The specific composition of the worm complex (homo-oligomer vs hetero-oligomer with the AFG3L2-type subunit spg-7) is not experimentally established.
Supporting Evidence:
PMID:16647881
paraplegin, which is a conserved subunit of the ubiquitous and ATP-dependent m-AAA protease in mitochondria.
GO:0004222 metalloendopeptidase activity
IBA
GO_REF:0000033
ACCEPT
Summary: IBA propagation of zinc-dependent endopeptidase activity from the family. Directly corroborated for the ppgn-1 sequence by the intact M41 HExxH zinc-binding catalytic motif (HEAGH at residue 555, within the Peptidase_M41 domain). Core molecular function.
Reason: The C-terminal M41 peptidase domain (InterPro IPR000642) and the intact HExxH motif support metalloendopeptidase chemistry for this specific protein, not merely by family membership.
Supporting Evidence:
PMID:9635427
Paraplegin is highly homologous to the yeast mitochondrial ATPases, AFG3, RCA1, and YME1, which have both proteolytic and chaperon-like activities at the inner mitochondrial membrane.
GO:0004176 ATP-dependent peptidase activity
IEA
GO_REF:0000002
ACCEPT
Summary: InterPro (IEA) assignment of ATP-dependent peptidase activity. This is the most complete single molecular-function term for an m-AAA protease because it captures the coupling of the AAA+ ATPase to the M41 peptidase. Supported by the intact Walker A/B (GPPGCGKT, IIYIDE) and HExxH motifs in the ppgn-1 sequence. Core.
Reason: ppgn-1 has both an intact AAA+ ATPase module (Walker A GPPGCGKT at 325, Walker B IIYIDE at 380) and an intact M41 peptidase module (HExxH at 555), the defining combination for ATP-dependent proteolysis.
Supporting Evidence:
PMID:16239145
AAA proteases comprise a conserved family of membrane bound ATP-dependent proteases that ensures the quality control of mitochondrial inner-membrane proteins.
GO:0004222 metalloendopeptidase activity
IEA
GO_REF:0000002
ACCEPT
Summary: Second annotation of metalloendopeptidase activity, here from the InterPro M41 signature (IEA). Same well-supported molecular function as the IBA annotation above; kept as a corroborating electronic assignment.
Reason: Redundant with the IBA metalloendopeptidase annotation but independently supported by the InterPro Peptidase_M41 signature (IPR000642) and the intact HExxH motif.
GO:0005524 ATP binding
IEA
GO_REF:0000002
ACCEPT
Summary: InterPro (IEA) assignment of ATP binding, an activity of the AAA+ module. Corroborated by the intact Walker A P-loop (GPPGCGKT at residue 325) in the ppgn-1 sequence. A component activity of the ATP-dependent protease.
Reason: The N-terminal AAA+ ATPase domain (SMART SM00382; InterPro IPR003959) with an intact Walker A motif provides a direct structural basis for ATP binding.
GO:0005739 mitochondrion
IEA
GO_REF:0000044
KEEP AS NON CORE
Summary: Subcellular-location mapping (IEA) to mitochondrion. Correct but non-specific: the family resides in the inner mitochondrial membrane, captured more precisely in core_functions (GO:0005743). Retained but marked non-core because it is a generic parent of the informative location.
Reason: Consistent with the orthologous localization (paraplegin localizes to mitochondria) and with two predicted TM helices; the more informative term is mitochondrial inner membrane, so this generic term is not the core localization statement.
Supporting Evidence:
PMID:9635427
Immunofluorescence analysis and import experiments showed that Paraplegin localizes to mitochondria.
GO:0006508 proteolysis
IEA
GO_REF:0000002
KEEP AS NON CORE
Summary: InterPro (IEA) generic proteolysis term. Correct but uninformative: the specific biological roles (protein quality-control degradation and mitochondrial protein processing) are captured in core_functions. Retained as a non-core parent term.
Reason: GO:0006508 is a high-level parent of the specific m-AAA processes; it is not wrong, but the informative annotations are mitochondrial protein processing (GO:0034982) and protein quality control (GO:0006515).
GO:0016020 membrane
IEA
GO_REF:0000044
KEEP AS NON CORE
Summary: Subcellular-location mapping (IEA) to the generic term membrane. The protein is a multi-pass integral membrane protein, but the informative location is the mitochondrial inner membrane (GO:0005743), used in core_functions. Non-core parent.
Reason: Correct (two predicted TM helices at 111-133 and 225-245; UniProt multi-pass membrane protein) but far too generic to be a core localization statement.
GO:0016887 ATP hydrolysis activity
IEA
GO_REF:0000002
ACCEPT
Summary: InterPro (IEA) assignment of ATP hydrolysis activity, the motor activity of the AAA+ module that drives substrate unfolding/translocation. Corroborated by the intact Walker B motif (IIYIDE at residue 380) in the ppgn-1 sequence. A component activity of the ATP-dependent protease.
Reason: The AAA+ ATPase module with intact Walker A and Walker B motifs supports ATP hydrolysis; this is the energy-providing half of the ATP-dependent protease.
GO:0005743 mitochondrial inner membrane
ISS NEW
Summary: Proposed refinement of the generic mitochondrion/membrane localizations to the specific compartment where m-AAA proteases reside. Inferred from orthology to paraplegin and from the two predicted TM helices flanking matrix-facing catalytic domains (canonical m-AAA topology).
Reason: The generic GOA terms (GO:0005739 mitochondrion, GO:0016020 membrane) understate the known compartment. The m-AAA protease is an integral protein of the mitochondrial inner membrane; this ISS annotation captures the informative location while the worm-specific topology remains to be experimentally mapped.
Supporting Evidence:
PMID:16647881
The m-AAA protease carries out protein quality control in the inner membrane of the mitochondria
GO:0006515 protein quality control for misfolded or incompletely synthesized proteins
ISS NEW
Summary: Proposed refinement of the generic proteolysis annotation to the specific quality-control process performed by the m-AAA protease: ATP-dependent degradation of misfolded/unassembled inner-membrane proteins. Inferred from orthology and the intact AAA+ + M41 catalytic modules.
Reason: GO:0006508 (proteolysis) is uninformative; the conserved biological role of the family is inner-membrane protein quality control. This ISS annotation records that specific process, complementing the mitochondrial protein processing (GO:0034982) role. The endogenous worm substrates are not yet identified.
Supporting Evidence:
PMID:16239145
AAA proteases comprise a conserved family of membrane bound ATP-dependent proteases that ensures the quality control of mitochondrial inner-membrane proteins.

