Focused function hypothesis
Hypothesis: The horse protein F7A4N8 enables kinase activity.
Target: Equus caballus (NCBITaxon:9796), UniProt F7A4N8. Gene label: CTDSP2; verify identity independently rather than treating the label as proof.
Target GO claim: GO:0016301 — kinase activity. Verify its definition and scope.
Decisive question
Determine whether this exact sequence supports a kinase fold and phosphotransfer mechanism. Establish its family independently; if a kinase mechanism is unsupported, identify the strongest alternative explanation without assuming the gene label is correct.
Identity and sequence inputs
- Target record: https://www.uniprot.org/uniprotkb/F7A4N8/entry
- Human comparison lead: https://www.uniprot.org/uniprotkb/O14595/entry (CTDSP2). Establish the relevant orthology/isoform relationship rather than assuming it.
- Frozen current UniProt sequence: 174 residues; SHA-256
94788163d6db3dbca3e1432762d7b2a1e8b57e1be2048c233c505a07a0b5042c. - These are current sequences downloaded for the cohort on 2026-09-08. Identity with the original prediction-time input has not been established. Evaluate the supplied sequence explicitly; document any different sequence used.
>F7A4N8 Equus caballus CTDSP2
MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHVGQSSPSTELS
TYKEEANTIAKSDLLQCLQYQFYQGIRFWGTARVHPTAALASISMSRALHRPQGRRGRGA
STVSSFSTSWPSSGASLGCSLSSRLLDKPRSSQSSAGGLLGLSWWQISAACLWF
Evidence and deliverable
Use primary literature and public sequence, structural and genomic resources. Select analyses that answer the decisive question; this is not a general gene review. Assess support and contrary evidence, and allow an unresolved outcome. Distinguish directly observed horse evidence, justified mammalian transfer, and results for a different protein model.
Do not consult the ai-gene-review repository's existing judgments, research syntheses or local bioinformatics analyses. Those are held out for comparison. Do not use agreement with ARBA or another prediction as biological validation. Preserve reproducible methods, accessions/versions, actual computation outputs and primary-source URLs/DOIs/PMIDs. Report the decisive findings and limitations, not just a verdict.