Focused function hypothesis

Warnings (1)

Focused function hypothesis

Hypothesis: The horse protein A0A9L0T3C1 negatively regulates autophagy.

Target: Equus caballus (NCBITaxon:9796), UniProt A0A9L0T3C1. Gene label: MTMR9; verify identity independently rather than treating the label as proof.

Target GO claim: GO:0010507 — negative regulation of autophagy. Verify its definition and scope.

Decisive question

Evaluate the partner-dependent mechanism for this process and whether the exact protein supports it. Identify experimentally grounded partners and substrate pathways. Distinguish complex formation, enzyme regulation and the direction of an autophagy phenotype.

Identity and sequence inputs

>A0A9L0T3C1 Equus caballus MTMR9
MEFAELIRTPRVDNVVLHRPFYPAVEGTLCLTGHHLILSSRQDNTEELWLLHSNIDAIDK
RFVGPLGTIIIKCKDFRIIQLDIPGMEECLNIASSIETSEWRLSYVNKEFAVCPSYPPIV
IVPKSIDDEALRKVATFRHGGRFPVLSYYHKKNGMVIMRSGQPLTGTNGRRCKEDEKLIN
ATLRAGKRGYIIDTRSLTVAQQARAKGGGFEQEAHYPQWRRIHKSIERYHILQESLIKLV
EACNDQTHNMDRWLSKLEASNWLTHIKEILTTACLAAQCIDREGASILIHGTEGTDSTLQ
VTSLAQIILEPRSRTIRGFEALIEREWLQAGHPFQQRCAQSAYCNSKQKWESPVFLLFLD
CVWQILRQFPCSFEFNENFLIMLFEHAYASQFGTFLGNNESERCKLKLQQKTMSLWSWVN
RPSELRKFTSPLFEANNLVIWPSVAPQSLHLWEGIFLRWNRSSKYLDEAYEEMVNIIEYN
KELQAKVNILRRQLAELETEDGMQESP

Evidence and deliverable

Use primary literature and public sequence, structural and genomic resources. Select analyses that answer the decisive question; this is not a general gene review. Assess support and contrary evidence, and allow an unresolved outcome. Distinguish directly observed horse evidence, justified mammalian transfer, and results for a different protein model.

Do not consult the ai-gene-review repository's existing judgments, research syntheses or local bioinformatics analyses. Those are held out for comparison. Do not use agreement with ARBA or another prediction as biological validation. Preserve reproducible methods, accessions/versions, actual computation outputs and primary-source URLs/DOIs/PMIDs. Report the decisive findings and limitations, not just a verdict.