Core Functions

ATP-dependent proteolytic quality control of the inner mitochondrial membrane. As a subunit of the m-AAA protease, ppgn-1 couples ATP-driven substrate unfolding and translocation (AAA+ module) to zinc-dependent peptide-bond hydrolysis (M41 module) to degrade misfolded or unassembled inner-membrane proteins to peptides. Inferred from orthology to paraplegin/AFG3L2 and from the intact Walker A/B and HExxH catalytic motifs in the ppgn-1 sequence; the endogenous C. elegans substrates are not yet identified.

Supporting Evidence:
  • PMID:16239145
    AAA proteases comprise a conserved family of membrane bound ATP-dependent proteases that ensures the quality control of mitochondrial inner-membrane proteins.
  • PMID:21610694
    m-AAA proteases exert dual functions in the mitochondrial inner membrane: they mediate the processing of specific regulatory proteins and ensure protein quality control degrading misfolded polypeptides to peptides.

Regulated proteolytic maturation (processing) of specific mitochondrial substrates. Beyond bulk degradation, m-AAA proteases perform limited, sequence-specific cleavage that matures regulatory substrates; the conserved paradigm is processing of the ribosomal protein MrpL32, which is required for mitochondrial ribosome assembly and translation. ppgn-1 is inferred to contribute this metalloendopeptidase-based processing activity within the worm m-AAA complex; the specific worm substrate(s) remain undetermined.

Supporting Evidence:
  • PMID:16239145
    The mitochondrial ribosomal protein MrpL32 is processed by the m-AAA protease, allowing its association with preassembled ribosomal particles and completion of ribosome assembly in close proximity to the inner membrane.

References

Gene Ontology annotation through association of InterPro records with GO terms
Annotation inferences using phylogenetic trees
Gene Ontology annotation based on UniProtKB/Swiss-Prot Subcellular Location vocabulary mapping, accompanied by conservative changes to GO terms applied by UniProt
Spastic paraplegia and OXPHOS impairment caused by mutations in paraplegin, a nuclear-encoded mitochondrial metalloprotease.
  • Paraplegin (the ortholog of ppgn-1) is a nuclear-encoded mitochondrial metalloprotease homologous to the yeast mitochondrial AAA ATPases (AFG3, RCA1, YME1) that combine proteolytic and chaperone-like activities at the inner mitochondrial membrane, and it localizes to mitochondria.
    "Paraplegin is highly homologous to the yeast mitochondrial ATPases, AFG3, RCA1, and YME1, which have both proteolytic and chaperon-like activities at the inner mitochondrial membrane."
The m-AAA protease defective in hereditary spastic paraplegia controls ribosome assembly in mitochondria.
  • AAA proteases are a conserved family of membrane-bound ATP-dependent proteases that ensure quality control of mitochondrial inner-membrane proteins, and the m-AAA protease processes the ribosomal protein MrpL32 to allow completion of ribosome assembly at the inner membrane.
    "AAA proteases comprise a conserved family of membrane bound ATP-dependent proteases that ensures the quality control of mitochondrial inner-membrane proteins."
Translating m-AAA protease function in mitochondria to hereditary spastic paraplegia.
  • Paraplegin is a conserved subunit of the ubiquitous, ATP-dependent m-AAA protease in mitochondria, which carries out protein quality control in the inner mitochondrial membrane.
    "paraplegin, which is a conserved subunit of the ubiquitous and ATP-dependent m-AAA protease in mitochondria."
Presequence-dependent folding ensures MrpL32 processing by the m-AAA protease in mitochondria.
  • m-AAA proteases have dual functions in the inner mitochondrial membrane: regulated processing of specific substrates and quality-control degradation of misfolded polypeptides to peptides.
    "m-AAA proteases exert dual functions in the mitochondrial inner membrane: they mediate the processing of specific regulatory proteins and ensure protein quality control degrading misfolded polypeptides to peptides."

Suggested Questions for Experts

Q: Does ppgn-1 form a functional m-AAA protease complex on its own, or does it require the AFG3L2-type subunit spg-7, and are the two subunits functionally redundant in C. elegans?

Suggested experts: C. elegans mitochondrial biologists, m-AAA protease / AAA+ protease structural biochemists

Q: What are the endogenous substrates of ppgn-1 in C. elegans, and does it mature a MrpL32 homolog to regulate mitochondrial ribosome assembly as in yeast and mouse?

Suggested experts: Mitochondrial proteostasis / ribosome assembly researchers

Suggested Experiments

Experiment: Generate a ppgn-1 null allele (CRISPR) and, in parallel with spg-7 RNAi/mutant, assay respiration, mitochondrial morphology, UPRmt (hsp-6p::GFP), fertility and lifespan to determine ppgn-1's non-redundant contribution.

Type: Reverse genetics / phenotyping

Experiment: Endogenously tag ppgn-1, purify from worm mitochondria, and identify complex partners (test for spg-7 hetero-oligomerization) and, using a catalytically dead HExxH mutant as a substrate trap, capture processed/degraded substrates.

Type: Affinity purification / mass spectrometry

Experiment: Determine ppgn-1 tissue expression and sub-mitochondrial topology with an endogenous fluorescent tag and protease-protection assays, to confirm the predicted inner-membrane, matrix-facing catalytic-domain topology.

Type: Localization

Knowledge Gaps

What is not known β€” curated, literature-grounded statements of the open unknowns (the inverse of core functions).

Gap: ppgn-1 has no experimental functional characterization in C. elegans: no loss-of-function (mutant or RNAi) phenotype, no localization, and no biochemical assay has been reported for this gene. Every GO annotation is phylogenetic (IBA) or electronic (IEA), and the only UniProt-linked reference is an unpublished nucleotide sequence submission.

OPEN BIOLOGY WHOLLY_DARK

What is known: The protein is confidently a paraplegin-subfamily m-AAA protease subunit (PANTHER PTHR43655:SF8; AAA+ + M41 architecture) with intact catalytic motifs, and the human ortholog paraplegin (SPG7) and yeast/mouse orthologs are well characterized. What is missing is any direct evidence for ppgn-1 itself in the worm.

Significance: Without any worm-level data, ppgn-1's function is entirely an orthology inference; its non-redundant contribution (if any) to C. elegans mitochondrial physiology is unknown.

What would resolve it: Generate and phenotype a ppgn-1 deletion/RNAi allele (respiration, mitochondrial morphology, UPRmt reporters, fertility, lifespan), and determine its expression and subcellular localization with an endogenous tag.

Provenance (the field's own admissions):

Gap: The endogenous substrate(s) of ppgn-1 in C. elegans are unidentified. It is unknown whether the worm protease matures a functional homolog of MrpL32 (regulated processing) and/or which misfolded inner-membrane proteins it degrades (quality control), and whether ppgn-1 and the AFG3L2-type subunit spg-7 act on the same or distinct substrate sets.

OPEN BIOLOGY MF_DARK

What is known: The conserved m-AAA protease has a defined dual activity (processing vs degradation), and MrpL32 maturation is the textbook processing substrate in yeast and mouse. ppgn-1 retains an intact HExxH metallopeptidase active site, so it is catalytically capable in principle.

