Focused function hypothesis

Warnings (1)

Focused function hypothesis

Hypothesis: The horse protein F6S899 catalyzes NAD-dependent lysine desuccinylation.

Target: Equus caballus (NCBITaxon:9796), UniProt F6S899. Gene label: SIRT5; verify identity independently rather than treating the label as proof.

Decisive question

Evaluate the structural and cofactor requirements for this single catalytic activity in the exact sequence. Compare characterized mammalian proteins and relevant public structures. Distinguish a functional target protein from a family label or a different transcript product.

Identity and sequence inputs

>F6S899 Equus caballus SIRT5
MRPLQIVHSRLISRLCCGLKSAASTQTKICLTMARPSSNMADFRKFFAKAKHIVVISGAG
ISAESGVPTFRGAGGYWRKWKAQDLATPQAFARNPSQVWEFYHYRREVVQTKEPNPGHLA
IAQCEARLHKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPI
CPALSGKGSPDPETQSARIPAENLPRWEHPLWSILPPCLPPRCLPGEFQWPNSTWKPPQP
QADSGFISRGPVVRLFLKPLLTKPKLFLNCPGEGRNYSASVY

Evidence and deliverable

Use primary literature and public sequence, structural and genomic resources. Select analyses that answer the decisive question; this is not a general gene review. Assess support and contrary evidence, and allow an unresolved outcome. Distinguish directly observed horse evidence, justified mammalian transfer, and results for a different protein model.

Do not consult the ai-gene-review repository's existing judgments, research syntheses or local bioinformatics analyses. Those are held out for comparison. Do not use agreement with ARBA or another prediction as biological validation. Preserve reproducible methods, accessions/versions, actual computation outputs and primary-source URLs/DOIs/PMIDs. Report the decisive findings and limitations, not just a verdict.