Focused fly function hypothesis

Hypothesis: The Drosophila melanogaster protein Q9VB17 contributes enzymatically to fatty-acid oxidation.

Target: Drosophila melanogaster (NCBITaxon:7227), UniProt Q9VB17. Gene label: CG5611. Verify identity and isoform independently; the gene label is not evidence for the hypothesis.

Original prediction

Could possibly oxidize fatty acids using specific components

Decisive question

Identify the best-supported biochemical reaction of this exact protein and determine whether it participates in fatty-acid oxidation. Use experimentally characterized homologs, subfamily placement, active-site geometry and relevant targeting or pathway context. Compare credible alternative reactions and substrates within the same broad fold. The original wording is tentative and mechanistically ambiguous: do not silently strengthen it into direct oxidoreductase catalysis. An auxiliary hydratase/isomerase role in an oxidation pathway and direct fatty-acid oxidation are different claims. Report the best defensible specificity, including an unresolved result if necessary.

Identity and sequence

• Target record: https://www.uniprot.org/uniprotkb/Q9VB17/entry
• FlyBase identifier(s) from the cohort identity mapping: FBgn0039531.
• Frozen current UniProt sequence: 326 residues; SHA-256 24288a1fe155fc15bd2f9f7ea8a64806adbbbb4e70d1086093e2b3aa14d5ece7.
• The sequence was frozen for the fly cohort on 2026-09-08. It is not established as the original prediction-time input. Analyze this sequence explicitly and document any alternate accession, version or isoform you analyze.

>Q9VB17 Drosophila melanogaster CG5611
MSRFVYKLLQSANQTSSGCRRISLATVRNAESESQEGAPARTVLVEKDSHITLIGLNREQ
QRNSIDANTAEQLTEAISQFEADDTSPVGVLYGIGGSFCAGYDLEELEAEAQRGSLNFLL
RHEGSVGPTRRHLRKPLVCGISGFCVAGGLELALMCDLRVMEDTAVLGFFNRRLGVPLSD
GGTVRLAAAVGYSNALEIIATGRRIYSGEARRIGLVNRVVATGTALGQAVNLAFSIAKFP
MASLMHDRNAVLENANAYNKPGFHVASYNEIMNVTSDMITDMQEGVKRFKNSEIKGPKTD
SWSIKEKTIPDWEKAEIEIEKQKQKT

Evidence and deliverable

Use primary literature and public sequence, structural and genomic resources. This is a focused mechanistic investigation, not a general gene overview. Seek supporting, contrary and competing explanations; an unresolved result is acceptable. Distinguish direct fly experiments, justified transfers and results on a different isoform. Do not equate missing target experiments with evidence of absence.

Do not consult the ai-gene-review repository's current reviews, generated research summaries or local bioinformatics analyses; these are held out for comparison. Agreement with ARBA or repeated prediction text does not validate the biology. Save executed methods/code, actual analysis outputs, sequence identifiers and primary-source URLs/DOIs/PMIDs. Report decisive evidence and limitations, not just a verdict. Do not fabricate computations or use docking/structural resemblance alone as experimental validation.