Significance: Substrate identity is what distinguishes a housekeeping protease from a specific regulatory node; it is the rate-limiting unknown for placing ppgn-1 in a pathway.

What would resolve it: Substrate-trapping (catalytically inactive HExxH mutant) plus comparative proteomics of ppgn-1 vs spg-7 loss-of-function to identify processed/stabilized substrates.

Provenance (the field's own admissions):

Gap: The oligomeric composition of the C. elegans m-AAA complex containing ppgn-1 is undetermined: whether ppgn-1 forms a homo-oligomer, assembles into a hetero-oligomer with the AFG3L2-type subunit spg-7, and whether the two worm subunits are functionally redundant, is untested.

OPEN BIOLOGY RESIDUAL_SUBGAP

What is known: In mammals the m-AAA protease is a hexamer of paraplegin (SPG7) and/or AFG3L2, and one catalytically dead subunit can be tolerated within an otherwise active complex. C. elegans has both a paraplegin-type (ppgn-1) and an AFG3L2-type (spg-7) subunit, but their assembly relationship is not reported.

Significance: Complex composition determines whether ppgn-1 loss can be buffered by spg-7 and how to interpret single-gene phenotypes.

What would resolve it: Co-immunoprecipitation / blue-native PAGE of endogenously tagged ppgn-1 and spg-7, and epistasis/double-mutant analysis to test redundancy.

Provenance (the field's own admissions):

Gap: Whether ppgn-1 (as opposed to its paralog spg-7) contributes to any organismal process in C. elegans - the mitochondrial unfolded-protein response, respiration, mitochondrial dynamics, fertility, longevity, or stress/pathogen resistance - is unknown. The large C. elegans mito-protease functional literature concerns spg-7 and cannot be attributed to ppgn-1.

OPEN BIOLOGY BP_DARK

What is known: Loss of m-AAA proteases across organisms causes respiratory deficiency, altered mitochondrial morphology and axonal degeneration; none of these readouts has been tested specifically for ppgn-1 in the worm.

Significance: Assigning ppgn-1 a biological process (vs treating it as a redundant paralog) requires worm phenotypes; this determines its relevance to mitochondrial surveillance and stress signaling.

What would resolve it: Test ppgn-1 loss-of-function against UPRmt (hsp-6p::GFP), respiration, mitochondrial morphology, and pathogen/stress-resistance assays, side by side with spg-7.

Provenance (the field's own admissions):

πŸ“š Additional Documentation

Notes

(ppgn-1-notes.md)

ppgn-1 (Y38F2AR.7 / WBGene00021425 / UniProt G5EDB6) β€” research notes

Research journal for the AI GO-annotation review. Provenance is recorded inline as
[PMID:xxxx "verbatim quote"]. This is a dark gene: the deliverable is a precise,
defensible statement of what is and is not known.

1. Identity (verified from the UniProt record)

  • UniProt G5EDB6 (TrEMBL, unreviewed), Caenorhabditis elegans, NCBITaxon:6239.
  • Gene symbol ppgn-1; ORF Y38F2AR.7; WormBase WBGene00021425; RefSeq NP_500191.3.
  • Protein name (UniProt SubName): Paraplegin. 747 aa, 82.8 kDa.
  • The only primary reference on the UniProt entry is an unpublished nucleotide-sequence
    submission: Yamanaka, Yamada-Inagawa, Nishizono, Ogura (2006), title "Paraplegin
    homologue in C. elegans" (EMBL AB257343 / BAE96353.1). No functional paper.
  • Domain architecture (UniProt/InterPro): N-terminal AAA+ ATPase module
    (AAA+ core IPR003959; AAA_lid_3 IPR041569; SMART AAA domain 317–462) and C-terminal
    peptidase M41 zinc-metallopeptidase module (IPR000642). Two predicted TM helices
    (Phobius: 111–133 and 225–245). N-terminal disordered/basic region 41–101 (matrix
    targeting/presequence-like). Cofactor Zn²⁺ (ARBA). SubCellular: Mitochondrion,
    multi-pass membrane protein.
  • PANTHER classification: PTHR43655 "ATP-DEPENDENT PROTEASE", subfamily
    PTHR43655:SF8 PARAPLEGIN. MEROPS peptidase clan/family M41.A12.
  • Reactome (electronic, projected): R-CEL-8949664 "Processing of SMDT1";
    R-CEL-9837999 "Mitochondrial protein degradation".

Bottom line on identity: despite the surrounding project framing, ppgn-1 is NOT an
epidermal/innate-immune/wound gene. It is the C. elegans paraplegin-subfamily
subunit of the mitochondrial m-AAA protease
β€” an ATP-dependent, membrane-embedded
zinc metalloprotease of the inner mitochondrial membrane. All curation below is against
that identity.

2. What the m-AAA protease family does (KNOWN β€” orthologue/family biology)

The family is well characterised in yeast, mouse and human; ppgn-1's GO annotations are
IBA/IEA propagations from these orthologues.

  • m-AAA proteases are a conserved, membrane-bound, ATP-dependent proteolytic machine of
    the mitochondrial inner membrane that performs protein quality control:
    PMID:16239145.
  • Human paraplegin (SPG7) is a bona fide subunit of this complex, and the complex is
    ATP-dependent: PMID:16647881
    and PMID:16647881.
  • The founding paper established paraplegin as a nuclear-encoded mitochondrial
    metalloprotease homologous to the yeast AAA ATPases with dual proteolytic + chaperone
    activity: PMID:9635427
    and localises to mitochondria: PMID:9635427.
  • Besides bulk degradation, the m-AAA protease has a regulated processing role: it
    matures specific substrates. The conserved paradigm is maturation of the ribosomal
    protein MrpL32: PMID:16239145.
    This dual degrade-vs-process behaviour is explicit in the literature:
    PMID:21610694.
  • Loss of function is pleiotropic across organisms (respiration, mito morphology, axon
    degeneration): PMID:16239145.
  • In mammals the physiological complex is a hetero-/homo-hexamer of paraplegin (SPG7)
    and/or AFG3L2 (WITH/FROM of the ppgn-1 IBA annotations lists human SPG7 = UniProtKB
    Q9UQ90 and AFG3L2 = UniProtKB Q9Y4W6, plus mouse Afg3l1/Afg3l2 and yeast Yta10/Yta12).

