Focused fly function hypothesis

Hypothesis: The Drosophila melanogaster protein Q9VV60 binds resveratrol.

Target: Drosophila melanogaster (NCBITaxon:7227), UniProt Q9VV60. Gene label: TyrRS. Verify identity and isoform independently; the gene label is not evidence for the hypothesis.

Original prediction

F:resveratrol binding

Decisive question

Evaluate biochemical resveratrol recognition by the supplied fly TyrRS sequence using verified ligand-bound structures, experimentally tested contact residues and conformational requirements in characterized TyrRS proteins. Establish the transferability of the binding pocket rather than relying on whole-protein similarity. Assess assay conditions, controls and compound isomer where reported. If docking is used, include meaningful controls and treat scores as hypotheses, not measured binding or evidence of physiological function. Separate binding from downstream stress signaling and from whether this interaction merits a GO molecular-function annotation; check the current status and scope of the emitted term independently.

Identity and sequence

• Target record: https://www.uniprot.org/uniprotkb/Q9VV60/entry
• FlyBase identifier(s) from the cohort identity mapping: FBgn0027080.
• Frozen current UniProt sequence: 525 residues; SHA-256 94682a9b94b943a5eca242d7bb960b2787dc2557781933a8d5849bd5e371a01f.
• The sequence was frozen for the fly cohort on 2026-09-08. It is not established as the original prediction-time input. Analyze this sequence explicitly and document any alternate accession, version or isoform you analyze.

>Q9VV60 Drosophila melanogaster TyrRS
MVGITPAEKKALITRNLQETLGDDKLTKILAERDLKIYWGTATTGKPHVAYFVPMSKIAD
FLKAGCEVTILFADLHAYLDNMKAPWSLLELRTKYYEQVIKAMLSSIGVPLEKLKFVKGS
DYQLSKEYTLDVYKLSSVVTQHDAKKAGAEVVKQVEYPLLSGLLYPGLQALDEEYLKVDA
QFGGVDQRKIFTFSEKYLPQLGYEKRIHFMNPMVPGLAGGKMSSSEEDSKIDLLDSPANV
KKKLKKAFCEPGNIADNGLLSFVKHVLFSLFKEGEGFEVNREAEHGGDVTFLKYEDLEKY
YAEDKLHPGDLKATVEKYINRLLDPIRKAFENPELQKLSAAAYPPPAKVKAGAAPAAGAD
EDAPHRLDIRVGKVVEVARHPDADTLYVLKIDLAEAQPRTIISGLVKFVTEEELNQRLVA
VLCNLKPSKMRGILSEGMVLCTSNADHTVVEPIVLPATATAGSRLSFEGFSGTPDEQLNP
KKKVWEKLSADFKTNSDGLAVWKDNFLLTPEGEKLSSKLANCSIK

Primary literature lead to inspect (not a preassigned conclusion): https://pubmed.ncbi.nlm.nih.gov/25533949/

Evidence and deliverable

Use primary literature and public sequence, structural and genomic resources. This is a focused mechanistic investigation, not a general gene overview. Seek supporting, contrary and competing explanations; an unresolved result is acceptable. Distinguish direct fly experiments, justified transfers and results on a different isoform. Do not equate missing target experiments with evidence of absence.

Do not consult the ai-gene-review repository's current reviews, generated research summaries or local bioinformatics analyses; these are held out for comparison. Agreement with ARBA or repeated prediction text does not validate the biology. Save executed methods/code, actual analysis outputs, sequence identifiers and primary-source URLs/DOIs/PMIDs. Report decisive evidence and limitations, not just a verdict. Do not fabricate computations or use docking/structural resemblance alone as experimental validation.