3. Bioinformatic verification for THIS protein (KNOWN β€” from ppgn-1 sequence)

To guard against propagating enzyme annotations onto a possible pseudoenzyme, I scanned
the ppgn-1 sequence itself (see ppgn-1-bioinformatics/, reproducible
analyze_motifs.py). All three catalytic motifs are intact and correctly ordered:

  • Walker A / P-loop GPPGCGKT at 325 (ATP binding).
  • Walker B IIYIDE at 380 (Mg-ATP hydrolysis).
  • HExxH zinc-binding catalytic motif HEAGH at 555, within the M41 domain,
    followed downstream by an acidic residue (…MLEHTD) β€” a complete FtsH-type Zn²⁺
    active site.

Interpretation: ppgn-1 is a catalytically competent m-AAA protease at the sequence
level, not a degenerate pseudoenzyme. This supports the enzymatic GO terms for this
specific protein, not merely by family membership. See
file:worm/ppgn-1/ppgn-1-bioinformatics/RESULTS.md.

4. C. elegans context β€” and the paralog trap (NOT-known for ppgn-1)

  • C. elegans has (at least) two m-AAA protease subunit genes: the well-studied
    spg-7 (WBGene00004978; the AFG3L2-type subunit, and the gene whose RNAi is the
    canonical trigger of the mitochondrial unfolded-protein response, UPR^mt, and of
    detoxification/immune gene induction β€” WormBase/literature summaries) and the
    understudied ppgn-1 (paraplegin subfamily, this gene).
  • Crucial curation caveat: the large C. elegans mitochondrial-protease functional
    literature (UPR^mt, drug resistance, detoxification, pathogen resistance) is about
    spg-7, NOT ppgn-1. None of it can be attributed to ppgn-1. The GOA annotations for
    ppgn-1 are correctly all IBA/IEA (no experimental evidence code), reflecting this.
  • WITH/FROM of the ppgn-1 IBA annotations includes WB:WBGene00004978 (spg-7) as a
    co-orthologue in the PANTHER tree, i.e. the two worm genes are placed together in the
    m-AAA clade.

5. Explicit KNOWN vs NOT-known ledger for ppgn-1

KNOWN (high confidence, from orthology + domain/motif evidence):
- Encodes a paraplegin-subfamily m-AAA protease subunit (AAA+ ATPase + M41 Zn-peptidase).
- Retains intact ATP-binding (Walker A), ATP-hydrolysis (Walker B) and Zn-peptidase
(HExxH) catalytic motifs β†’ catalytically competent in principle.
- Predicted mitochondrial, integral inner-membrane (two TM helices), matrix-facing
catalytic domains β€” the canonical m-AAA topology.
- Family function: ATP-dependent proteolytic quality control + regulated processing of
inner-membrane / matrix substrates.

NOT KNOWN (the real gaps for ppgn-1 specifically):
- No C. elegans experimental characterisation of ppgn-1: no mutant/RNAi phenotype,
no localisation, no biochemistry has been reported for this gene (all GO evidence is
IBA/IEA; the only UniProt reference is an unpublished sequence submission).
- Substrates unknown: which inner-membrane proteins ppgn-1 degrades or matures in the
worm is undetermined (no worm equivalent of the MrpL32 result attributed to ppgn-1).
- Complex composition unknown: whether ppgn-1 assembles with the AFG3L2-type subunit
spg-7 into a hetero-hexamer, forms a homo-oligomer, or is catalytically redundant with
spg-7 is untested.
- Physiological role unknown: whether ppgn-1 (as opposed to spg-7) contributes to
UPR^mt, respiration, mitochondrial morphology, fertility, longevity, stress/pathogen
responses, or is functionally dispensable, is unknown.
- Regulation unknown: expression, tissue distribution (Bgee: "Expressed in germ line
and 4 other cell types" β€” coarse, electronic), and conditions under which it acts are
uncharacterised.

6. Annotation-review plan (summary)

All 10 GOA annotations are IBA/IEA and are consistent with a catalytically competent
paraplegin-subfamily m-AAA protease; none is contradicted, so none is REMOVEd.
- Core, well-supported family propagations β†’ ACCEPT: mitochondrial protein processing
(IBA), m-AAA complex (IBA), metalloendopeptidase activity (IBA + IEA), ATP-dependent
peptidase activity (IEA), ATP binding (IEA), ATP hydrolysis activity (IEA).
- Correct but non-specific / non-core β†’ KEEP_AS_NON_CORE with a note: proteolysis
(GO:0006508, generic parent of the specific processing/QC role), mitochondrion
(GO:0005739, generic parent of inner membrane), membrane (GO:0016020, generic parent
of inner membrane).
- The persistent uncertainty (no worm data) is captured in knowledge_gaps, not by
down-grading correct family propagations.

7. Deep research status

just deep-research-falcon worm ppgn-1 --fallback perplexity-lite was run FOREGROUND and
retried. Falcon timed out at the 600 s server limit on both attempts; the perplexity-lite
fallback returned HTTP 401 (account quota exhausted). No -deep-research-*.md file was
produced. Per repo policy I did not fabricate one. This review therefore rests on the
UniProt/InterPro record, the GOA evidence codes, the primary m-AAA/paraplegin literature
cited above (PubMed-verified, cached in publications/), and the reproducible sequence
analysis in ppgn-1-bioinformatics/.

Bioinformatics Results

(RESULTS.md)

ppgn-1 (G5EDB6) β€” catalytic motif analysis

Question

The GO annotations for ppgn-1 (Y38F2AR.7, C. elegans paraplegin subfamily) are all
IBA/IEA β€” propagated from the m-AAA protease family, with no C. elegans experimental
support. A legitimate worry for any family propagation is that the target is a
pseudoenzyme: a fold-retaining paralog that has lost the catalytic residues (cf.
human AFG3L1P pseudogene, or the peptidase-dead YME1L variants). If ppgn-1 had lost its
Walker A/B or HExxH residues, the enzymatic annotations (metalloendopeptidase, ATP
binding, ATP hydrolysis, ATP-dependent peptidase) would be over-annotations for this
specific protein even though they are correct for the family.

Method

analyze_motifs.py parses the amino-acid sequence directly from ../ppgn-1-uniprot.txt
(nothing hard-coded) and scans for the three diagnostic motifs of an m-AAA protease:

  • Walker A / P-loop (G-x(4)-G-K-[S/T]) β€” binds the Ξ²/Ξ³ phosphates of ATP.
  • Walker B (hhhh-D-E) β€” the Asp/Glu that coordinate Mg²⁺ and activate water for ATP hydrolysis.
  • HExxH β€” the M41/FtsH zinc-binding catalytic motif (two His coordinate the catalytic Zn²⁺; the Glu polarises the attacking water).

Run with uv run python analyze_motifs.py.

Result (reproducible)

length: 747 aa
Walker A (P-loop, ATP binding):            FOUND at 325 -> GPPGCGKT
Walker B (Mg-ATP hydrolysis):              FOUND at 380 -> IIYIDE
HExxH (M41 zinc-binding catalytic motif):  FOUND at 555 -> HEAGH
HExxH context [555..589]: HEAGHALVGWMLEHTDALLKVTIIPRTSAALGFAQ

All three catalytic elements are intact and in the expected order (AAA+ ATPase module
N-terminal, M41 peptidase module C-terminal), consistent with the domain architecture
UniProt/InterPro annotate (AAA+ core IPR003959; Peptidase M41 IPR000642). The HExxH lies
within the M41 domain and is followed downstream by an acidic residue (…MLEHTD),
consistent with a complete FtsH-type Zn²⁺ active site.

Interpretation

At the sequence level ppgn-1 is a catalytically competent m-AAA protease subunit, not
a degenerate pseudoenzyme: it retains the residues required for both ATP binding/hydrolysis
and zinc-dependent peptide-bond cleavage. This supports (for this specific protein, not
merely by family membership) the molecular-function annotations ATP binding,
ATP hydrolysis activity, metalloendopeptidase activity, and ATP-dependent peptidase activity.

Caveats / what this does NOT show

  • Motif presence proves catalytic potential, not that the enzyme is active in vivo,
    what its physiological substrates are, or which partner subunit(s) it assembles with.
  • It does not establish whether ppgn-1 is catalytically required in a complex or serves a
    more structural role alongside the C. elegans AFG3L2-type subunit (spg-7). Mammalian
    m-AAA complexes tolerate one catalytically dead subunit within an otherwise active
    hexamer.
  • Sub-mitochondrial topology (matrix-facing catalytic domains flanked by two TM helices)
    is inferred from UniProt Phobius predictions, not experimentally mapped here.

πŸ“„ View Raw YAML

id: G5EDB6
gene_symbol: ppgn-1
product_type: PROTEIN
status: DRAFT
taxon:
  id: NCBITaxon:6239
  label: Caenorhabditis elegans
description: >-
  ppgn-1 (Y38F2AR.7) encodes the Caenorhabditis elegans paraplegin-subfamily subunit
  of the mitochondrial m-AAA protease, an ATP-dependent proteolytic machine embedded in
  the inner mitochondrial membrane. The protein has the diagnostic two-module
  architecture of this family: an N-terminal AAA+ ATPase module that uses ATP binding and
  hydrolysis to unfold and translocate substrates, and a C-terminal M41 (FtsH-type)
  zinc-metallopeptidase module that cleaves peptide bonds; the catalytic residues of both
  modules (Walker A P-loop GPPGCGKT, Walker B IIYIDE, and the HExxH zinc-binding motif
  HEAGH) are intact in the ppgn-1 sequence. It is predicted to be an integral, multi-pass
  inner-membrane protein with matrix-facing catalytic domains and an N-terminal
  mitochondrial targeting region. Within the conserved m-AAA complex, family members
  carry out two coupled activities: quality-control degradation of misfolded or
  unassembled inner-membrane proteins, and regulated proteolytic maturation of specific
  substrates (the paradigm being processing of the ribosomal protein MrpL32 to control
  mitochondrial ribosome assembly and translation). The orthologous human subunit is
  paraplegin (SPG7), whose loss causes autosomal-recessive hereditary spastic paraplegia.
  The specific in vivo role, substrates, and complex partners of ppgn-1 in C. elegans
  have not been experimentally determined; C. elegans additionally carries the
  well-studied AFG3L2-type m-AAA subunit spg-7.
references:
- id: GO_REF:0000002
  title: Gene Ontology annotation through association of InterPro records with GO terms
  findings: []
- id: GO_REF:0000033
  title: Annotation inferences using phylogenetic trees
  findings: []
- id: GO_REF:0000044
  title: Gene Ontology annotation based on UniProtKB/Swiss-Prot Subcellular Location
    vocabulary mapping, accompanied by conservative changes to GO terms applied by
    UniProt
  findings: []
- id: PMID:9635427
  title: "Spastic paraplegia and OXPHOS impairment caused by mutations in paraplegin,
    a nuclear-encoded mitochondrial metalloprotease."
  findings:
  - statement: >-
      Paraplegin (the ortholog of ppgn-1) is a nuclear-encoded mitochondrial
      metalloprotease homologous to the yeast mitochondrial AAA ATPases (AFG3, RCA1,
      YME1) that combine proteolytic and chaperone-like activities at the inner
      mitochondrial membrane, and it localizes to mitochondria.
    supporting_text: >-
      Paraplegin is highly homologous to the yeast mitochondrial ATPases, AFG3, RCA1,
      and YME1, which have both proteolytic and chaperon-like activities at the inner
      mitochondrial membrane.
  reference_review:
    relevance: HIGH
    correctness: VERIFIED
    review_notes: >-
      PubMed-verified founding paper defining paraplegin as the mitochondrial m-AAA
      metalloprotease subunit orthologous to ppgn-1; establishes family identity,
      mitochondrial localization, and dual protease/chaperone character. Concerns human
      SPG7, not C. elegans ppgn-1, so it supports the annotations by orthology only.
- id: PMID:16239145
  title: "The m-AAA protease defective in hereditary spastic paraplegia controls ribosome
    assembly in mitochondria."
  findings:
  - statement: >-
      AAA proteases are a conserved family of membrane-bound ATP-dependent proteases that
      ensure quality control of mitochondrial inner-membrane proteins, and the m-AAA
      protease processes the ribosomal protein MrpL32 to allow completion of ribosome
      assembly at the inner membrane.
    supporting_text: >-
      AAA proteases comprise a conserved family of membrane bound ATP-dependent proteases
      that ensures the quality control of mitochondrial inner-membrane proteins.
  reference_review:
    relevance: HIGH
    correctness: VERIFIED
    review_notes: >-
      PubMed-verified; defines the conserved MF/BP of the family (ATP-dependent
      inner-membrane quality control and the MrpL32 processing paradigm) that the ppgn-1
      IBA annotations propagate. Yeast/mouse study, not C. elegans.
- id: PMID:16647881
  title: "Translating m-AAA protease function in mitochondria to hereditary spastic paraplegia."
  findings:
  - statement: >-
      Paraplegin is a conserved subunit of the ubiquitous, ATP-dependent m-AAA protease
      in mitochondria, which carries out protein quality control in the inner
      mitochondrial membrane.
    supporting_text: >-
      paraplegin, which is a conserved subunit of the ubiquitous and ATP-dependent m-AAA
      protease in mitochondria.
  reference_review:
    relevance: HIGH
    correctness: VERIFIED
    review_notes: >-
      PubMed-verified review supporting the m-AAA complex membership (part_of GO:0005745)
      and the inner-membrane quality-control role by orthology to paraplegin.
- id: PMID:21610694
  title: "Presequence-dependent folding ensures MrpL32 processing by the m-AAA protease
    in mitochondria."
  findings:
  - statement: >-
      m-AAA proteases have dual functions in the inner mitochondrial membrane: regulated
      processing of specific substrates and quality-control degradation of misfolded
      polypeptides to peptides.
    supporting_text: >-
      m-AAA proteases exert dual functions in the mitochondrial inner membrane: they
      mediate the processing of specific regulatory proteins and ensure protein quality
      control degrading misfolded polypeptides to peptides.
  reference_review:
    relevance: MEDIUM
    correctness: VERIFIED
    review_notes: >-
      PubMed-verified; articulates the processing-vs-degradation dual role underlying the
      distinction between the two core functions. Yeast substrate mechanism, not worm.
existing_annotations:
- term:
    id: GO:0034982
    label: mitochondrial protein processing
  evidence_type: IBA
  original_reference_id: GO_REF:0000033
  qualifier: involved_in
  review:
    summary: >-
      Phylogenetic (IBA) propagation of the conserved m-AAA processing role from
      paraplegin/AFG3L2 orthologs. Consistent with ppgn-1's intact M41 protease domain
      and the family paradigm of regulated substrate maturation (e.g. MrpL32). Retained
      as a core function, with the caveat that no C. elegans substrate has been shown.
    action: ACCEPT
    reason: >-
      ppgn-1 is a clear paraplegin-subfamily m-AAA subunit (PANTHER PTHR43655:SF8) with a
      complete M41 zinc-peptidase module (HExxH motif HEAGH intact at residue 555), so the
      conserved processing activity is appropriately propagated. The direct substrate in
      the worm is unknown (see knowledge_gaps).
    supported_by:
    - reference_id: PMID:16239145
      supporting_text: >-
        The mitochondrial ribosomal protein MrpL32 is processed by the m-AAA protease,
        allowing its association with preassembled ribosomal particles and completion of
        ribosome assembly in close proximity to the inner membrane.
- term:
    id: GO:0005745
    label: m-AAA complex
  evidence_type: IBA
  original_reference_id: GO_REF:0000033
  qualifier: part_of
  review:
    summary: >-
      IBA propagation that ppgn-1 is a subunit of the inner-membrane m-AAA protease
      complex. Well supported by orthology to paraplegin (a conserved m-AAA subunit) and
      by the shared two-module (AAA+ + M41) architecture. Core.
    action: ACCEPT
    reason: >-
      Paraplegin is a conserved subunit of the m-AAA complex; ppgn-1 is its C. elegans
      ortholog. The specific composition of the worm complex (homo-oligomer vs
      hetero-oligomer with the AFG3L2-type subunit spg-7) is not experimentally
      established.
    supported_by:
    - reference_id: PMID:16647881
      supporting_text: >-
        paraplegin, which is a conserved subunit of the ubiquitous and ATP-dependent
        m-AAA protease in mitochondria.
- term:
    id: GO:0004222
    label: metalloendopeptidase activity
  evidence_type: IBA
  original_reference_id: GO_REF:0000033
  qualifier: enables
  review:
    summary: >-
      IBA propagation of zinc-dependent endopeptidase activity from the family. Directly
      corroborated for the ppgn-1 sequence by the intact M41 HExxH zinc-binding catalytic
      motif (HEAGH at residue 555, within the Peptidase_M41 domain). Core molecular
      function.
    action: ACCEPT
    reason: >-
      The C-terminal M41 peptidase domain (InterPro IPR000642) and the intact HExxH motif
      support metalloendopeptidase chemistry for this specific protein, not merely by
      family membership.
    supported_by:
    - reference_id: PMID:9635427
      supporting_text: >-
        Paraplegin is highly homologous to the yeast mitochondrial ATPases, AFG3, RCA1,
        and YME1, which have both proteolytic and chaperon-like activities at the inner
        mitochondrial membrane.
- term:
    id: GO:0004176
    label: ATP-dependent peptidase activity
  evidence_type: IEA
  original_reference_id: GO_REF:0000002
  qualifier: enables
  review:
    summary: >-
      InterPro (IEA) assignment of ATP-dependent peptidase activity. This is the most
      complete single molecular-function term for an m-AAA protease because it captures
      the coupling of the AAA+ ATPase to the M41 peptidase. Supported by the intact
      Walker A/B (GPPGCGKT, IIYIDE) and HExxH motifs in the ppgn-1 sequence. Core.
    action: ACCEPT
    reason: >-
      ppgn-1 has both an intact AAA+ ATPase module (Walker A GPPGCGKT at 325, Walker B
      IIYIDE at 380) and an intact M41 peptidase module (HExxH at 555), the defining
      combination for ATP-dependent proteolysis.
    supported_by:
    - reference_id: PMID:16239145
      supporting_text: >-
        AAA proteases comprise a conserved family of membrane bound ATP-dependent
        proteases that ensures the quality control of mitochondrial inner-membrane
        proteins.
- term:
    id: GO:0004222
    label: metalloendopeptidase activity
  evidence_type: IEA
  original_reference_id: GO_REF:0000002
  qualifier: enables
  review:
    summary: >-
      Second annotation of metalloendopeptidase activity, here from the InterPro M41
      signature (IEA). Same well-supported molecular function as the IBA annotation
      above; kept as a corroborating electronic assignment.
    action: ACCEPT
    reason: >-
      Redundant with the IBA metalloendopeptidase annotation but independently supported
      by the InterPro Peptidase_M41 signature (IPR000642) and the intact HExxH motif.
- term:
    id: GO:0005524
    label: ATP binding
  evidence_type: IEA
  original_reference_id: GO_REF:0000002
  qualifier: enables
  review:
    summary: >-
      InterPro (IEA) assignment of ATP binding, an activity of the AAA+ module.
      Corroborated by the intact Walker A P-loop (GPPGCGKT at residue 325) in the ppgn-1
      sequence. A component activity of the ATP-dependent protease.
    action: ACCEPT
    reason: >-
      The N-terminal AAA+ ATPase domain (SMART SM00382; InterPro IPR003959) with an
      intact Walker A motif provides a direct structural basis for ATP binding.
- term:
    id: GO:0005739
    label: mitochondrion
  evidence_type: IEA
  original_reference_id: GO_REF:0000044
  qualifier: located_in
  review:
    summary: >-
      Subcellular-location mapping (IEA) to mitochondrion. Correct but non-specific: the
      family resides in the inner mitochondrial membrane, captured more precisely in
      core_functions (GO:0005743). Retained but marked non-core because it is a generic
      parent of the informative location.
    action: KEEP_AS_NON_CORE
    reason: >-
      Consistent with the orthologous localization (paraplegin localizes to mitochondria)
      and with two predicted TM helices; the more informative term is mitochondrial inner
      membrane, so this generic term is not the core localization statement.
    supported_by:
    - reference_id: PMID:9635427
      supporting_text: >-
        Immunofluorescence analysis and import experiments showed that Paraplegin
        localizes to mitochondria.
- term:
    id: GO:0006508
    label: proteolysis
  evidence_type: IEA
  original_reference_id: GO_REF:0000002
  qualifier: involved_in
  review:
    summary: >-
      InterPro (IEA) generic proteolysis term. Correct but uninformative: the specific
      biological roles (protein quality-control degradation and mitochondrial protein
      processing) are captured in core_functions. Retained as a non-core parent term.
    action: KEEP_AS_NON_CORE
    reason: >-
      GO:0006508 is a high-level parent of the specific m-AAA processes; it is not wrong,
      but the informative annotations are mitochondrial protein processing (GO:0034982)
      and protein quality control (GO:0006515).
- term:
    id: GO:0016020
    label: membrane
  evidence_type: IEA
  original_reference_id: GO_REF:0000044
  qualifier: located_in
  review:
    summary: >-
      Subcellular-location mapping (IEA) to the generic term membrane. The protein is a
      multi-pass integral membrane protein, but the informative location is the
      mitochondrial inner membrane (GO:0005743), used in core_functions. Non-core parent.
    action: KEEP_AS_NON_CORE
    reason: >-
      Correct (two predicted TM helices at 111-133 and 225-245; UniProt multi-pass
      membrane protein) but far too generic to be a core localization statement.
- term:
    id: GO:0016887
    label: ATP hydrolysis activity
  evidence_type: IEA
  original_reference_id: GO_REF:0000002
  qualifier: enables
  review:
    summary: >-
      InterPro (IEA) assignment of ATP hydrolysis activity, the motor activity of the
      AAA+ module that drives substrate unfolding/translocation. Corroborated by the
      intact Walker B motif (IIYIDE at residue 380) in the ppgn-1 sequence. A component
      activity of the ATP-dependent protease.
    action: ACCEPT
    reason: >-
      The AAA+ ATPase module with intact Walker A and Walker B motifs supports ATP
      hydrolysis; this is the energy-providing half of the ATP-dependent protease.
- term:
    id: GO:0005743
    label: mitochondrial inner membrane
  evidence_type: ISS
  qualifier: located_in
  review:
    summary: >-
      Proposed refinement of the generic mitochondrion/membrane localizations to the
      specific compartment where m-AAA proteases reside. Inferred from orthology to
      paraplegin and from the two predicted TM helices flanking matrix-facing catalytic
      domains (canonical m-AAA topology).
    action: NEW
    reason: >-
      The generic GOA terms (GO:0005739 mitochondrion, GO:0016020 membrane) understate the
      known compartment. The m-AAA protease is an integral protein of the mitochondrial
      inner membrane; this ISS annotation captures the informative location while the
      worm-specific topology remains to be experimentally mapped.
    supported_by:
    - reference_id: PMID:16647881
      supporting_text: >-
        The m-AAA protease carries out protein quality control in the inner membrane of
        the mitochondria
- term:
    id: GO:0006515
    label: protein quality control for misfolded or incompletely synthesized proteins
  evidence_type: ISS
  qualifier: involved_in
  review:
    summary: >-
      Proposed refinement of the generic proteolysis annotation to the specific
      quality-control process performed by the m-AAA protease: ATP-dependent degradation
      of misfolded/unassembled inner-membrane proteins. Inferred from orthology and the
      intact AAA+ + M41 catalytic modules.
    action: NEW
    reason: >-
      GO:0006508 (proteolysis) is uninformative; the conserved biological role of the
      family is inner-membrane protein quality control. This ISS annotation records that
      specific process, complementing the mitochondrial protein processing (GO:0034982)
      role. The endogenous worm substrates are not yet identified.
    supported_by:
    - reference_id: PMID:16239145
      supporting_text: >-
        AAA proteases comprise a conserved family of membrane bound ATP-dependent
        proteases that ensures the quality control of mitochondrial inner-membrane
        proteins.
core_functions:
- description: >-
    ATP-dependent proteolytic quality control of the inner mitochondrial membrane. As a
    subunit of the m-AAA protease, ppgn-1 couples ATP-driven substrate unfolding and
    translocation (AAA+ module) to zinc-dependent peptide-bond hydrolysis (M41 module) to
    degrade misfolded or unassembled inner-membrane proteins to peptides. Inferred from
    orthology to paraplegin/AFG3L2 and from the intact Walker A/B and HExxH catalytic
    motifs in the ppgn-1 sequence; the endogenous C. elegans substrates are not yet
    identified.
  molecular_function:
    id: GO:0004176
    label: ATP-dependent peptidase activity
  directly_involved_in:
  - id: GO:0006515
    label: protein quality control for misfolded or incompletely synthesized proteins
  locations:
  - id: GO:0005743
    label: mitochondrial inner membrane
  in_complex:
    id: GO:0005745
    label: m-AAA complex
  supported_by:
  - reference_id: PMID:16239145
    supporting_text: >-
      AAA proteases comprise a conserved family of membrane bound ATP-dependent proteases
      that ensures the quality control of mitochondrial inner-membrane proteins.
  - reference_id: PMID:21610694
    supporting_text: >-
      m-AAA proteases exert dual functions in the mitochondrial inner membrane: they
      mediate the processing of specific regulatory proteins and ensure protein quality
      control degrading misfolded polypeptides to peptides.
- description: >-
    Regulated proteolytic maturation (processing) of specific mitochondrial substrates.
    Beyond bulk degradation, m-AAA proteases perform limited, sequence-specific cleavage
    that matures regulatory substrates; the conserved paradigm is processing of the
    ribosomal protein MrpL32, which is required for mitochondrial ribosome assembly and
    translation. ppgn-1 is inferred to contribute this metalloendopeptidase-based
    processing activity within the worm m-AAA complex; the specific worm substrate(s)
    remain undetermined.
  molecular_function:
    id: GO:0004222
    label: metalloendopeptidase activity
  directly_involved_in:
  - id: GO:0034982
    label: mitochondrial protein processing
  locations:
  - id: GO:0005743
    label: mitochondrial inner membrane
  in_complex:
    id: GO:0005745
    label: m-AAA complex
  supported_by:
  - reference_id: PMID:16239145
    supporting_text: >-
      The mitochondrial ribosomal protein MrpL32 is processed by the m-AAA protease,
      allowing its association with preassembled ribosomal particles and completion of
      ribosome assembly in close proximity to the inner membrane.
knowledge_gaps:
- gap_statement: >-
    ppgn-1 has no experimental functional characterization in C. elegans: no
    loss-of-function (mutant or RNAi) phenotype, no localization, and no biochemical
    assay has been reported for this gene. Every GO annotation is phylogenetic (IBA) or
    electronic (IEA), and the only UniProt-linked reference is an unpublished nucleotide
    sequence submission.
  boundary: >-
    The protein is confidently a paraplegin-subfamily m-AAA protease subunit (PANTHER
    PTHR43655:SF8; AAA+ + M41 architecture) with intact catalytic motifs, and the human
    ortholog paraplegin (SPG7) and yeast/mouse orthologs are well characterized. What is
    missing is any direct evidence for ppgn-1 itself in the worm.
  gap_kind:
  - BIOLOGY
  dark_aspect: WHOLLY_DARK
  status: OPEN
  significance: >-
    Without any worm-level data, ppgn-1's function is entirely an orthology inference; its
    non-redundant contribution (if any) to C. elegans mitochondrial physiology is unknown.
  resolution: >-
    Generate and phenotype a ppgn-1 deletion/RNAi allele (respiration, mitochondrial
    morphology, UPRmt reporters, fertility, lifespan), and determine its expression and
    subcellular localization with an endogenous tag.
  provenance:
  - reference_id: PMID:9635427
    supporting_text: >-
      Paraplegin is highly homologous to the yeast mitochondrial ATPases, AFG3, RCA1,
      and YME1, which have both proteolytic and chaperon-like activities at the inner
      mitochondrial membrane.
- gap_statement: >-
    The endogenous substrate(s) of ppgn-1 in C. elegans are unidentified. It is unknown
    whether the worm protease matures a functional homolog of MrpL32 (regulated
    processing) and/or which misfolded inner-membrane proteins it degrades (quality
    control), and whether ppgn-1 and the AFG3L2-type subunit spg-7 act on the same or
    distinct substrate sets.
  boundary: >-
    The conserved m-AAA protease has a defined dual activity (processing vs degradation),
    and MrpL32 maturation is the textbook processing substrate in yeast and mouse. ppgn-1
    retains an intact HExxH metallopeptidase active site, so it is catalytically capable
    in principle.
  gap_kind:
  - BIOLOGY
  dark_aspect: MF_DARK
  status: OPEN
  significance: >-
    Substrate identity is what distinguishes a housekeeping protease from a specific
    regulatory node; it is the rate-limiting unknown for placing ppgn-1 in a pathway.
  resolution: >-
    Substrate-trapping (catalytically inactive HExxH mutant) plus comparative proteomics
    of ppgn-1 vs spg-7 loss-of-function to identify processed/stabilized substrates.
  provenance:
  - reference_id: PMID:21610694
    supporting_text: >-
      m-AAA proteases exert dual functions in the mitochondrial inner membrane: they
      mediate the processing of specific regulatory proteins and ensure protein quality
      control degrading misfolded polypeptides to peptides.
- gap_statement: >-
    The oligomeric composition of the C. elegans m-AAA complex containing ppgn-1 is
    undetermined: whether ppgn-1 forms a homo-oligomer, assembles into a hetero-oligomer
    with the AFG3L2-type subunit spg-7, and whether the two worm subunits are
    functionally redundant, is untested.
  boundary: >-
    In mammals the m-AAA protease is a hexamer of paraplegin (SPG7) and/or AFG3L2, and one
    catalytically dead subunit can be tolerated within an otherwise active complex. C.
    elegans has both a paraplegin-type (ppgn-1) and an AFG3L2-type (spg-7) subunit, but
    their assembly relationship is not reported.
  gap_kind:
  - BIOLOGY
  dark_aspect: RESIDUAL_SUBGAP
  status: OPEN
  significance: >-
    Complex composition determines whether ppgn-1 loss can be buffered by spg-7 and how to
    interpret single-gene phenotypes.
  resolution: >-
    Co-immunoprecipitation / blue-native PAGE of endogenously tagged ppgn-1 and spg-7, and
    epistasis/double-mutant analysis to test redundancy.
  provenance:
  - reference_id: PMID:16647881
    supporting_text: >-
      paraplegin, which is a conserved subunit of the ubiquitous and ATP-dependent m-AAA
      protease in mitochondria.
- gap_statement: >-
    Whether ppgn-1 (as opposed to its paralog spg-7) contributes to any organismal process
    in C. elegans - the mitochondrial unfolded-protein response, respiration, mitochondrial
    dynamics, fertility, longevity, or stress/pathogen resistance - is unknown. The large
    C. elegans mito-protease functional literature concerns spg-7 and cannot be attributed
    to ppgn-1.
  boundary: >-
    Loss of m-AAA proteases across organisms causes respiratory deficiency, altered
    mitochondrial morphology and axonal degeneration; none of these readouts has been
    tested specifically for ppgn-1 in the worm.
  gap_kind:
  - BIOLOGY
  dark_aspect: BP_DARK
  status: OPEN
  significance: >-
    Assigning ppgn-1 a biological process (vs treating it as a redundant paralog) requires
    worm phenotypes; this determines its relevance to mitochondrial surveillance and
    stress signaling.
  resolution: >-
    Test ppgn-1 loss-of-function against UPRmt (hsp-6p::GFP), respiration, mitochondrial
    morphology, and pathogen/stress-resistance assays, side by side with spg-7.
  provenance:
  - reference_id: PMID:16239145
    supporting_text: >-
      Inactivation of AAA proteases causes pleiotropic phenotypes in various organisms,
      including respiratory deficiencies, mitochondrial morphology defects, and axonal
      degeneration in hereditary spastic paraplegia (HSP).
suggested_questions:
- question: >-
    Does ppgn-1 form a functional m-AAA protease complex on its own, or does it require
    the AFG3L2-type subunit spg-7, and are the two subunits functionally redundant in
    C. elegans?
  experts:
  - C. elegans mitochondrial biologists
  - m-AAA protease / AAA+ protease structural biochemists
- question: >-
    What are the endogenous substrates of ppgn-1 in C. elegans, and does it mature a
    MrpL32 homolog to regulate mitochondrial ribosome assembly as in yeast and mouse?
  experts:
  - Mitochondrial proteostasis / ribosome assembly researchers
suggested_experiments:
- experiment_type: Reverse genetics / phenotyping
  description: >-
    Generate a ppgn-1 null allele (CRISPR) and, in parallel with spg-7 RNAi/mutant, assay
    respiration, mitochondrial morphology, UPRmt (hsp-6p::GFP), fertility and lifespan to
    determine ppgn-1's non-redundant contribution.
- experiment_type: Affinity purification / mass spectrometry
  description: >-
    Endogenously tag ppgn-1, purify from worm mitochondria, and identify complex partners
    (test for spg-7 hetero-oligomerization) and, using a catalytically dead HExxH mutant
    as a substrate trap, capture processed/degraded substrates.
- experiment_type: Localization
  description: >-
    Determine ppgn-1 tissue expression and sub-mitochondrial topology with an endogenous
    fluorescent tag and protease-protection assays, to confirm the predicted inner-membrane,
    matrix-facing catalytic-domain topology.